F431811

General Info

Members Datasets Scaffolds Average Seq Length
390 197 386 291

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0009041|Ga0495629_0009041_1787_2758
Length 323
Sequence LTQQYLAGDRNHASQAGCTLSTPISPDPRGLASVSTFTPISLTSTDGLALYARDYPAAAGQAHLPVICIHGLTRNSSDFDELAPEIARLGRRVLAVDVRGRGHSQRDPNPDNYKPAVYAGDIEKMMHDLGLSRAVFVGTSMGGLITMLLAARNIDLVAAAILNDIGPVISPKGLARIAGYTGKSAALTGWDQAAGYVKDINQCAFPANSDEEWLKWARRAFEQDLEGKLCARYDPNIAIALQTGTLRPTSLAARAAFKRLTRKRPTLLVRGGISDLVEPHQAAWMRKMAPDMQYAEVPNVGHAPMLTEPEALAAIRNFLAQVA

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221684 Massilia sp. Root133 Isolate Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
97 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
98 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
99 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0.51
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.64
Nodule 0.51
Rhizoplane 3.59
Rhizosphere 77.44
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000382 3300002739 Bacteria 9385
2 JGI25152J39213_1000081 3300002773 Bacteria 65382
3 JGI25150J39212_1000295 3300002774 Bacteria 25413
4 JGI25150J39212_1001420 3300002774 Bacteria 6735
5 JGI25150J39212_1009992 3300002774 Bacteria 1785
6 JGI25159J45721_1002906 3300002987 Bacteria 6255
7 JGI25153J46596_10003708 3300003215 Bacteria 8443
8 rootH2_10285230 3300003320 Bacteria 1346
9 JGI25161J50226_1000125 3300003374 Bacteria 56088
10 JGI25161J50226_1008789 3300003374 Bacteria 1513
11 Ga0007409J51694_1021157 3300003575 Bacteria 3535
12 Ga0055526_1001151 3300003771 Bacteria 19182
13 Ga0055526_1002707 3300003771 Bacteria 11776
14 Ga0055537_1000289 3300003773 Bacteria 35664
15 Ga0055524_1000076 3300003775 Bacteria 121769
16 Ga0055524_1000617 3300003775 Bacteria 25512
17 Ga0055524_1002303 3300003775 Bacteria 9950
18 Ga0055524_1007141 3300003775 Bacteria 4782
19 Ga0055534_1000066 3300003784 Bacteria 80944
20 Ga0055534_1006517 3300003784 Bacteria 2928
21 Ga0055534_1011200 3300003784 Bacteria 1836
22 Ga0055528_1000036 3300003790 Bacteria 116393
23 Ga0055530_10001200 3300003791 Bacteria 20028
24 Ga0055531_10015234 3300003794 Bacteria 3405
25 Ga0055543_1000063 3300004625 Bacteria 98011
26 Ga0065165_1002003 3300005262 Bacteria 19080
27 Ga0065165_1012560 3300005262 Bacteria 3441
28 Ga0065165_1018132 3300005262 Bacteria 2562
29 Ga0070658_10001507 3300005327 Bacteria 19770
30 Ga0070658_10134108 3300005327 Bacteria 2065
31 Ga0070658_10316398 3300005327 Bacteria 1332
32 Ga0070683_100244915 3300005329 Bacteria 1705
33 Ga0070680_100064247 3300005336 Bacteria 3008
34 Ga0070660_100000393 3300005339 Bacteria 29017
35 Ga0070660_100087308 3300005339 Bacteria 2455
36 Ga0070660_100183168 3300005339 Bacteria 1695
37 Ga0070692_10000436 3300005345 Bacteria 12687
38 Ga0070659_100060470 3300005366 Bacteria 2992
39 Ga0070667_100028601 3300005367 Bacteria 4641
40 Ga0070663_100000836 3300005455 Bacteria 16662
41 Ga0068855_100001751 3300005563 Bacteria 27092
42 Ga0068855_100063923 3300005563 Bacteria 4293
43 Ga0068855_100292079 3300005563 Bacteria 1807
44 Ga0068855_100369211 3300005563 Bacteria 1578
45 Ga0070664_100032444 3300005564 Bacteria 4369
46 Ga0068863_100066989 3300005841 Bacteria 3396
47 Ga0068860_100068896 3300005843 Bacteria 3362
48 Ga0099826_10000005 3300006948 Bacteria 465206
49 Ga0105245_10104244 3300009098 Bacteria 2629
50 Ga0105243_10014513 3300009148 Bacteria 5960
51 Ga0105241_10017745 3300009174 Bacteria 5234
52 Ga0105242_10028416 3300009176 Bacteria 4452
53 Ga0105248_10009240 3300009177 Bacteria 10846
54 Ga0105249_10216975 3300009553 Bacteria 1881
55 Ga0105246_10055871 3300011119 Bacteria 2726
56 Ga0157371_10001298 3300013102 Bacteria 26285
57 Ga0157370_10029398 3300013104 Bacteria 5393
58 Ga0157375_10148327 3300013308 Bacteria 2478
59 Ga0157380_10004052 3300014326 Bacteria 10104
60 Ga0157380_10807044 3300014326 Unclassified 956
61 Ga0213872_10001493 3300021361 Bacteria 15098
62 Ga0209436_100056 3300025208 Bacteria 61172
63 Ga0209563_100003 3300025230 Bacteria 1932942
64 Ga0207425_1000001 3300025245 Bacteria 2525432
65 Ga0207425_1000039 3300025245 Bacteria 219078
66 Ga0207425_1006576 3300025245 Bacteria 3162
67 Ga0209677_102118 3300025253 Bacteria 7794
68 Ga0209129_1000001 3300025258 Bacteria 1452436
69 Ga0209129_1004384 3300025258 Bacteria 5541
70 Ga0209565_1000017 3300025263 Bacteria 462438
71 Ga0209565_1000826 3300025263 Bacteria 17586
72 Ga0209565_1009054 3300025263 Bacteria 2559
73 Ga0209565_1026389 3300025263 Bacteria 1165
74 Ga0209673_1000007 3300025273 Bacteria 634477
75 Ga0209130_1000128 3300025284 Bacteria 123595
76 Ga0209675_1000009 3300025291 Bacteria 562872
77 Ga0209675_1000620 3300025291 Bacteria 25347
78 Ga0209675_1008750 3300025291 Bacteria 3669
79 Ga0209564_1000036 3300025295 Bacteria 423455
80 Ga0209564_1000055 3300025295 Bacteria 343782
81 Ga0209564_1000109 3300025295 Bacteria 212912
82 Ga0209564_1014040 3300025295 Bacteria 3358
83 Ga0209564_1019918 3300025295 Bacteria 2483
84 Ga0209564_1038812 3300025295 Bacteria 1319
85 Ga0209758_1000020 3300025297 Bacteria 734220
86 Ga0209050_1000074 3300025298 Bacteria 289334
87 Ga0209050_1000628 3300025298 Bacteria 55015
88 Ga0209256_1000028 3300025299 Bacteria 420213
89 Ga0209256_1000090 3300025299 Bacteria 212541
90 Ga0209256_1000167 3300025299 Bacteria 133419
91 Ga0209256_1000621 3300025299 Bacteria 48888
92 Ga0209256_1000751 3300025299 Bacteria 42247
93 Ga0207426_1002180 3300025302 Bacteria 13239
94 Ga0209257_1000003 3300025304 Bacteria 1702593
95 Ga0209257_1016088 3300025304 Bacteria 3053
96 Ga0207647_10043566 3300025904 Bacteria 2808
97 Ga0207705_10000654 3300025909 Bacteria 28865
98 Ga0207705_10008429 3300025909 Bacteria 7526
99 Ga0207705_10014382 3300025909 Bacteria 5695
100 Ga0207657_10000165 3300025919 Bacteria 67173
101 Ga0207657_10001054 3300025919 Bacteria 29233
102 Ga0207657_10004691 3300025919 Bacteria 14430
103 Ga0207657_10086765 3300025919 Bacteria 2619
104 Ga0207649_10017268 3300025920 Bacteria 4090
105 Ga0207649_10088215 3300025920 Bacteria 2025
106 Ga0207687_10033612 3300025927 Bacteria 3479
107 Ga0207690_10067232 3300025932 Bacteria 2457
108 Ga0207706_10127031 3300025933 Bacteria 2242
109 Ga0207709_10049122 3300025935 Bacteria 2573
110 Ga0207711_10001496 3300025941 Bacteria 21764
111 Ga0207679_10090463 3300025945 Bacteria 2366
112 Ga0207667_10000579 3300025949 Bacteria 47716
113 Ga0207667_10330857 3300025949 Bacteria 1555
114 Ga0207658_10009372 3300025986 Bacteria 6640
115 Ga0207678_10008877 3300026067 Bacteria 8851
116 Ga0207678_10240298 3300026067 Bacteria 1551
117 Ga0207641_10006218 3300026088 Bacteria 10101
118 Ga0207648_10128983 3300026089 Bacteria 2225
119 Ga0207674_10210410 3300026116 Bacteria 1894
120 Ga0207698_10086605 3300026142 Bacteria 2548
121 Ga0209282_1000003 3300027666 Bacteria 856377
122 Ga0268264_10059405 3300028381 Bacteria 3204
123 Ga0307408_100000126 3300031548 Bacteria 84345
124 Ga0307408_100016149 3300031548 Bacteria 4978
125 Ga0307405_10044751 3300031731 Bacteria 2708
126 Ga0307413_10036236 3300031824 Bacteria 2838
127 Ga0307413_10096988 3300031824 Bacteria 1937
128 Ga0307410_10163308 3300031852 Bacteria 1671
129 Ga0307410_10290244 3300031852 Bacteria 1287
130 Ga0307412_10004525 3300031911 Bacteria 7745
131 Ga0307412_10039656 3300031911 Bacteria 3042
132 Ga0307416_100308127 3300032002 Bacteria 1578
133 Ga0307414_10030195 3300032004 Bacteria 3538
134 Ga0307414_10120168 3300032004 Bacteria 2018
135 Ga0307411_10013978 3300032005 Bacteria 4452
136 Ga0395899_0000129 3300037312 Bacteria 118043
137 Ga0395899_0000378 3300037312 Bacteria 53364
138 Ga0395899_0002589 3300037312 Bacteria 14582
139 Ga0395899_0036639 3300037312 Bacteria 3678
140 Ga0395899_0063113 3300037312 Bacteria 2726
141 Ga0395900_0000263 3300037418 Bacteria 81724
142 Ga0395900_0001554 3300037418 Bacteria 27256
143 Ga0395900_0002367 3300037418 Bacteria 20833
144 Ga0395900_0069056 3300037418 Bacteria 3631
145 Ga0395900_0100790 3300037418 Bacteria 2966
146 Ga0395898_0006037 3300037466 Bacteria 13005
147 Ga0395898_0009619 3300037466 Bacteria 10149
148 Ga0395898_0117306 3300037466 Bacteria 2550
149 Ga0395898_0148801 3300037466 Bacteria 2241
150 Ga0395898_0195277 3300037466 Bacteria 1933
151 Ga0395898_0265203 3300037466 Bacteria 1638
152 Ga0395898_0277263 3300037466 Bacteria 1599
153 Ga0395898_0517763 3300037466 Bacteria 1134
154 Ga0395905_0000323 3300037471 Bacteria 69005
155 Ga0395905_0085346 3300037471 Bacteria 2958
156 Ga0395905_0145619 3300037471 Bacteria 2229
157 Ga0395905_0633175 3300037471 Bacteria 971
158 Ga0395901_0000362 3300038443 Bacteria 54976
159 Ga0395901_0001239 3300038443 Bacteria 27244
160 Ga0395901_0001793 3300038443 Bacteria 22145
161 Ga0395901_0071887 3300038443 Bacteria 3605
162 Ga0395901_0243579 3300038443 Bacteria 1874
163 Ga0395901_0316155 3300038443 Bacteria 1616
164 Ga0395901_0370400 3300038443 Bacteria 1475
165 Ga0436361_0062622 3300039447 Bacteria 1007
166 Ga0436361_0128853 3300039447 Bacteria 981
167 Ga0436361_0216872 3300039447 Bacteria 21502
168 Ga0439448_0000330 3300042005 Bacteria 10540
169 Ga0439449_0041731 3300042007 Bacteria 1706
170 Ga0439450_001677 3300042008 Bacteria 3303
171 Ga0439455_0000774 3300042012 Bacteria 4814
172 Ga0439455_0024125 3300042012 Bacteria 1470
173 Ga0450904_000322 3300042139 Bacteria 10110
174 Ga0450916_013222 3300042530 Bacteria 1062
175 Ga0466965_0142821 3300044683 Bacteria 1247
176 Ga0466965_0144502 3300044683 Bacteria 1240
177 Ga0466963_0060040 3300044694 Bacteria 2539
178 Ga0466964_0000618 3300044706 Bacteria 11331
179 Ga0466964_0003749 3300044706 Bacteria 5566
180 Ga0466971_0075831 3300044719 Bacteria 1529
181 Ga0466968_0006603 3300044735 Bacteria 4377
182 Ga0466957_0071386 3300044842 Bacteria 2147
183 Ga0466960_0090302 3300044901 Bacteria 1560
184 Ga0466958_0013954 3300045836 Bacteria 4581
185 Ga0466967_0025998 3300045976 Bacteria 4839
186 Ga0466967_0536609 3300045976 Bacteria 1150
187 Ga0495603_0019314 3300046455 Bacteria 4125
188 Ga0495629_0009041 3300046459 Bacteria 7306
189 Ga0495638_0000694 3300046460 Bacteria 36523
190 Ga0495638_0021641 3300046460 Bacteria 4233
191 Ga0495638_0113282 3300046460 Bacteria 1609
192 Ga0495653_0077609 3300046463 Bacteria 2466
193 Ga0495650_0000011 3300046471 Bacteria 615329
194 Ga0495650_0036880 3300046471 Bacteria 2134
195 Ga0495580_0085146 3300046472 Bacteria 2202
196 Ga0495582_0048925 3300046473 Bacteria 2328
197 Ga0495605_0000183 3300046474 Bacteria 77763
198 Ga0495605_0084804 3300046474 Bacteria 1476
199 Ga0495584_0000003 3300046491 Bacteria 323768
200 Ga0495584_0005104 3300046491 Bacteria 6973
201 Ga0495584_0006838 3300046491 Bacteria 5959
202 Ga0495585_0000010 3300046492 Bacteria 229958
203 Ga0495585_0000442 3300046492 Bacteria 39742
204 Ga0495585_0000445 3300046492 Bacteria 39560
205 Ga0495585_0001079 3300046492 Bacteria 22503
206 Ga0495585_0010797 3300046492 Bacteria 5426
207 Ga0495585_0015553 3300046492 Bacteria 4421
208 Ga0495585_0041712 3300046492 Bacteria 2573
209 Ga0495585_0105481 3300046492 Bacteria 1503
210 Ga0495594_0015658 3300046499 Bacteria 3986
211 Ga0495594_0022493 3300046499 Bacteria 3372
212 Ga0495594_0023450 3300046499 Bacteria 3307
213 Ga0495594_0089767 3300046499 Bacteria 1721
214 Ga0495594_0153291 3300046499 Bacteria 1308
215 Ga0495596_0000023 3300046500 Bacteria 110071
216 Ga0495596_0007708 3300046500 Bacteria 4839
217 Ga0495607_0001538 3300046501 Bacteria 20234
218 Ga0495607_0021411 3300046501 Bacteria 4069
219 Ga0495583_0000199 3300046506 Bacteria 100936
220 Ga0495583_0000308 3300046506 Bacteria 77290
221 Ga0495583_0001015 3300046506 Bacteria 32043
222 Ga0495583_0002703 3300046506 Bacteria 14728
223 Ga0495583_0006327 3300046506 Bacteria 7772
224 Ga0495583_0071621 3300046506 Bacteria 1522
225 Ga0495583_0075401 3300046506 Bacteria 1475
226 Ga0495606_0008436 3300046507 Bacteria 8952
227 Ga0495606_0008804 3300046507 Bacteria 8662
228 Ga0495606_0018431 3300046507 Bacteria 5232
229 Ga0495606_0166442 3300046507 Bacteria 1282
230 Ga0495606_0180776 3300046507 Bacteria 1216
231 Ga0495616_0000560 3300046513 Bacteria 28175
232 Ga0495616_0001289 3300046513 Bacteria 17606
233 Ga0495616_0018769 3300046513 Bacteria 3788
234 Ga0495616_0026978 3300046513 Bacteria 3051
235 Ga0495616_0049897 3300046513 Bacteria 2095
236 Ga0495616_0169907 3300046513 Bacteria 975
237 Ga0495620_0002412 3300046515 Bacteria 10831
238 Ga0495631_0054051 3300046518 Bacteria 1752
239 Ga0495631_0070097 3300046518 Bacteria 1516
240 Ga0495632_0003705 3300046519 Bacteria 10711
241 Ga0495632_0004588 3300046519 Bacteria 9359
242 Ga0495632_0012318 3300046519 Bacteria 4936
243 Ga0495637_0015984 3300046520 Bacteria 3514
244 Ga0495643_0000247 3300046522 Bacteria 79969
245 Ga0495643_0002104 3300046522 Bacteria 16470
246 Ga0495643_0029383 3300046522 Bacteria 3075
247 Ga0495643_0034227 3300046522 Bacteria 2804
248 Ga0495643_0077005 3300046522 Bacteria 1743
249 Ga0495644_0012341 3300046523 Bacteria 3285
250 Ga0495644_0016265 3300046523 Bacteria 2848
251 Ga0495644_0042399 3300046523 Bacteria 1713
252 Ga0495648_0000003 3300046524 Bacteria 386817
253 Ga0495648_0003267 3300046524 Bacteria 14352
254 Ga0495663_0002807 3300046525 Bacteria 5149
255 Ga0495666_0000573 3300046526 Bacteria 16457
256 Ga0495666_0009125 3300046526 Bacteria 4961
257 Ga0495666_0022408 3300046526 Bacteria 3128
258 Ga0495666_0066556 3300046526 Bacteria 1717
259 Ga0495642_0011649 3300046528 Bacteria 3384
260 Ga0495642_0160580 3300046528 Bacteria 974
261 Ga0495654_0061055 3300046530 Bacteria 1811
262 Ga0495665_0003815 3300046531 Bacteria 8155
263 Ga0495665_0045488 3300046531 Bacteria 2331
264 Ga0495665_0150601 3300046531 Bacteria 1214
265 Ga0495586_0041782 3300046535 Bacteria 2469
266 Ga0495587_0015246 3300046536 Bacteria 4801
267 Ga0495609_0011735 3300046538 Bacteria 4166
268 Ga0495609_0054613 3300046538 Bacteria 1773
269 Ga0495597_0000889 3300046542 Bacteria 23283
270 Ga0495597_0143158 3300046542 Bacteria 985
271 Ga0495622_0004204 3300046557 Bacteria 6712
272 Ga0495622_0006061 3300046557 Bacteria 5617
273 Ga0495622_0011451 3300046557 Bacteria 4099
274 Ga0495622_0051238 3300046557 Bacteria 1915
275 Ga0495633_0006468 3300046558 Bacteria 6934
276 Ga0495633_0007019 3300046558 Bacteria 6567
277 Ga0495633_0009468 3300046558 Bacteria 5376
278 Ga0495633_0083263 3300046558 Bacteria 1488
279 Ga0495656_0001536 3300046615 Bacteria 7543
280 Ga0495656_0030833 3300046615 Bacteria 2170
281 Ga0495656_0161432 3300046615 Bacteria 1089
282 Ga0495668_0016445 3300046616 Bacteria 4300
283 Ga0495668_0023676 3300046616 Bacteria 3499
284 Ga0495668_0034625 3300046616 Bacteria 2831
285 Ga0495668_0136691 3300046616 Bacteria 1342
286 Ga0495611_0002711 3300046648 Bacteria 7981
287 Ga0495611_0010352 3300046648 Bacteria 3946
288 Ga0495611_0015161 3300046648 Bacteria 3294
289 Ga0495625_0002032 3300046660 Bacteria 22791
290 Ga0495625_0023173 3300046660 Bacteria 4745
291 Ga0495625_0025825 3300046660 Bacteria 4448
292 Ga0495661_0008486 3300046665 Bacteria 7103
293 Ga0495661_0061532 3300046665 Bacteria 2228
294 Ga0495661_0065408 3300046665 Bacteria 2142
295 Ga0495661_0137547 3300046665 Bacteria 1332
296 Ga0495588_0000078 3300046674 Bacteria 214254
297 Ga0495588_0085251 3300046674 Bacteria 1651
298 Ga0495588_0092183 3300046674 Bacteria 1587
299 Ga0495588_0093903 3300046674 Bacteria 1572
300 Ga0495588_0120974 3300046674 Bacteria 1380
301 Ga0495588_0161624 3300046674 Bacteria 1184
302 Ga0495599_0209135 3300046678 Bacteria 1197
303 Ga0495623_0029616 3300046679 Bacteria 3522
304 Ga0495623_0155301 3300046679 Bacteria 1349
305 Ga0495669_0010428 3300046684 Bacteria 3927
306 Ga0495669_0040391 3300046684 Bacteria 2069
307 Ga0495613_0065991 3300046689 Bacteria 2644
308 Ga0495670_0017677 3300046691 Bacteria 3511
309 Ga0495649_0005178 3300046694 Bacteria 8358
310 Ga0495589_0000350 3300046794 Bacteria 36135
311 Ga0495589_0028711 3300046794 Bacteria 2806
312 Ga0495600_0016490 3300046809 Bacteria 4688
313 Ga0495660_0000070 3300046810 Bacteria 112800
314 Ga0495660_0017483 3300046810 Bacteria 4127
315 Ga0495581_0007206 3300047315 Bacteria 6435
316 Ga0495581_0077752 3300047315 Bacteria 1920
317 Ga0495581_0163252 3300047315 Bacteria 1302
318 Ga0495604_0038368 3300047317 Bacteria 3768
319 Ga0495604_0219694 3300047317 Bacteria 1309
320 Ga0495636_0012449 3300047318 Bacteria 3368
321 Ga0495674_0006391 3300047319 Bacteria 11296
322 Ga0495674_0128202 3300047319 Bacteria 2139
323 Ga0495672_0002603 3300047320 Bacteria 16359
324 Ga0495672_0136039 3300047320 Bacteria 1288
325 Ga0495676_0096460 3300047321 Bacteria 2198
326 Ga0495683_0000177 3300047323 Bacteria 62546
327 Ga0495683_0074902 3300047323 Bacteria 1658
328 Ga0495683_0114944 3300047323 Bacteria 1281
329 Ga0495683_0163346 3300047323 Bacteria 1028
330 Ga0495687_000396 3300047443 Bacteria 54169
331 Ga0495687_002304 3300047443 Bacteria 15596
332 Ga0495675_0031892 3300047444 Bacteria 3365
333 Ga0495677_0000833 3300047445 Bacteria 12443
334 Ga0495677_0004554 3300047445 Bacteria 5302
335 Ga0495677_0033457 3300047445 Bacteria 1874
336 Ga0495677_0058106 3300047445 Bacteria 1430
337 Ga0495677_0062821 3300047445 Bacteria 1379
338 Ga0495677_0081549 3300047445 Bacteria 1213
339 Ga0495685_011893 3300047447 Bacteria 2944
340 Ga0495673_0004531 3300047469 Bacteria 8675
341 Ga0495681_0020559 3300047470 Bacteria 3580
342 Ga0495681_0024937 3300047470 Bacteria 3136
343 Ga0495681_0046331 3300047470 Bacteria 2074
344 Ga0495686_0004643 3300047472 Bacteria 11162
345 Ga0495686_0215670 3300047472 Bacteria 1094
346 Ga0495593_0043778 3300047673 Bacteria 2397
347 Ga0495602_0033512 3300048088 Bacteria 4817
348 Ga0495615_0006541 3300048090 Bacteria 2165
349 Ga0495626_0000028 3300048091 Bacteria 204580
350 Ga0495626_0003744 3300048091 Bacteria 9590
351 Ga0495626_0004748 3300048091 Bacteria 8214
352 Ga0495626_0016049 3300048091 Bacteria 3816
353 Ga0495626_0020917 3300048091 Bacteria 3254
354 Ga0495626_0027158 3300048091 Bacteria 2784
355 Ga0495626_0035799 3300048091 Bacteria 2368
356 Ga0495626_0083619 3300048091 Bacteria 1414
357 Ga0496102_0040634 3300048905 Bacteria 4208
358 Ga0496102_0188241 3300048905 Bacteria 1945
359 Ga0496102_0485714 3300048905 Bacteria 1157
360 Ga0496104_0093253 3300048907 Bacteria 2880
361 Ga0496104_0107180 3300048907 Bacteria 2678
362 Ga0496105_0248172 3300048908 Bacteria 1443
363 Ga0496106_0011792 3300048909 Bacteria 6451
364 Ga0496107_0018614 3300048910 Bacteria 4892
365 Ga0496107_0081091 3300048910 Bacteria 2367
366 Ga0496111_0261660 3300048914 Bacteria 1284
367 Ga0496113_0007315 3300048916 Bacteria 7089
368 Ga0496114_0345784 3300048917 Bacteria 1315
369 Ga0496115_0007457 3300048918 Bacteria 8050
370 Ga0496115_0008000 3300048918 Bacteria 7804
371 Ga0496122_0002576 3300048925 Bacteria 25464
372 Ga0496123_0021878 3300048926 Bacteria 4954
373 Ga0496124_0001540 3300048927 Bacteria 33442
374 Ga0496124_0019764 3300048927 Bacteria 6252
375 Ga0496124_0078463 3300048927 Bacteria 2721
376 Ga0496124_0085623 3300048927 Bacteria 2582
377 Ga0496125_0028141 3300048928 Bacteria 5082
378 Ga0495678_001797 3300049459 Bacteria 15854
379 Ga0495678_017959 3300049459 Bacteria 3191
380 Ga0495682_0009892 3300049460 Bacteria 3710
381 Ga0501047_0181206 3300049581 Bacteria 1973
382 Ga0501279_001469 3300049775 Bacteria 3088
383 Ga0501035_0000813 3300049822 Bacteria 33299
384 Ga0500604_0000115 3300053151 Bacteria 24819
385 Ga0587068_000283 3300059641 Bacteria 4210
386 Ga0466962_0134841 3300061719 Bacteria 1194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0161624 Ga0495588_0161624_235_1107 261
2 3300046674 Ga0495588_0120974 Ga0495588_0120974_386_1192 266
3 3300037466 Ga0395898_0517763 Ga0395898_0517763_189_1079 270
4 3300005366 Ga0070659_100060470 Ga0070659_1000604702 274
5 3300011119 Ga0105246_10055871 Ga0105246_100558712 274
6 3300025932 Ga0207690_10067232 Ga0207690_100672322 274
7 3300025933 Ga0207706_10127031 Ga0207706_101270311 274
8 3300026116 Ga0207674_10210410 Ga0207674_102104102 274
9 3300005563 Ga0068855_100063923 Ga0068855_1000639232 276
10 3300026142 Ga0207698_10086605 Ga0207698_100866052 276
11 3300047445 Ga0495677_0062821 Ga0495677_0062821_75_911 276
12 3300005327 Ga0070658_10134108 Ga0070658_101341082 277
13 3300005564 Ga0070664_100032444 Ga0070664_1000324442 277
14 3300009098 Ga0105245_10104244 Ga0105245_101042442 277
15 3300009148 Ga0105243_10014513 Ga0105243_100145135 277
16 3300009174 Ga0105241_10017745 Ga0105241_100177453 277
17 3300009176 Ga0105242_10028416 Ga0105242_100284163 277
18 3300025909 Ga0207705_10008429 Ga0207705_100084296 277
19 3300025927 Ga0207687_10033612 Ga0207687_100336122 277
20 3300025935 Ga0207709_10049122 Ga0207709_100491222 277
21 3300037312 Ga0395899_0002589 Ga0395899_0002589_783_1685 277
22 3300037466 Ga0395898_0195277 Ga0395898_0195277_813_1715 277
23 3300037471 Ga0395905_0633175 Ga0395905_0633175_46_921 277
24 3300046506 Ga0495583_0006327 Ga0495583_0006327_1511_2431 277
25 3300048905 Ga0496102_0188241 Ga0496102_0188241_286_1206 277
26 3300048907 Ga0496104_0093253 Ga0496104_0093253_1066_1959 277
27 3300048914 Ga0496111_0261660 Ga0496111_0261660_266_1156 277
28 3300048917 Ga0496114_0345784 Ga0496114_0345784_146_1054 277
29 3300048927 Ga0496124_0001540 Ga0496124_0001540_8175_9062 277
30 3300045976 Ga0466967_0025998 Ga0466967_0025998_2605_3525 280
31 3300003575 Ga0007409J51694_1021157 Ga0007409J51694_10211572 281
32 3300005327 Ga0070658_10316398 Ga0070658_103163982 283
33 3300047472 Ga0495686_0004643 Ga0495686_0004643_6012_6869 283
34 3300005339 Ga0070660_100183168 Ga0070660_1001831682 284
35 3300025919 Ga0207657_10086765 Ga0207657_100867653 284
36 iso_pu_bacteria 2643221554 2643790733 284
37 3300025920 Ga0207649_10017268 Ga0207649_100172682 285
38 3300005367 Ga0070667_100028601 Ga0070667_1000286012 286
39 3300005841 Ga0068863_100066989 Ga0068863_1000669894 286
40 3300005843 Ga0068860_100068896 Ga0068860_1000688962 286
41 3300009177 Ga0105248_10009240 Ga0105248_100092406 286
42 3300009553 Ga0105249_10216975 Ga0105249_102169752 286
43 3300013308 Ga0157375_10148327 Ga0157375_101483272 286
44 3300025941 Ga0207711_10001496 Ga0207711_100014965 286
45 3300025986 Ga0207658_10009372 Ga0207658_100093722 286
46 3300026088 Ga0207641_10006218 Ga0207641_100062185 286
47 3300028381 Ga0268264_10059405 Ga0268264_100594052 286
48 3300031731 Ga0307405_10044751 Ga0307405_100447512 286
49 3300031852 Ga0307410_10290244 Ga0307410_102902442 286
50 3300031911 Ga0307412_10039656 Ga0307412_100396563 286
51 3300046506 Ga0495583_0075401 Ga0495583_0075401_159_1061 286
52 3300048910 Ga0496107_0018614 Ga0496107_0018614_3489_4355 286
53 iso_pu_bacteria 2643221556 2643802688 286
54 iso_pu_bacteria 2643221684 2644472193 286
55 3300003775 Ga0055524_1000076 Ga0055524_100007646 287
56 3300005262 Ga0065165_1018132 Ga0065165_10181323 287
57 3300005327 Ga0070658_10001507 Ga0070658_1000150718 287
58 3300005329 Ga0070683_100244915 Ga0070683_1002449152 287
59 3300005339 Ga0070660_100000393 Ga0070660_1000003938 287
60 3300005345 Ga0070692_10000436 Ga0070692_100004366 287
61 3300005455 Ga0070663_100000836 Ga0070663_10000083612 287
62 3300005563 Ga0068855_100001751 Ga0068855_1000017518 287
63 3300005563 Ga0068855_100292079 Ga0068855_1002920792 287
64 3300006948 Ga0099826_10000005 Ga0099826_10000005397 287
65 3300013102 Ga0157371_10001298 Ga0157371_1000129820 287
66 3300013104 Ga0157370_10029398 Ga0157370_100293982 287
67 3300014326 Ga0157380_10004052 Ga0157380_100040522 287
68 3300014326 Ga0157380_10807044 Ga0157380_108070441 287
69 3300025295 Ga0209564_1014040 Ga0209564_10140402 287
70 3300025299 Ga0209256_1000090 Ga0209256_1000090118 287
71 3300025904 Ga0207647_10043566 Ga0207647_100435662 287
72 3300025909 Ga0207705_10000654 Ga0207705_100006548 287
73 3300025909 Ga0207705_10014382 Ga0207705_100143822 287
74 3300025919 Ga0207657_10000165 Ga0207657_1000016551 287
75 3300025919 Ga0207657_10001054 Ga0207657_100010547 287
76 3300025949 Ga0207667_10000579 Ga0207667_1000057928 287
77 3300025949 Ga0207667_10330857 Ga0207667_103308572 287
78 3300026067 Ga0207678_10008877 Ga0207678_100088774 287
79 3300027666 Ga0209282_1000003 Ga0209282_1000003407 287
80 3300031824 Ga0307413_10036236 Ga0307413_100362362 287
81 3300031824 Ga0307413_10096988 Ga0307413_100969882 287
82 3300031852 Ga0307410_10163308 Ga0307410_101633082 287
83 3300031911 Ga0307412_10004525 Ga0307412_100045255 287
84 3300032002 Ga0307416_100308127 Ga0307416_1003081272 287
85 3300032004 Ga0307414_10030195 Ga0307414_100301952 287
86 3300032004 Ga0307414_10120168 Ga0307414_101201682 287
87 3300032005 Ga0307411_10013978 Ga0307411_100139782 287
88 3300037312 Ga0395899_0000129 Ga0395899_0000129_71115_71984 287
89 3300037312 Ga0395899_0036639 Ga0395899_0036639_225_1094 287
90 3300037312 Ga0395899_0063113 Ga0395899_0063113_1633_2502 287
91 3300037418 Ga0395900_0001554 Ga0395900_0001554_10096_10965 287
92 3300037418 Ga0395900_0002367 Ga0395900_0002367_9887_10792 287
93 3300037418 Ga0395900_0069056 Ga0395900_0069056_2619_3488 287
94 3300037418 Ga0395900_0100790 Ga0395900_0100790_225_1094 287
95 3300037466 Ga0395898_0006037 Ga0395898_0006037_9877_10746 287
96 3300037466 Ga0395898_0009619 Ga0395898_0009619_5925_6794 287
97 3300037466 Ga0395898_0148801 Ga0395898_0148801_217_1122 287
98 3300037466 Ga0395898_0265203 Ga0395898_0265203_220_1089 287
99 3300037466 Ga0395898_0277263 Ga0395898_0277263_171_1064 287
100 3300037471 Ga0395905_0000323 Ga0395905_0000323_49138_50043 287
101 3300037471 Ga0395905_0145619 Ga0395905_0145619_1003_1881 287
102 3300038443 Ga0395901_0001239 Ga0395901_0001239_3037_3906 287
103 3300038443 Ga0395901_0001793 Ga0395901_0001793_16897_17802 287
104 3300038443 Ga0395901_0071887 Ga0395901_0071887_2512_3381 287
105 3300038443 Ga0395901_0243579 Ga0395901_0243579_58_951 287
106 3300038443 Ga0395901_0370400 Ga0395901_0370400_225_1094 287
107 3300044694 Ga0466963_0060040 Ga0466963_0060040_1238_2113 287
108 3300046506 Ga0495583_0002703 Ga0495583_0002703_1839_2711 287
109 3300046513 Ga0495616_0000560 Ga0495616_0000560_7020_7892 287
110 3300046520 Ga0495637_0015984 Ga0495637_0015984_1756_2628 287
111 3300046522 Ga0495643_0000247 Ga0495643_0000247_16043_16915 287
112 3300046616 Ga0495668_0023676 Ga0495668_0023676_2358_3227 287
113 3300046674 Ga0495588_0000078 Ga0495588_0000078_134706_135671 287
114 3300053151 Ga0500604_0000115 Ga0500604_0000115_18537_19442 287
115 3300002739 JGI25158J39367_1000382 JGI25158J39367_10003821 288
116 3300002773 JGI25152J39213_1000081 JGI25152J39213_100008114 288
117 3300002774 JGI25150J39212_1000295 JGI25150J39212_100029511 288
118 3300002774 JGI25150J39212_1001420 JGI25150J39212_10014206 288
119 3300002774 JGI25150J39212_1009992 JGI25150J39212_10099922 288
120 3300002987 JGI25159J45721_1002906 JGI25159J45721_10029061 288
121 3300003215 JGI25153J46596_10003708 JGI25153J46596_100037086 288
122 3300003320 rootH2_10285230 rootH2_102852302 288
123 3300003374 JGI25161J50226_1000125 JGI25161J50226_100012514 288
124 3300003374 JGI25161J50226_1008789 JGI25161J50226_10087891 288
125 3300003771 Ga0055526_1001151 Ga0055526_100115112 288
126 3300003771 Ga0055526_1002707 Ga0055526_10027074 288
127 3300003773 Ga0055537_1000289 Ga0055537_100028935 288
128 3300003775 Ga0055524_1000617 Ga0055524_100061711 288
129 3300003775 Ga0055524_1002303 Ga0055524_10023032 288
130 3300003775 Ga0055524_1007141 Ga0055524_10071413 288
131 3300003784 Ga0055534_1000066 Ga0055534_100006633 288
132 3300003784 Ga0055534_1006517 Ga0055534_10065172 288
133 3300003784 Ga0055534_1011200 Ga0055534_10112002 288
134 3300003790 Ga0055528_1000036 Ga0055528_100003642 288
135 3300003791 Ga0055530_10001200 Ga0055530_100012007 288
136 3300003794 Ga0055531_10015234 Ga0055531_100152344 288
137 3300004625 Ga0055543_1000063 Ga0055543_100006325 288
138 3300005262 Ga0065165_1002003 Ga0065165_10020037 288
139 3300005262 Ga0065165_1012560 Ga0065165_10125602 288
140 3300005336 Ga0070680_100064247 Ga0070680_1000642472 288
141 3300005339 Ga0070660_100087308 Ga0070660_1000873082 288
142 3300005563 Ga0068855_100369211 Ga0068855_1003692112 288
143 3300021361 Ga0213872_10001493 Ga0213872_100014939 288
144 3300025208 Ga0209436_100056 Ga0209436_10005616 288
145 3300025230 Ga0209563_100003 Ga0209563_100003438 288
146 3300025245 Ga0207425_1000001 Ga0207425_10000011015 288
147 3300025245 Ga0207425_1000039 Ga0207425_1000039130 288
148 3300025245 Ga0207425_1006576 Ga0207425_10065762 288
149 3300025253 Ga0209677_102118 Ga0209677_1021182 288
150 3300025258 Ga0209129_1000001 Ga0209129_1000001192 288
151 3300025258 Ga0209129_1004384 Ga0209129_10043846 288
152 3300025263 Ga0209565_1000017 Ga0209565_1000017119 288
153 3300025263 Ga0209565_1000826 Ga0209565_10008268 288
154 3300025263 Ga0209565_1009054 Ga0209565_10090544 288
155 3300025263 Ga0209565_1026389 Ga0209565_10263891 288
156 3300025273 Ga0209673_1000007 Ga0209673_1000007310 288
157 3300025284 Ga0209130_1000128 Ga0209130_100012865 288
158 3300025291 Ga0209675_1000009 Ga0209675_1000009208 288
159 3300025291 Ga0209675_1000620 Ga0209675_100062024 288
160 3300025291 Ga0209675_1008750 Ga0209675_10087504 288
161 3300025295 Ga0209564_1000036 Ga0209564_1000036310 288
162 3300025295 Ga0209564_1000055 Ga0209564_1000055143 288
163 3300025295 Ga0209564_1000109 Ga0209564_1000109133 288
164 3300025295 Ga0209564_1019918 Ga0209564_10199183 288
165 3300025295 Ga0209564_1038812 Ga0209564_10388122 288
166 3300025297 Ga0209758_1000020 Ga0209758_1000020261 288
167 3300025298 Ga0209050_1000074 Ga0209050_1000074132 288
168 3300025298 Ga0209050_1000628 Ga0209050_100062849 288
169 3300025299 Ga0209256_1000028 Ga0209256_1000028234 288
170 3300025299 Ga0209256_1000167 Ga0209256_1000167125 288
171 3300025299 Ga0209256_1000621 Ga0209256_100062111 288
172 3300025299 Ga0209256_1000751 Ga0209256_10007514 288
173 3300025302 Ga0207426_1002180 Ga0207426_10021807 288
174 3300025304 Ga0209257_1000003 Ga0209257_100000380 288
175 3300025304 Ga0209257_1016088 Ga0209257_10160882 288
176 3300025919 Ga0207657_10004691 Ga0207657_100046913 288
177 3300025920 Ga0207649_10088215 Ga0207649_100882152 288
178 3300025945 Ga0207679_10090463 Ga0207679_100904632 288
179 3300026067 Ga0207678_10240298 Ga0207678_102402981 288
180 3300026089 Ga0207648_10128983 Ga0207648_101289832 288
181 3300031548 Ga0307408_100000126 Ga0307408_10000012614 288
182 3300031548 Ga0307408_100016149 Ga0307408_1000161494 288
183 3300037312 Ga0395899_0000378 Ga0395899_0000378_34821_35693 288
184 3300037418 Ga0395900_0000263 Ga0395900_0000263_17405_18277 288
185 3300037466 Ga0395898_0117306 Ga0395898_0117306_1349_2221 288
186 3300037471 Ga0395905_0085346 Ga0395905_0085346_1217_2089 288
187 3300038443 Ga0395901_0000362 Ga0395901_0000362_52716_53588 288
188 3300038443 Ga0395901_0316155 Ga0395901_0316155_310_1182 288
189 3300039447 Ga0436361_0062622 Ga0436361_0062622_32_898 288
190 3300039447 Ga0436361_0128853 Ga0436361_0128853_84_950 288
191 3300039447 Ga0436361_0216872 Ga0436361_0216872_17108_17974 288
192 3300042005 Ga0439448_0000330 Ga0439448_0000330_380_1252 288
193 3300042007 Ga0439449_0041731 Ga0439449_0041731_635_1507 288
194 3300042008 Ga0439450_001677 Ga0439450_001677_429_1301 288
195 3300042012 Ga0439455_0000774 Ga0439455_0000774_2590_3462 288
196 3300042012 Ga0439455_0024125 Ga0439455_0024125_342_1214 288
197 3300042139 Ga0450904_000322 Ga0450904_000322_1234_2130 288
198 3300042530 Ga0450916_013222 Ga0450916_013222_117_983 288
199 3300044683 Ga0466965_0142821 Ga0466965_0142821_267_1142 288
200 3300044683 Ga0466965_0144502 Ga0466965_0144502_199_1071 288
201 3300044706 Ga0466964_0000618 Ga0466964_0000618_1833_2780 288
202 3300044706 Ga0466964_0003749 Ga0466964_0003749_3147_4019 288
203 3300044719 Ga0466971_0075831 Ga0466971_0075831_462_1334 288
204 3300044735 Ga0466968_0006603 Ga0466968_0006603_268_1215 288
205 3300044842 Ga0466957_0071386 Ga0466957_0071386_333_1280 288
206 3300044901 Ga0466960_0090302 Ga0466960_0090302_389_1336 288
207 3300045836 Ga0466958_0013954 Ga0466958_0013954_902_1774 288
208 3300045976 Ga0466967_0536609 Ga0466967_0536609_130_1002 288
209 3300046455 Ga0495603_0019314 Ga0495603_0019314_2362_3234 288
210 3300046459 Ga0495629_0009041 Ga0495629_0009041_1787_2758 288
211 3300046460 Ga0495638_0000694 Ga0495638_0000694_8711_9583 288
212 3300046460 Ga0495638_0021641 Ga0495638_0021641_199_1065 288
213 3300046460 Ga0495638_0113282 Ga0495638_0113282_612_1484 288
214 3300046463 Ga0495653_0077609 Ga0495653_0077609_321_1223 288
215 3300046471 Ga0495650_0000011 Ga0495650_0000011_186553_187425 288
216 3300046471 Ga0495650_0036880 Ga0495650_0036880_740_1606 288
217 3300046472 Ga0495580_0085146 Ga0495580_0085146_770_1642 288
218 3300046473 Ga0495582_0048925 Ga0495582_0048925_19_891 288
219 3300046474 Ga0495605_0000183 Ga0495605_0000183_57510_58415 288
220 3300046474 Ga0495605_0084804 Ga0495605_0084804_163_1041 288
221 3300046491 Ga0495584_0000003 Ga0495584_0000003_142851_143723 288
222 3300046491 Ga0495584_0005104 Ga0495584_0005104_4688_5560 288
223 3300046491 Ga0495584_0006838 Ga0495584_0006838_2237_3109 288
224 3300046492 Ga0495585_0000010 Ga0495585_0000010_89544_90416 288
225 3300046492 Ga0495585_0000442 Ga0495585_0000442_16639_17511 288
226 3300046492 Ga0495585_0000445 Ga0495585_0000445_36698_37570 288
227 3300046492 Ga0495585_0001079 Ga0495585_0001079_13364_14236 288
228 3300046492 Ga0495585_0010797 Ga0495585_0010797_1323_2195 288
229 3300046492 Ga0495585_0015553 Ga0495585_0015553_3295_4167 288
230 3300046492 Ga0495585_0041712 Ga0495585_0041712_983_1855 288
231 3300046492 Ga0495585_0105481 Ga0495585_0105481_232_1104 288
232 3300046499 Ga0495594_0015658 Ga0495594_0015658_2430_3302 288
233 3300046499 Ga0495594_0022493 Ga0495594_0022493_2212_3084 288
234 3300046499 Ga0495594_0023450 Ga0495594_0023450_37_909 288
235 3300046499 Ga0495594_0089767 Ga0495594_0089767_185_1057 288
236 3300046499 Ga0495594_0153291 Ga0495594_0153291_55_957 288
237 3300046500 Ga0495596_0000023 Ga0495596_0000023_48238_49110 288
238 3300046500 Ga0495596_0007708 Ga0495596_0007708_2002_2919 288
239 3300046501 Ga0495607_0001538 Ga0495607_0001538_4621_5526 288
240 3300046501 Ga0495607_0021411 Ga0495607_0021411_1897_2769 288
241 3300046506 Ga0495583_0000199 Ga0495583_0000199_64382_65257 288
242 3300046506 Ga0495583_0000308 Ga0495583_0000308_20851_21729 288
243 3300046506 Ga0495583_0001015 Ga0495583_0001015_8060_8932 288
244 3300046506 Ga0495583_0071621 Ga0495583_0071621_260_1132 288
245 3300046507 Ga0495606_0008436 Ga0495606_0008436_6162_7112 288
246 3300046507 Ga0495606_0008804 Ga0495606_0008804_1272_2144 288
247 3300046507 Ga0495606_0018431 Ga0495606_0018431_3090_4007 288
248 3300046507 Ga0495606_0166442 Ga0495606_0166442_248_1120 288
249 3300046507 Ga0495606_0180776 Ga0495606_0180776_184_1056 288
250 3300046513 Ga0495616_0001289 Ga0495616_0001289_14808_15680 288
251 3300046513 Ga0495616_0018769 Ga0495616_0018769_2726_3604 288
252 3300046513 Ga0495616_0026978 Ga0495616_0026978_1482_2357 288
253 3300046513 Ga0495616_0049897 Ga0495616_0049897_1195_2067 288
254 3300046513 Ga0495616_0169907 Ga0495616_0169907_46_918 288
255 3300046515 Ga0495620_0002412 Ga0495620_0002412_5143_6015 288
256 3300046518 Ga0495631_0054051 Ga0495631_0054051_279_1151 288
257 3300046518 Ga0495631_0070097 Ga0495631_0070097_554_1432 288
258 3300046519 Ga0495632_0003705 Ga0495632_0003705_756_1634 288
259 3300046519 Ga0495632_0004588 Ga0495632_0004588_7883_8755 288
260 3300046519 Ga0495632_0012318 Ga0495632_0012318_2289_3206 288
261 3300046522 Ga0495643_0002104 Ga0495643_0002104_15178_16050 288
262 3300046522 Ga0495643_0029383 Ga0495643_0029383_1638_2543 288
263 3300046522 Ga0495643_0034227 Ga0495643_0034227_1901_2773 288
264 3300046522 Ga0495643_0077005 Ga0495643_0077005_560_1462 288
265 3300046523 Ga0495644_0012341 Ga0495644_0012341_1922_2839 288
266 3300046523 Ga0495644_0016265 Ga0495644_0016265_912_1796 288
267 3300046523 Ga0495644_0042399 Ga0495644_0042399_352_1224 288
268 3300046524 Ga0495648_0000003 Ga0495648_0000003_139543_140415 288
269 3300046524 Ga0495648_0003267 Ga0495648_0003267_9151_10023 288
270 3300046525 Ga0495663_0002807 Ga0495663_0002807_796_1668 288
271 3300046526 Ga0495666_0000573 Ga0495666_0000573_732_1604 288
272 3300046526 Ga0495666_0009125 Ga0495666_0009125_3573_4475 288
273 3300046526 Ga0495666_0022408 Ga0495666_0022408_558_1430 288
274 3300046526 Ga0495666_0066556 Ga0495666_0066556_353_1225 288
275 3300046528 Ga0495642_0011649 Ga0495642_0011649_405_1277 288
276 3300046528 Ga0495642_0160580 Ga0495642_0160580_51_923 288
277 3300046530 Ga0495654_0061055 Ga0495654_0061055_168_1052 288
278 3300046531 Ga0495665_0003815 Ga0495665_0003815_728_1600 288
279 3300046531 Ga0495665_0045488 Ga0495665_0045488_33_905 288
280 3300046531 Ga0495665_0150601 Ga0495665_0150601_74_946 288
281 3300046535 Ga0495586_0041782 Ga0495586_0041782_1398_2300 288
282 3300046536 Ga0495587_0015246 Ga0495587_0015246_3809_4711 288
283 3300046538 Ga0495609_0011735 Ga0495609_0011735_1084_2001 288
284 3300046538 Ga0495609_0054613 Ga0495609_0054613_490_1368 288
285 3300046542 Ga0495597_0000889 Ga0495597_0000889_17394_18266 288
286 3300046542 Ga0495597_0143158 Ga0495597_0143158_97_969 288
287 3300046557 Ga0495622_0004204 Ga0495622_0004204_4757_5659 288
288 3300046557 Ga0495622_0006061 Ga0495622_0006061_1180_2052 288
289 3300046557 Ga0495622_0011451 Ga0495622_0011451_1390_2292 288
290 3300046557 Ga0495622_0051238 Ga0495622_0051238_47_919 288
291 3300046558 Ga0495633_0006468 Ga0495633_0006468_4113_4985 288
292 3300046558 Ga0495633_0007019 Ga0495633_0007019_5170_6048 288
293 3300046558 Ga0495633_0009468 Ga0495633_0009468_3380_4252 288
294 3300046558 Ga0495633_0083263 Ga0495633_0083263_120_992 288
295 3300046615 Ga0495656_0001536 Ga0495656_0001536_2133_3005 288
296 3300046615 Ga0495656_0030833 Ga0495656_0030833_204_1076 288
297 3300046615 Ga0495656_0161432 Ga0495656_0161432_157_1029 288
298 3300046616 Ga0495668_0016445 Ga0495668_0016445_2667_3569 288
299 3300046616 Ga0495668_0034625 Ga0495668_0034625_41_913 288
300 3300046616 Ga0495668_0136691 Ga0495668_0136691_154_1038 288
301 3300046648 Ga0495611_0002711 Ga0495611_0002711_1932_2834 288
302 3300046648 Ga0495611_0010352 Ga0495611_0010352_2484_3356 288
303 3300046648 Ga0495611_0015161 Ga0495611_0015161_200_1072 288
304 3300046660 Ga0495625_0002032 Ga0495625_0002032_8063_8929 288
305 3300046660 Ga0495625_0023173 Ga0495625_0023173_3418_4290 288
306 3300046660 Ga0495625_0025825 Ga0495625_0025825_1306_2178 288
307 3300046665 Ga0495661_0008486 Ga0495661_0008486_5374_6279 288
308 3300046665 Ga0495661_0061532 Ga0495661_0061532_891_1763 288
309 3300046665 Ga0495661_0065408 Ga0495661_0065408_463_1341 288
310 3300046665 Ga0495661_0137547 Ga0495661_0137547_433_1305 288
311 3300046674 Ga0495588_0085251 Ga0495588_0085251_497_1369 288
312 3300046674 Ga0495588_0092183 Ga0495588_0092183_321_1193 288
313 3300046674 Ga0495588_0093903 Ga0495588_0093903_170_1042 288
314 3300046678 Ga0495599_0209135 Ga0495599_0209135_265_1167 288
315 3300046679 Ga0495623_0029616 Ga0495623_0029616_1837_2739 288
316 3300046679 Ga0495623_0155301 Ga0495623_0155301_303_1175 288
317 3300046684 Ga0495669_0010428 Ga0495669_0010428_2336_3208 288
318 3300046684 Ga0495669_0040391 Ga0495669_0040391_234_1151 288
319 3300046689 Ga0495613_0065991 Ga0495613_0065991_1082_1984 288
320 3300046691 Ga0495670_0017677 Ga0495670_0017677_318_1190 288
321 3300046694 Ga0495649_0005178 Ga0495649_0005178_45_917 288
322 3300046794 Ga0495589_0000350 Ga0495589_0000350_33593_34498 288
323 3300046794 Ga0495589_0028711 Ga0495589_0028711_82_999 288
324 3300046809 Ga0495600_0016490 Ga0495600_0016490_3592_4494 288
325 3300046810 Ga0495660_0000070 Ga0495660_0000070_101869_102774 288
326 3300046810 Ga0495660_0017483 Ga0495660_0017483_2726_3604 288
327 3300047315 Ga0495581_0007206 Ga0495581_0007206_4811_5683 288
328 3300047315 Ga0495581_0077752 Ga0495581_0077752_668_1540 288
329 3300047315 Ga0495581_0163252 Ga0495581_0163252_64_936 288
330 3300047317 Ga0495604_0038368 Ga0495604_0038368_2176_3048 288
331 3300047317 Ga0495604_0219694 Ga0495604_0219694_235_1107 288
332 3300047318 Ga0495636_0012449 Ga0495636_0012449_1471_2343 288
333 3300047319 Ga0495674_0006391 Ga0495674_0006391_895_1866 288
334 3300047319 Ga0495674_0128202 Ga0495674_0128202_898_1800 288
335 3300047320 Ga0495672_0002603 Ga0495672_0002603_878_1783 288
336 3300047320 Ga0495672_0136039 Ga0495672_0136039_381_1259 288
337 3300047321 Ga0495676_0096460 Ga0495676_0096460_776_1648 288
338 3300047323 Ga0495683_0000177 Ga0495683_0000177_48497_49369 288
339 3300047323 Ga0495683_0074902 Ga0495683_0074902_507_1412 288
340 3300047323 Ga0495683_0114944 Ga0495683_0114944_349_1221 288
341 3300047323 Ga0495683_0163346 Ga0495683_0163346_16_888 288
342 3300047443 Ga0495687_000396 Ga0495687_000396_23223_24173 288
343 3300047443 Ga0495687_002304 Ga0495687_002304_7307_8212 288
344 3300047444 Ga0495675_0031892 Ga0495675_0031892_902_1774 288
345 3300047445 Ga0495677_0000833 Ga0495677_0000833_2091_2975 288
346 3300047445 Ga0495677_0004554 Ga0495677_0004554_2394_3299 288
347 3300047445 Ga0495677_0033457 Ga0495677_0033457_383_1255 288
348 3300047445 Ga0495677_0058106 Ga0495677_0058106_343_1215 288
349 3300047445 Ga0495677_0081549 Ga0495677_0081549_49_921 288
350 3300047447 Ga0495685_011893 Ga0495685_011893_431_1348 288
351 3300047469 Ga0495673_0004531 Ga0495673_0004531_2046_2948 288
352 3300047470 Ga0495681_0020559 Ga0495681_0020559_2301_3179 288
353 3300047470 Ga0495681_0024937 Ga0495681_0024937_468_1340 288
354 3300047470 Ga0495681_0046331 Ga0495681_0046331_987_1859 288
355 3300047472 Ga0495686_0215670 Ga0495686_0215670_167_1084 288
356 3300047673 Ga0495593_0043778 Ga0495593_0043778_660_1532 288
357 3300048088 Ga0495602_0033512 Ga0495602_0033512_3721_4623 288
358 3300048090 Ga0495615_0006541 Ga0495615_0006541_376_1248 288
359 3300048091 Ga0495626_0000028 Ga0495626_0000028_93899_94789 288
360 3300048091 Ga0495626_0003744 Ga0495626_0003744_8551_9423 288
361 3300048091 Ga0495626_0004748 Ga0495626_0004748_1691_2563 288
362 3300048091 Ga0495626_0016049 Ga0495626_0016049_2029_2931 288
363 3300048091 Ga0495626_0020917 Ga0495626_0020917_1780_2652 288
364 3300048091 Ga0495626_0027158 Ga0495626_0027158_198_1070 288
365 3300048091 Ga0495626_0035799 Ga0495626_0035799_356_1273 288
366 3300048091 Ga0495626_0083619 Ga0495626_0083619_418_1290 288
367 3300048905 Ga0496102_0040634 Ga0496102_0040634_978_1850 288
368 3300048905 Ga0496102_0485714 Ga0496102_0485714_195_1067 288
369 3300048907 Ga0496104_0107180 Ga0496104_0107180_1312_2184 288
370 3300048908 Ga0496105_0248172 Ga0496105_0248172_230_1102 288
371 3300048909 Ga0496106_0011792 Ga0496106_0011792_503_1375 288
372 3300048910 Ga0496107_0081091 Ga0496107_0081091_282_1154 288
373 3300048916 Ga0496113_0007315 Ga0496113_0007315_3751_4623 288
374 3300048918 Ga0496115_0007457 Ga0496115_0007457_783_1655 288
375 3300048918 Ga0496115_0008000 Ga0496115_0008000_4572_5444 288
376 3300048925 Ga0496122_0002576 Ga0496122_0002576_2231_3103 288
377 3300048926 Ga0496123_0021878 Ga0496123_0021878_3984_4856 288
378 3300048927 Ga0496124_0019764 Ga0496124_0019764_2320_3192 288
379 3300048927 Ga0496124_0078463 Ga0496124_0078463_913_1785 288
380 3300048927 Ga0496124_0085623 Ga0496124_0085623_1119_2084 288
381 3300048928 Ga0496125_0028141 Ga0496125_0028141_206_1078 288
382 3300049459 Ga0495678_001797 Ga0495678_001797_9317_10189 288
383 3300049459 Ga0495678_017959 Ga0495678_017959_185_1084 288
384 3300049460 Ga0495682_0009892 Ga0495682_0009892_298_1215 288
385 3300049581 Ga0501047_0181206 Ga0501047_0181206_1058_1930 288
386 3300049775 Ga0501279_001469 Ga0501279_001469_663_1529 288
387 3300049822 Ga0501035_0000813 Ga0501035_0000813_13867_14739 288
388 3300059641 Ga0587068_000283 Ga0587068_000283_1438_2391 288
389 3300061719 Ga0466962_0134841 Ga0466962_0134841_285_1157 288
390 iso_pu_bacteria 8047673197 8047675302 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

65

309

0.9

PF12146

Hydrolase_4

Serine aminopeptidase, S33

60

310

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

66

315

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bwx-assembly1.cif.gz_A crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.9371 2 287
3bwx-assembly1.cif.gz_A crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.9214 2 287
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.9063 1 285
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.9 1 285
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8939 2 127
ID Description Score Start End Superfamily
3bwxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.932 2 287 3.40.50.1820
3bwxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9191 2 287 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9121 2 97 3.40.50.12270
af_A0A0R0EQP0_201_384_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9043 20 127 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9028 3 127 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A317DZK5-F1-model_v4 Alpha/beta hydrolase 0.964 2 288 GO:0016020
GO:0016787
AF-A0A2W4MFK7-F1-model_v4 Alpha/beta hydrolase 0.9633 2 288 GO:0016787
AF-A0A523G328-F1-model_v4 Alpha/beta hydrolase 0.9591 2 288 GO:0016020
GO:0016787
AF-A0A3D2E6D3-F1-model_v4 deleted 0.9518 1 288
AF-A0A5C7PET1-F1-model_v4 Alpha/beta fold hydrolase 0.9511 5 127 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
94.16 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map