F431883

General Info

Members Datasets Scaffolds Average Seq Length
390 155 780 243

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2881147464|2881154395
Length 255
Sequence RKPDAGRVASRATAGAPGNAAPLLKVSSLGAGYGGMPVLREVSLEVDKAEIVALVGSNGAGKTTLLRALSRVIGSTGMIEFAGHDLAPMTPDEAFGAGLVQVPEGRQLFDRMSVEDNLLMGAYRRGDGRAIGRDLERIYGLFPRLGERRRQLAGSLSGGEQQMCAMARGLMAAPVLLMIDEMSLGLAPVVVEQLMEVLAAIRKDGVTILLVEQDVHLALSGADRGYVMETGRIVHHGAAKDLIDDPEVRRAYLGL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
32 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
33 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
34 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
62 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
63 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
64 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
151 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
152 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
153 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
154 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
155 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.26
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0.77
Rhizoplane 3.08
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10147107 3300005327 Bacteria 1971
2 Ga0070680_100153123 3300005336 Bacteria 1936
3 Ga0070689_100454383 3300005340 Bacteria 1090
4 Ga0070714_100422562 3300005435 Bacteria 1263
5 Ga0070714_100899306 3300005435 Bacteria 859
6 Ga0070713_100061680 3300005436 Bacteria 3137
7 Ga0070681_10053777 3300005458 Bacteria 4012
8 Ga0070681_10115339 3300005458 Bacteria 2624
9 Ga0070681_10126358 3300005458 Bacteria 2490
10 Ga0070681_10595575 3300005458 Bacteria 1020
11 Ga0070706_100200931 3300005467 Bacteria 1862
12 Ga0070707_100591590 3300005468 Bacteria 1072
13 Ga0070684_100121055 3300005535 Bacteria 2354
14 Ga0070697_100001199 3300005536 Bacteria 19616
15 Ga0068853_100315806 3300005539 Bacteria 1448
16 Ga0070695_100004798 3300005545 Bacteria 7958
17 Ga0070665_100200426 3300005548 Bacteria 1996
18 Ga0068855_100327470 3300005563 Unclassified 1692
19 Ga0068857_100756735 3300005577 Unclassified 926
20 Ga0068856_100561084 3300005614 Bacteria 1163
21 Ga0075430_100028969 3300006846 Bacteria 4700
22 Ga0075431_100038648 3300006847 Bacteria 4915
23 Ga0075433_10245321 3300006852 Bacteria 1590
24 Ga0075436_100005687 3300006914 Bacteria 8558
25 Ga0105240_10161694 3300009093 Bacteria 2659
26 Ga0105240_10439495 3300009093 Bacteria 1462
27 Ga0111539_10422275 3300009094 Bacteria 1553
28 Ga0114129_10000198 3300009147 Bacteria 66798
29 Ga0114129_10449474 3300009147 Bacteria 1690
30 Ga0105238_10159574 3300009551 Unclassified 2230
31 Ga0157370_10206651 3300013104 Bacteria 1821
32 Ga0157370_10212936 3300013104 Bacteria 1791
33 Ga0157369_10009833 3300013105 Bacteria 10930
34 Ga0157369_10150126 3300013105 Bacteria 2463
35 Ga0157372_10191579 3300013307 Bacteria 2368
36 Ga0157372_10530183 3300013307 Unclassified 1373
37 Ga0157380_10653270 3300014326 Bacteria 1049
38 Ga0157379_10347732 3300014968 Bacteria 1357
39 Ga0213872_10046938 3300021361 Bacteria 1965
40 Ga0213874_10103008 3300021377 Bacteria 951
41 Ga0224572_1003389 3300024225 Bacteria 2684
42 Ga0228598_1014194 3300024227 Bacteria 1576
43 Ga0209672_108393 3300025228 Bacteria 1532
44 Ga0209455_1000858 3300025272 Bacteria 16228
45 Ga0207647_10171431 3300025904 Bacteria 1263
46 Ga0207705_10075516 3300025909 Bacteria 2448
47 Ga0207684_10300075 3300025910 Bacteria 1385
48 Ga0207707_10016582 3300025912 Bacteria 6422
49 Ga0207707_10061630 3300025912 Bacteria 3264
50 Ga0207707_10229439 3300025912 Bacteria 1615
51 Ga0207695_10172557 3300025913 Bacteria 2087
52 Ga0207695_10183948 3300025913 Bacteria 2010
53 Ga0207660_10031312 3300025917 Bacteria 3661
54 Ga0207700_10013430 3300025928 Bacteria 5328
55 Ga0207700_10256482 3300025928 Bacteria 1496
56 Ga0207690_10363044 3300025932 Bacteria 1148
57 Ga0207670_10649492 3300025936 Bacteria 870
58 Ga0207704_10312135 3300025938 Bacteria 1209
59 Ga0207661_10054294 3300025944 Bacteria 3209
60 Ga0207667_10109202 3300025949 Bacteria 2853
61 Ga0207667_10206307 3300025949 Bacteria 2015
62 Ga0207712_10444042 3300025961 Bacteria 1099
63 Ga0207678_10034140 3300026067 Bacteria 4431
64 Ga0207678_10258738 3300026067 Bacteria 1491
65 Ga0207674_10256434 3300026116 Unclassified 1696
66 Ga0265338_10007612 3300028800 Bacteria 13371
67 Ga0265338_10024590 3300028800 Bacteria 6147
68 Ga0265760_10013124 3300031090 Bacteria 2371
69 Ga0265325_10006660 3300031241 Bacteria 6988
70 Ga0265340_10031812 3300031247 Bacteria 2636
71 Ga0265340_10040621 3300031247 Bacteria 2291
72 Ga0265339_10000109 3300031249 Bacteria 66969
73 Ga0265313_10000054 3300031595 Bacteria 110199
74 Ga0316575_10103973 3300031665 Bacteria 1156
75 Ga0265314_10120149 3300031711 Bacteria 1655
76 Ga0265342_10062655 3300031712 Bacteria 2188
77 Ga0265342_10087926 3300031712 Bacteria 1785
78 Ga0316576_10010604 3300031727 Bacteria 5998
79 Ga0316583_10009109 3300032133 Bacteria 3580
80 Ga0373956_0004024 3300035119 Bacteria 5905
81 Ga0373956_0050879 3300035119 Bacteria 1861
82 Ga0373957_0007369 3300035120 Bacteria 3519
83 Ga0373955_0064887 3300035172 Bacteria 2025
84 Ga0316574_0190113 3300035398 Bacteria 1320
85 Ga0373933_0001112 3300035724 Bacteria 16015
86 Ga0373937_0001726 3300036401 Bacteria 18377
87 Ga0373937_0003821 3300036401 Bacteria 12726
88 Ga0316582_0238513 3300036647 Bacteria 1245
89 Ga0395899_0064066 3300037312 Bacteria 2703
90 Ga0395900_0005282 3300037418 Bacteria 13539
91 Ga0395900_0006728 3300037418 Bacteria 11933
92 Ga0395900_0009460 3300037418 Bacteria 9989
93 Ga0395900_0274966 3300037418 Bacteria 1678
94 Ga0395900_0431166 3300037418 Bacteria 1277
95 Ga0395898_0008548 3300037466 Bacteria 10814
96 Ga0395898_0223477 3300037466 Bacteria 1796
97 Ga0395898_0276631 3300037466 Bacteria 1601
98 Ga0395905_0067158 3300037471 Bacteria 3359
99 Ga0395905_0321657 3300037471 Bacteria 1437
100 Ga0395901_0046220 3300038443 Bacteria 4521
101 Ga0395901_0162759 3300038443 Bacteria 2343
102 Ga0395901_0233072 3300038443 Bacteria 1922
103 Ga0436365_0664828 3300039437 Bacteria 896
104 Ga0436360_0253616 3300039438 Bacteria 1509
105 Ga0436361_0666462 3300039447 Bacteria 7731
106 Ga0436363_0141013 3300039450 Bacteria 1510
107 Ga0436363_0869206 3300039450 Bacteria 3503
108 Ga0450900_013349 3300042136 Bacteria 1084
109 Ga0451577_0058592 3300042876 Bacteria 3433
110 Ga0466963_0021008 3300044694 Bacteria 4114
111 Ga0453684_0027082 3300044712 Bacteria 8239
112 Ga0453684_0031873 3300044712 Bacteria 7392
113 Ga0453684_0056424 3300044712 Bacteria 5095
114 Ga0466957_0105854 3300044842 Bacteria 1778
115 Ga0466958_0048089 3300045836 Bacteria 2576
116 Ga0495592_0014586 3300046454 Bacteria 5964
117 Ga0495651_0174857 3300046462 Bacteria 1525
118 Ga0495580_0244054 3300046472 Bacteria 1231
119 Ga0495618_0105165 3300046514 Bacteria 1807
120 Ga0495630_0284453 3300046517 Bacteria 1263
121 Ga0495665_0006316 3300046531 Bacteria 6394
122 Ga0495640_0059121 3300046533 Bacteria 2612
123 Ga0495645_0331333 3300046543 Bacteria 985
124 Ga0495634_0005443 3300046642 Bacteria 9794
125 Ga0495636_0069466 3300047318 Bacteria 1501
126 Ga0495684_0003115 3300047471 Bacteria 13017
127 Ga0495602_0295430 3300048088 Bacteria 1188
128 Ga0496100_0055862 3300048903 Bacteria 2581
129 Ga0496101_0215296 3300048904 Bacteria 1489
130 Ga0496104_0250328 3300048907 Bacteria 1684
131 Ga0496104_0254927 3300048907 Unclassified 1667
132 Ga0496105_0024886 3300048908 Bacteria 4866
133 Ga0496108_0242348 3300048911 Unclassified 1568
134 Ga0496109_0035083 3300048912 Unclassified 4523
135 Ga0496109_0128228 3300048912 Bacteria 2367
136 Ga0496110_0044266 3300048913 Unclassified 3887
137 Ga0496111_0051801 3300048914 Unclassified 2964
138 Ga0496113_0523974 3300048916 Unclassified 951
139 Ga0496114_0235886 3300048917 Bacteria 1608
140 Ga0501031_0001433 3300049568 Bacteria 14778
141 Ga0501031_0002711 3300049568 Bacteria 11274
142 Ga0501031_0029644 3300049568 Bacteria 3569
143 Ga0501031_0031155 3300049568 Bacteria 3479
144 Ga0501031_0067045 3300049568 Bacteria 2338
145 Ga0501031_0178972 3300049568 Bacteria 1385
146 Ga0501031_0353441 3300049568 Bacteria 951
147 Ga0501032_0002972 3300049569 Bacteria 13158
148 Ga0501032_0005831 3300049569 Bacteria 9110
149 Ga0501032_0006330 3300049569 Bacteria 8725
150 Ga0501032_0021807 3300049569 Bacteria 4448
151 Ga0501032_0026781 3300049569 Bacteria 3963
152 Ga0501032_0044259 3300049569 Bacteria 3014
153 Ga0501032_0052159 3300049569 Bacteria 2756
154 Ga0501032_0200620 3300049569 Bacteria 1302
155 Ga0501032_0297588 3300049569 Bacteria 1043
156 Ga0501033_0000491 3300049570 Bacteria 37247
157 Ga0501033_0001064 3300049570 Bacteria 25051
158 Ga0501033_0003048 3300049570 Bacteria 13930
159 Ga0501033_0003984 3300049570 Bacteria 11956
160 Ga0501033_0031246 3300049570 Bacteria 4002
161 Ga0501033_0037066 3300049570 Bacteria 3651
162 Ga0501033_0039173 3300049570 Bacteria 3540
163 Ga0501033_0063023 3300049570 Bacteria 2729
164 Ga0501033_0090934 3300049570 Bacteria 2232
165 Ga0501033_0110081 3300049570 Bacteria 2005
166 Ga0501033_0153795 3300049570 Bacteria 1658
167 Ga0501033_0316999 3300049570 Bacteria 1096
168 Ga0501034_0003792 3300049571 Bacteria 17058
169 Ga0501034_0038995 3300049571 Bacteria 4811
170 Ga0501034_0078298 3300049571 Bacteria 3310
171 Ga0501034_0090899 3300049571 Bacteria 3050
172 Ga0501034_0111637 3300049571 Bacteria 2724
173 Ga0501034_0132138 3300049571 Bacteria 2479
174 Ga0501034_0153745 3300049571 Bacteria 2276
175 Ga0501034_0262024 3300049571 Bacteria 1671
176 Ga0501034_0282140 3300049571 Bacteria 1600
177 Ga0501034_0425269 3300049571 Bacteria 1249
178 Ga0501036_0000389 3300049572 Bacteria 30927
179 Ga0501036_0000657 3300049572 Bacteria 25357
180 Ga0501036_0008161 3300049572 Bacteria 8582
181 Ga0501036_0044463 3300049572 Bacteria 3762
182 Ga0501036_0045888 3300049572 Bacteria 3700
183 Ga0501036_0067687 3300049572 Bacteria 3022
184 Ga0501036_0084871 3300049572 Bacteria 2677
185 Ga0501036_0091569 3300049572 Bacteria 2568
186 Ga0501036_0091570 3300049572 Bacteria 2568
187 Ga0501036_0269758 3300049572 Bacteria 1425
188 Ga0501036_0675996 3300049572 Bacteria 854
189 Ga0501037_0000242 3300049573 Bacteria 46822
190 Ga0501037_0003351 3300049573 Bacteria 11642
191 Ga0501037_0007385 3300049573 Bacteria 8040
192 Ga0501037_0014301 3300049573 Bacteria 5849
193 Ga0501037_0029806 3300049573 Bacteria 4031
194 Ga0501037_0044157 3300049573 Bacteria 3274
195 Ga0501037_0051617 3300049573 Bacteria 3007
196 Ga0501037_0060760 3300049573 Bacteria 2756
197 Ga0501037_0079714 3300049573 Bacteria 2376
198 Ga0501037_0142333 3300049573 Bacteria 1716
199 Ga0501037_0174066 3300049573 Bacteria 1529
200 Ga0501037_0190054 3300049573 Bacteria 1454
201 Ga0501038_0000414 3300049574 Bacteria 36995
202 Ga0501038_0002561 3300049574 Bacteria 16947
203 Ga0501038_0004565 3300049574 Bacteria 12887
204 Ga0501038_0019665 3300049574 Bacteria 6079
205 Ga0501038_0052877 3300049574 Bacteria 3500
206 Ga0501038_0054953 3300049574 Bacteria 3422
207 Ga0501038_0201181 3300049574 Bacteria 1598
208 Ga0501038_0277421 3300049574 Bacteria 1320
209 Ga0501038_0362119 3300049574 Bacteria 1128
210 Ga0501039_0001213 3300049575 Bacteria 18933
211 Ga0501039_0005887 3300049575 Bacteria 9289
212 Ga0501039_0030366 3300049575 Bacteria 4168
213 Ga0501039_0048231 3300049575 Bacteria 3292
214 Ga0501039_0065909 3300049575 Bacteria 2810
215 Ga0501039_0098865 3300049575 Bacteria 2276
216 Ga0501039_0431653 3300049575 Bacteria 1035
217 Ga0501040_0001518 3300049576 Bacteria 14731
218 Ga0501040_0042405 3300049576 Bacteria 3099
219 Ga0501041_0005122 3300049577 Bacteria 7645
220 Ga0501041_0036570 3300049577 Bacteria 2974
221 Ga0501042_0000450 3300049578 Bacteria 21127
222 Ga0501042_0017171 3300049578 Bacteria 4987
223 Ga0501043_0000440 3300049579 Bacteria 37461
224 Ga0501043_0003602 3300049579 Bacteria 12716
225 Ga0501043_0004851 3300049579 Bacteria 10869
226 Ga0501043_0009172 3300049579 Bacteria 7777
227 Ga0501043_0024562 3300049579 Bacteria 4729
228 Ga0501043_0033261 3300049579 Bacteria 4056
229 Ga0501043_0063473 3300049579 Bacteria 2900
230 Ga0501043_0069908 3300049579 Bacteria 2757
231 Ga0501043_0094768 3300049579 Bacteria 2346
232 Ga0501043_0117467 3300049579 Bacteria 2087
233 Ga0501043_0148357 3300049579 Bacteria 1836
234 Ga0501043_0310140 3300049579 Bacteria 1204
235 Ga0501043_0531192 3300049579 Bacteria 876
236 Ga0501046_0002040 3300049580 Bacteria 19198
237 Ga0501046_0005439 3300049580 Bacteria 11384
238 Ga0501046_0011601 3300049580 Bacteria 7532
239 Ga0501046_0018353 3300049580 Bacteria 5822
240 Ga0501046_0064979 3300049580 Bacteria 2847
241 Ga0501046_0083126 3300049580 Bacteria 2472
242 Ga0501046_0102672 3300049580 Bacteria 2192
243 Ga0501046_0145577 3300049580 Bacteria 1790
244 Ga0501047_0002605 3300049581 Bacteria 17170
245 Ga0501047_0009900 3300049581 Bacteria 9012
246 Ga0501047_0016670 3300049581 Bacteria 7017
247 Ga0501047_0024269 3300049581 Bacteria 5821
248 Ga0501047_0091884 3300049581 Bacteria 2913
249 Ga0501047_0144508 3300049581 Bacteria 2256
250 Ga0501047_0163707 3300049581 Bacteria 2095
251 Ga0501047_0229064 3300049581 Bacteria 1712
252 Ga0501047_0559454 3300049581 Bacteria 967
253 Ga0501048_0000526 3300049582 Bacteria 26953
254 Ga0501048_0005338 3300049582 Bacteria 9782
255 Ga0501048_0028284 3300049582 Bacteria 4069
256 Ga0501048_0036627 3300049582 Bacteria 3525
257 Ga0501048_0044512 3300049582 Bacteria 3174
258 Ga0501048_0111223 3300049582 Bacteria 1934
259 Ga0501067_0004016 3300049583 Bacteria 8118
260 Ga0501067_0009601 3300049583 Bacteria 5360
261 Ga0501067_0016242 3300049583 Bacteria 4114
262 Ga0501067_0150429 3300049583 Bacteria 1297
263 Ga0501067_0207233 3300049583 Bacteria 1092
264 Ga0501068_0001262 3300049584 Bacteria 13425
265 Ga0501068_0005032 3300049584 Bacteria 7200
266 Ga0501068_0049905 3300049584 Bacteria 2528
267 Ga0501068_0067204 3300049584 Bacteria 2184
268 Ga0501068_0266590 3300049584 Bacteria 1093
269 Ga0501068_0325546 3300049584 Bacteria 985
270 Ga0501069_0000017 3300049585 Bacteria 141492
271 Ga0501069_0000794 3300049585 Bacteria 14862
272 Ga0501069_0007385 3300049585 Bacteria 5766
273 Ga0501069_0011751 3300049585 Bacteria 4643
274 Ga0501069_0012003 3300049585 Bacteria 4598
275 Ga0501069_0078744 3300049585 Bacteria 1854
276 Ga0501070_0000236 3300049586 Bacteria 52046
277 Ga0501070_0005231 3300049586 Bacteria 11062
278 Ga0501070_0005469 3300049586 Bacteria 10842
279 Ga0501070_0015307 3300049586 Bacteria 6453
280 Ga0501070_0024284 3300049586 Bacteria 5083
281 Ga0501070_0049355 3300049586 Bacteria 3495
282 Ga0501070_0161678 3300049586 Bacteria 1846
283 Ga0501070_0355492 3300049586 Bacteria 1189
284 Ga0501071_0000478 3300049587 Bacteria 20200
285 Ga0501071_0093958 3300049587 Bacteria 2205
286 Ga0501071_0418555 3300049587 Bacteria 1024
287 Ga0501072_0006717 3300049588 Bacteria 8745
288 Ga0501072_0050423 3300049588 Bacteria 3277
289 Ga0501072_0075689 3300049588 Bacteria 2662
290 Ga0501072_0346092 3300049588 Bacteria 1180
291 Ga0501072_0402255 3300049588 Bacteria 1086
292 Ga0501073_0003198 3300049589 Bacteria 12293
293 Ga0501073_0061819 3300049589 Bacteria 2613
294 Ga0501073_0068771 3300049589 Bacteria 2468
295 Ga0501073_0108916 3300049589 Bacteria 1922
296 Ga0501073_0188370 3300049589 Bacteria 1427
297 Ga0501074_0000038 3300049590 Bacteria 62674
298 Ga0501074_0002336 3300049590 Bacteria 13194
299 Ga0501074_0002688 3300049590 Bacteria 12449
300 Ga0501074_0005206 3300049590 Bacteria 9349
301 Ga0501074_0177348 3300049590 Bacteria 1520
302 Ga0501075_0002011 3300049591 Bacteria 13447
303 Ga0501075_0099330 3300049591 Bacteria 2210
304 Ga0501076_0001256 3300049592 Bacteria 16903
305 Ga0501076_0019612 3300049592 Bacteria 5171
306 Ga0501077_0000074 3300049593 Bacteria 50267
307 Ga0501079_0000179 3300049741 Bacteria 36096
308 Ga0501079_0025352 3300049741 Bacteria 4549
309 Ga0501079_0093381 3300049741 Bacteria 2331
310 Ga0501079_0193585 3300049741 Bacteria 1587
311 Ga0501079_0467263 3300049741 Bacteria 991
312 Ga0501079_0531029 3300049741 Bacteria 925
313 Ga0501079_0752446 3300049741 Bacteria 767
314 Ga0501080_0000477 3300049742 Bacteria 31151
315 Ga0501080_0001489 3300049742 Bacteria 19766
316 Ga0501080_0006975 3300049742 Bacteria 10197
317 Ga0501080_0017659 3300049742 Bacteria 6598
318 Ga0501080_0046542 3300049742 Bacteria 4039
319 Ga0501080_0071145 3300049742 Bacteria 3235
320 Ga0501080_0107564 3300049742 Bacteria 2585
321 Ga0501080_0143540 3300049742 Bacteria 2207
322 Ga0501080_0146981 3300049742 Bacteria 2179
323 Ga0501080_0209909 3300049742 Bacteria 1785
324 Ga0501080_0213191 3300049742 Bacteria 1769
325 Ga0501080_0534171 3300049742 Bacteria 1046
326 Ga0501081_0000044 3300049743 Bacteria 47269
327 Ga0501081_0008130 3300049743 Bacteria 6809
328 Ga0501081_0093663 3300049743 Bacteria 2115
329 Ga0501083_0000486 3300049744 Bacteria 25482
330 Ga0501083_0011161 3300049744 Bacteria 6305
331 Ga0501083_0032744 3300049744 Bacteria 3563
332 Ga0501083_0139435 3300049744 Bacteria 1588
333 Ga0501035_0000101 3300049822 Bacteria 106949
334 Ga0501035_0000686 3300049822 Bacteria 36991
335 Ga0501035_0002218 3300049822 Bacteria 19286
336 Ga0501035_0014629 3300049822 Bacteria 7244
337 Ga0501035_0014671 3300049822 Bacteria 7234
338 Ga0501035_0018627 3300049822 Bacteria 6394
339 Ga0501035_0024725 3300049822 Bacteria 5506
340 Ga0501035_0049227 3300049822 Bacteria 3777
341 Ga0501035_0101218 3300049822 Bacteria 2528
342 Ga0501035_0159481 3300049822 Bacteria 1953
343 Ga0501035_0160325 3300049822 Bacteria 1947
344 Ga0501035_0165596 3300049822 Bacteria 1912
345 Ga0501035_0182523 3300049822 Bacteria 1807
346 Ga0501035_0195774 3300049822 Bacteria 1736
347 Ga0501035_0250797 3300049822 Bacteria 1503
348 Ga0501044_0000010 3300049823 Bacteria 260121
349 Ga0501044_0001056 3300049823 Bacteria 33138
350 Ga0501044_0001117 3300049823 Bacteria 31880
351 Ga0501044_0019527 3300049823 Bacteria 7247
352 Ga0501044_0025725 3300049823 Bacteria 6239
353 Ga0501044_0034502 3300049823 Bacteria 5305
354 Ga0501044_0035088 3300049823 Bacteria 5254
355 Ga0501044_0063192 3300049823 Bacteria 3783
356 Ga0501044_0110560 3300049823 Bacteria 2756
357 Ga0501044_0121973 3300049823 Bacteria 2606
358 Ga0501044_0134123 3300049823 Bacteria 2468
359 Ga0501044_0189771 3300049823 Bacteria 2018
360 Ga0501044_0305837 3300049823 Bacteria 1517
361 Ga0501044_0382404 3300049823 Bacteria 1322
362 Ga0501044_0596464 3300049823 Bacteria 998
363 Ga0501045_0006446 3300049824 Bacteria 8130
364 Ga0501045_0026457 3300049824 Bacteria 4173
365 Ga0501045_0102028 3300049824 Bacteria 2124
366 nmdc:mga05p37_285303_c1 3300050507 Bacteria 1967
367 nmdc:mga05p37_5561_c1 3300050507 Bacteria 14818
368 nmdc:mga06r32_440950_c1 3300050510 Bacteria 1282
369 nmdc:mga0n895_1287350_c1 3300050512 Bacteria 702
370 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
371 Ga0495601_0119987 3300053077 Bacteria 1707
372 Ga0495595_0036230 3300053084 Bacteria 2238
373 Ga0495619_0075413 3300053085 Bacteria 2263
374 Ga0501084_0001704 3300054114 Bacteria 17462
375 Ga0501084_0029695 3300054114 Bacteria 4574
376 Ga0501084_0052244 3300054114 Bacteria 3420
377 Ga0501084_0073656 3300054114 Bacteria 2860
378 Ga0590071_001043 3300059421 Bacteria 7516
379 Ga0501082_0001379 3300060353 Bacteria 21365
380 Ga0501082_0008643 3300060353 Bacteria 8781
381 Ga0501082_0124854 3300060353 Bacteria 2232
382 Ga0530510_0000651 3300061734 Bacteria 22445
383 Ga0530510_0006995 3300061734 Bacteria 7859
384 Ga0530510_0322636 3300061734 Bacteria 1158
385 2881154395 2881147464 Bacteria 7779814
386 2864999486 2864997549 Bacteria 5139696
387 2874124861 2874123672 Bacteria 7238285
388 2881928511 2881927736 Bacteria 3993927
389 2980131053 2980125574 Bacteria 5567337
390 3005724530 3005718088 Bacteria 8283608
391 Ga0070658_10147107
392 Ga0070680_100153123
393 Ga0070689_100454383
394 Ga0070714_100422562
395 Ga0070714_100899306
396 Ga0070713_100061680
397 Ga0070681_10053777
398 Ga0070681_10115339
399 Ga0070681_10126358
400 Ga0070681_10595575
401 Ga0070706_100200931
402 Ga0070707_100591590
403 Ga0070684_100121055
404 Ga0070697_100001199
405 Ga0068853_100315806
406 Ga0070695_100004798
407 Ga0070665_100200426
408 Ga0068855_100327470
409 Ga0068857_100756735
410 Ga0068856_100561084
411 Ga0075430_100028969
412 Ga0075431_100038648
413 Ga0075433_10245321
414 Ga0075436_100005687
415 Ga0105240_10161694
416 Ga0105240_10439495
417 Ga0111539_10422275
418 Ga0114129_10000198
419 Ga0114129_10449474
420 Ga0105238_10159574
421 Ga0157370_10206651
422 Ga0157370_10212936
423 Ga0157369_10009833
424 Ga0157369_10150126
425 Ga0157372_10191579
426 Ga0157372_10530183
427 Ga0157380_10653270
428 Ga0157379_10347732
429 Ga0213872_10046938
430 Ga0213874_10103008
431 Ga0224572_1003389
432 Ga0228598_1014194
433 Ga0209672_108393
434 Ga0209455_1000858
435 Ga0207647_10171431
436 Ga0207705_10075516
437 Ga0207684_10300075
438 Ga0207707_10016582
439 Ga0207707_10061630
440 Ga0207707_10229439
441 Ga0207695_10172557
442 Ga0207695_10183948
443 Ga0207660_10031312
444 Ga0207700_10013430
445 Ga0207700_10256482
446 Ga0207690_10363044
447 Ga0207670_10649492
448 Ga0207704_10312135
449 Ga0207661_10054294
450 Ga0207667_10109202
451 Ga0207667_10206307
452 Ga0207712_10444042
453 Ga0207678_10034140
454 Ga0207678_10258738
455 Ga0207674_10256434
456 Ga0265338_10007612
457 Ga0265338_10024590
458 Ga0265760_10013124
459 Ga0265325_10006660
460 Ga0265340_10031812
461 Ga0265340_10040621
462 Ga0265339_10000109
463 Ga0265313_10000054
464 Ga0316575_10103973
465 Ga0265314_10120149
466 Ga0265342_10062655
467 Ga0265342_10087926
468 Ga0316576_10010604
469 Ga0316583_10009109
470 Ga0373956_0004024
471 Ga0373956_0050879
472 Ga0373957_0007369
473 Ga0373955_0064887
474 Ga0316574_0190113
475 Ga0373933_0001112
476 Ga0373937_0001726
477 Ga0373937_0003821
478 Ga0316582_0238513
479 Ga0395899_0064066
480 Ga0395900_0005282
481 Ga0395900_0006728
482 Ga0395900_0009460
483 Ga0395900_0274966
484 Ga0395900_0431166
485 Ga0395898_0008548
486 Ga0395898_0223477
487 Ga0395898_0276631
488 Ga0395905_0067158
489 Ga0395905_0321657
490 Ga0395901_0046220
491 Ga0395901_0162759
492 Ga0395901_0233072
493 Ga0436365_0664828
494 Ga0436360_0253616
495 Ga0436361_0666462
496 Ga0436363_0141013
497 Ga0436363_0869206
498 Ga0450900_013349
499 Ga0451577_0058592
500 Ga0466963_0021008
501 Ga0453684_0027082
502 Ga0453684_0031873
503 Ga0453684_0056424
504 Ga0466957_0105854
505 Ga0466958_0048089
506 Ga0495592_0014586
507 Ga0495651_0174857
508 Ga0495580_0244054
509 Ga0495618_0105165
510 Ga0495630_0284453
511 Ga0495665_0006316
512 Ga0495640_0059121
513 Ga0495645_0331333
514 Ga0495634_0005443
515 Ga0495636_0069466
516 Ga0495684_0003115
517 Ga0495602_0295430
518 Ga0496100_0055862
519 Ga0496101_0215296
520 Ga0496104_0250328
521 Ga0496104_0254927
522 Ga0496105_0024886
523 Ga0496108_0242348
524 Ga0496109_0035083
525 Ga0496109_0128228
526 Ga0496110_0044266
527 Ga0496111_0051801
528 Ga0496113_0523974
529 Ga0496114_0235886
530 Ga0501031_0001433
531 Ga0501031_0002711
532 Ga0501031_0029644
533 Ga0501031_0031155
534 Ga0501031_0067045
535 Ga0501031_0178972
536 Ga0501031_0353441
537 Ga0501032_0002972
538 Ga0501032_0005831
539 Ga0501032_0006330
540 Ga0501032_0021807
541 Ga0501032_0026781
542 Ga0501032_0044259
543 Ga0501032_0052159
544 Ga0501032_0200620
545 Ga0501032_0297588
546 Ga0501033_0000491
547 Ga0501033_0001064
548 Ga0501033_0003048
549 Ga0501033_0003984
550 Ga0501033_0031246
551 Ga0501033_0037066
552 Ga0501033_0039173
553 Ga0501033_0063023
554 Ga0501033_0090934
555 Ga0501033_0110081
556 Ga0501033_0153795
557 Ga0501033_0316999
558 Ga0501034_0003792
559 Ga0501034_0038995
560 Ga0501034_0078298
561 Ga0501034_0090899
562 Ga0501034_0111637
563 Ga0501034_0132138
564 Ga0501034_0153745
565 Ga0501034_0262024
566 Ga0501034_0282140
567 Ga0501034_0425269
568 Ga0501036_0000389
569 Ga0501036_0000657
570 Ga0501036_0008161
571 Ga0501036_0044463
572 Ga0501036_0045888
573 Ga0501036_0067687
574 Ga0501036_0084871
575 Ga0501036_0091569
576 Ga0501036_0091570
577 Ga0501036_0269758
578 Ga0501036_0675996
579 Ga0501037_0000242
580 Ga0501037_0003351
581 Ga0501037_0007385
582 Ga0501037_0014301
583 Ga0501037_0029806
584 Ga0501037_0044157
585 Ga0501037_0051617
586 Ga0501037_0060760
587 Ga0501037_0079714
588 Ga0501037_0142333
589 Ga0501037_0174066
590 Ga0501037_0190054
591 Ga0501038_0000414
592 Ga0501038_0002561
593 Ga0501038_0004565
594 Ga0501038_0019665
595 Ga0501038_0052877
596 Ga0501038_0054953
597 Ga0501038_0201181
598 Ga0501038_0277421
599 Ga0501038_0362119
600 Ga0501039_0001213
601 Ga0501039_0005887
602 Ga0501039_0030366
603 Ga0501039_0048231
604 Ga0501039_0065909
605 Ga0501039_0098865
606 Ga0501039_0431653
607 Ga0501040_0001518
608 Ga0501040_0042405
609 Ga0501041_0005122
610 Ga0501041_0036570
611 Ga0501042_0000450
612 Ga0501042_0017171
613 Ga0501043_0000440
614 Ga0501043_0003602
615 Ga0501043_0004851
616 Ga0501043_0009172
617 Ga0501043_0024562
618 Ga0501043_0033261
619 Ga0501043_0063473
620 Ga0501043_0069908
621 Ga0501043_0094768
622 Ga0501043_0117467
623 Ga0501043_0148357
624 Ga0501043_0310140
625 Ga0501043_0531192
626 Ga0501046_0002040
627 Ga0501046_0005439
628 Ga0501046_0011601
629 Ga0501046_0018353
630 Ga0501046_0064979
631 Ga0501046_0083126
632 Ga0501046_0102672
633 Ga0501046_0145577
634 Ga0501047_0002605
635 Ga0501047_0009900
636 Ga0501047_0016670
637 Ga0501047_0024269
638 Ga0501047_0091884
639 Ga0501047_0144508
640 Ga0501047_0163707
641 Ga0501047_0229064
642 Ga0501047_0559454
643 Ga0501048_0000526
644 Ga0501048_0005338
645 Ga0501048_0028284
646 Ga0501048_0036627
647 Ga0501048_0044512
648 Ga0501048_0111223
649 Ga0501067_0004016
650 Ga0501067_0009601
651 Ga0501067_0016242
652 Ga0501067_0150429
653 Ga0501067_0207233
654 Ga0501068_0001262
655 Ga0501068_0005032
656 Ga0501068_0049905
657 Ga0501068_0067204
658 Ga0501068_0266590
659 Ga0501068_0325546
660 Ga0501069_0000017
661 Ga0501069_0000794
662 Ga0501069_0007385
663 Ga0501069_0011751
664 Ga0501069_0012003
665 Ga0501069_0078744
666 Ga0501070_0000236
667 Ga0501070_0005231
668 Ga0501070_0005469
669 Ga0501070_0015307
670 Ga0501070_0024284
671 Ga0501070_0049355
672 Ga0501070_0161678
673 Ga0501070_0355492
674 Ga0501071_0000478
675 Ga0501071_0093958
676 Ga0501071_0418555
677 Ga0501072_0006717
678 Ga0501072_0050423
679 Ga0501072_0075689
680 Ga0501072_0346092
681 Ga0501072_0402255
682 Ga0501073_0003198
683 Ga0501073_0061819
684 Ga0501073_0068771
685 Ga0501073_0108916
686 Ga0501073_0188370
687 Ga0501074_0000038
688 Ga0501074_0002336
689 Ga0501074_0002688
690 Ga0501074_0005206
691 Ga0501074_0177348
692 Ga0501075_0002011
693 Ga0501075_0099330
694 Ga0501076_0001256
695 Ga0501076_0019612
696 Ga0501077_0000074
697 Ga0501079_0000179
698 Ga0501079_0025352
699 Ga0501079_0093381
700 Ga0501079_0193585
701 Ga0501079_0467263
702 Ga0501079_0531029
703 Ga0501079_0752446
704 Ga0501080_0000477
705 Ga0501080_0001489
706 Ga0501080_0006975
707 Ga0501080_0017659
708 Ga0501080_0046542
709 Ga0501080_0071145
710 Ga0501080_0107564
711 Ga0501080_0143540
712 Ga0501080_0146981
713 Ga0501080_0209909
714 Ga0501080_0213191
715 Ga0501080_0534171
716 Ga0501081_0000044
717 Ga0501081_0008130
718 Ga0501081_0093663
719 Ga0501083_0000486
720 Ga0501083_0011161
721 Ga0501083_0032744
722 Ga0501083_0139435
723 Ga0501035_0000101
724 Ga0501035_0000686
725 Ga0501035_0002218
726 Ga0501035_0014629
727 Ga0501035_0014671
728 Ga0501035_0018627
729 Ga0501035_0024725
730 Ga0501035_0049227
731 Ga0501035_0101218
732 Ga0501035_0159481
733 Ga0501035_0160325
734 Ga0501035_0165596
735 Ga0501035_0182523
736 Ga0501035_0195774
737 Ga0501035_0250797
738 Ga0501044_0000010
739 Ga0501044_0001056
740 Ga0501044_0001117
741 Ga0501044_0019527
742 Ga0501044_0025725
743 Ga0501044_0034502
744 Ga0501044_0035088
745 Ga0501044_0063192
746 Ga0501044_0110560
747 Ga0501044_0121973
748 Ga0501044_0134123
749 Ga0501044_0189771
750 Ga0501044_0305837
751 Ga0501044_0382404
752 Ga0501044_0596464
753 Ga0501045_0006446
754 Ga0501045_0026457
755 Ga0501045_0102028
756 nmdc:mga05p37_285303_c1
757 nmdc:mga05p37_5561_c1
758 nmdc:mga06r32_440950_c1
759 nmdc:mga0n895_1287350_c1
760 nmdc:mga08x19_35_c1
761 Ga0495601_0119987
762 Ga0495595_0036230
763 Ga0495619_0075413
764 Ga0501084_0001704
765 Ga0501084_0029695
766 Ga0501084_0052244
767 Ga0501084_0073656
768 Ga0590071_001043
769 Ga0501082_0001379
770 Ga0501082_0008643
771 Ga0501082_0124854
772 Ga0530510_0000651
773 Ga0530510_0006995
774 Ga0530510_0322636
775 2881154395
776 2864999486
777 2874124861
778 2881928511
779 2980131053
780 3005724530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

39

183

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9733 12 245
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9456 12 245
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9255 14 244
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9204 14 242
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9191 14 232
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9712 10 245 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9631 10 245 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9625 13 244 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9595 12 245 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9466 13 244 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X8Z9E7-F1-model_v4 ABC transporter ATP-binding protein 0.9896 13 245 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A496QUQ5-F1-model_v4 ABC transporter ATP-binding protein 0.9868 14 245 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A6G6K803-F1-model_v4 ABC transporter ATP-binding protein 0.9865 13 245 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A127JRR5-F1-model_v4 ABC transporter ATP-binding protein 0.9862 12 245 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7T2SAA5-F1-model_v4 ABC transporter ATP-binding protein 0.9857 12 245 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Map