F431768

General Info

Members Datasets Scaffolds Average Seq Length
390 209 780 330

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10083405|Ga0307405_100834052
Length 350
Sequence MKRRSPLPIVLLCAAALLVGCGEKPEPNPRSATGGGPGEPLRLMLDYFPNADHAGIYAAQASGAYEKAGLDVKITPPPDPSAPLRLLLAGKTDLAISYEPELLLARDKGARLVAVGALVQKPLTSLMAVGKADVHTPQDLRGKRVGTSGIPYQSAYLKTILETAGVDTGSVKEINVGFNLVPAMLSGKVDATLGAFSNYEGVDLERRGKHPTIQRMEKLGVPTYDELVFVARRADLDQEFAGRVRRFMQATARGHVALKADPQAGLEGLLNADKGLDRGLQEASVKALLPVFFPADPKRPFGYQDPAEWQRYADWMLENDLIRRRQPAEQALTNEFLPGEGLDPGRISQD

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 12.05
Rhizosphere 79.74
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10083405 3300031731 Bacteria 2095
2 JGI24740J21852_10026799 3300001979 Bacteria 1926
3 JGI25407J50210_10008339 3300003373 Bacteria 2612
4 Ga0070683_100031494 3300005329 Bacteria 4823
5 Ga0070683_100044155 3300005329 Bacteria 4109
6 Ga0070683_100084180 3300005329 Bacteria 2980
7 Ga0070683_100087013 3300005329 Bacteria 2930
8 Ga0070683_100142027 3300005329 Bacteria 2275
9 Ga0068869_100148588 3300005334 Bacteria 1815
10 Ga0070682_100037359 3300005337 Bacteria 2973
11 Ga0070660_100003729 3300005339 Bacteria 10527
12 Ga0070689_100041608 3300005340 Bacteria 3527
13 Ga0070691_10000249 3300005341 Bacteria 18519
14 Ga0070661_100000032 3300005344 Bacteria 112964
15 Ga0070692_10047257 3300005345 Bacteria 2227
16 Ga0070668_100002340 3300005347 Bacteria 13926
17 Ga0070668_100223531 3300005347 Bacteria 1554
18 Ga0070668_100224531 3300005347 Bacteria 1550
19 Ga0070668_100226568 3300005347 Bacteria 1544
20 Ga0070669_100005245 3300005353 Bacteria 9359
21 Ga0070669_100269486 3300005353 Bacteria 1361
22 Ga0070674_100121827 3300005356 Bacteria 1932
23 Ga0070674_100253798 3300005356 Bacteria 1382
24 Ga0070673_100462985 3300005364 Bacteria 1142
25 Ga0070688_100068425 3300005365 Bacteria 2264
26 Ga0070659_100000224 3300005366 Bacteria 44085
27 Ga0070659_100007141 3300005366 Bacteria 8104
28 Ga0070659_100173074 3300005366 Bacteria 1769
29 Ga0070714_100328871 3300005435 Bacteria 1431
30 Ga0070713_100245061 3300005436 Bacteria 1633
31 Ga0070710_10000010 3300005437 Bacteria 141733
32 Ga0070710_10033168 3300005437 Bacteria 2802
33 Ga0070711_100023801 3300005439 Bacteria 3989
34 Ga0070705_100007822 3300005440 Bacteria 5281
35 Ga0070705_100077555 3300005440 Bacteria 2029
36 Ga0070700_100024981 3300005441 Bacteria 3515
37 Ga0070700_100161084 3300005441 Bacteria 1544
38 Ga0070663_100231656 3300005455 Bacteria 1455
39 Ga0070678_100242007 3300005456 Bacteria 1509
40 Ga0070662_100004478 3300005457 Bacteria 8845
41 Ga0068867_100103701 3300005459 Bacteria 2175
42 Ga0070685_10051285 3300005466 Bacteria 2385
43 Ga0070684_100049885 3300005535 Bacteria 3634
44 Ga0068853_100143097 3300005539 Bacteria 2148
45 Ga0070672_100142683 3300005543 Bacteria 1977
46 Ga0070672_100404280 3300005543 Bacteria 1171
47 Ga0070672_100412157 3300005543 Bacteria 1159
48 Ga0070696_100061341 3300005546 Bacteria 2631
49 Ga0070693_100118675 3300005547 Bacteria 1638
50 Ga0070693_100153984 3300005547 Bacteria 1458
51 Ga0070704_100189185 3300005549 Bacteria 1653
52 Ga0070664_100047120 3300005564 Bacteria 3641
53 Ga0070664_100097624 3300005564 Bacteria 2551
54 Ga0070664_100184783 3300005564 Bacteria 1855
55 Ga0068854_100092171 3300005578 Bacteria 2257
56 Ga0068856_100081659 3300005614 Bacteria 3207
57 Ga0070702_100005708 3300005615 Bacteria 5825
58 Ga0068852_100318082 3300005616 Bacteria 1511
59 Ga0068859_100039658 3300005617 Bacteria 4725
60 Ga0068859_100230811 3300005617 Bacteria 1939
61 Ga0068864_100107708 3300005618 Bacteria 2479
62 Ga0068866_10079285 3300005718 Bacteria 1759
63 Ga0068861_100026935 3300005719 Bacteria 4183
64 Ga0068861_100053750 3300005719 Bacteria 3066
65 Ga0068861_100143800 3300005719 Bacteria 1950
66 Ga0068863_100008400 3300005841 Bacteria 10084
67 Ga0068863_100423922 3300005841 Bacteria 1304
68 Ga0068858_100343636 3300005842 Unclassified 1429
69 Ga0081455_10100567 3300005937 Bacteria 2323
70 Ga0081455_10244743 3300005937 Bacteria 1316
71 Ga0081538_10000067 3300005981 Bacteria 97828
72 Ga0081538_10000084 3300005981 Bacteria 90336
73 Ga0081538_10001633 3300005981 Bacteria 22992
74 Ga0081538_10009803 3300005981 Bacteria 7925
75 Ga0081538_10010870 3300005981 Bacteria 7424
76 Ga0081538_10011207 3300005981 Bacteria 7282
77 Ga0081538_10018414 3300005981 Bacteria 5245
78 Ga0081538_10030536 3300005981 Bacteria 3656
79 Ga0081538_10053317 3300005981 Bacteria 2405
80 Ga0070717_10082701 3300006028 Unclassified 2699
81 Ga0075432_10037043 3300006058 Bacteria 1697
82 Ga0070712_100007973 3300006175 Bacteria 6641
83 Ga0070712_100125658 3300006175 Bacteria 1937
84 Ga0070712_100166448 3300006175 Bacteria 1707
85 Ga0075428_100014027 3300006844 Bacteria 8918
86 Ga0075428_100042812 3300006844 Bacteria 4979
87 Ga0075428_100267790 3300006844 Bacteria 1839
88 Ga0075430_100002921 3300006846 Bacteria 14295
89 Ga0075430_100048550 3300006846 Bacteria 3584
90 Ga0075430_100089292 3300006846 Bacteria 2579
91 Ga0075430_100108766 3300006846 Bacteria 2313
92 Ga0075429_100028965 3300006880 Bacteria 4810
93 Ga0068865_100063678 3300006881 Bacteria 2593
94 Ga0068865_100096231 3300006881 Bacteria 2158
95 Ga0097620_100039659 3300006931 Bacteria 4725
96 Ga0097620_100230791 3300006931 Bacteria 1939
97 Ga0111539_10011305 3300009094 Bacteria 11211
98 Ga0111539_10493877 3300009094 Bacteria 1425
99 Ga0105245_10097463 3300009098 Bacteria 2715
100 Ga0114129_10004853 3300009147 Bacteria 18980
101 Ga0114129_10189745 3300009147 Bacteria 2792
102 Ga0114129_10312777 3300009147 Bacteria 2090
103 Ga0114129_10624015 3300009147 Bacteria 1394
104 Ga0105243_10014403 3300009148 Bacteria 5986
105 Ga0105243_10069067 3300009148 Bacteria 2849
106 Ga0105243_10555356 3300009148 Bacteria 1098
107 Ga0105242_10002217 3300009176 Bacteria 15334
108 Ga0105248_10184937 3300009177 Bacteria 2348
109 Ga0105237_10156784 3300009545 Bacteria 2274
110 Ga0105238_10315574 3300009551 Bacteria 1548
111 Ga0105249_10001019 3300009553 Bacteria 24774
112 Ga0105249_10262313 3300009553 Bacteria 1717
113 Ga0105249_10506486 3300009553 Bacteria 1253
114 Ga0105239_10398111 3300010375 Bacteria 1558
115 Ga0163162_10177309 3300013306 Bacteria 2257
116 Ga0157372_10101459 3300013307 Bacteria 3285
117 Ga0163163_10058810 3300014325 Bacteria 3801
118 Ga0163163_10172910 3300014325 Bacteria 2207
119 Ga0157380_10480030 3300014326 Bacteria 1202
120 Ga0157376_10178285 3300014969 Bacteria 1940
121 Ga0213873_10020740 3300021358 Unclassified 1538
122 Ga0213874_10000391 3300021377 Bacteria 8677
123 Ga0213874_10050499 3300021377 Unclassified 1274
124 Ga0213876_10013682 3300021384 Bacteria 4302
125 Ga0213876_10039300 3300021384 Bacteria 2500
126 Ga0213876_10049345 3300021384 Bacteria 2224
127 Ga0213876_10054778 3300021384 Unclassified 2105
128 Ga0213876_10094071 3300021384 Bacteria 1588
129 Ga0213876_10145871 3300021384 Bacteria 1258
130 Ga0213875_10018480 3300021388 Bacteria 3359
131 Ga0207692_10000006 3300025898 Bacteria 294686
132 Ga0207642_10032933 3300025899 Bacteria 2187
133 Ga0207710_10033591 3300025900 Bacteria 2250
134 Ga0207688_10002274 3300025901 Bacteria 10325
135 Ga0207688_10020414 3300025901 Bacteria 3617
136 Ga0207643_10030486 3300025908 Bacteria 3002
137 Ga0207705_10130155 3300025909 Bacteria 1872
138 Ga0207693_10010492 3300025915 Bacteria 7518
139 Ga0207693_10125816 3300025915 Bacteria 2015
140 Ga0207660_10115895 3300025917 Bacteria 2023
141 Ga0207662_10021012 3300025918 Bacteria 3726
142 Ga0207657_10229197 3300025919 Bacteria 1486
143 Ga0207649_10000015 3300025920 Bacteria 245662
144 Ga0207649_10124905 3300025920 Bacteria 1740
145 Ga0207681_10009344 3300025923 Bacteria 5992
146 Ga0207687_10098684 3300025927 Bacteria 2145
147 Ga0207700_10171114 3300025928 Bacteria 1812
148 Ga0207700_10422296 3300025928 Unclassified 1171
149 Ga0207664_10230309 3300025929 Unclassified 1610
150 Ga0207644_10289174 3300025931 Bacteria 1318
151 Ga0207690_10000276 3300025932 Bacteria 36407
152 Ga0207690_10050886 3300025932 Bacteria 2768
153 Ga0207706_10001024 3300025933 Bacteria 28478
154 Ga0207706_10159982 3300025933 Bacteria 1980
155 Ga0207709_10059982 3300025935 Bacteria 2370
156 Ga0207670_10025055 3300025936 Bacteria 3738
157 Ga0207669_10027805 3300025937 Bacteria 3103
158 Ga0207669_10141294 3300025937 Bacteria 1672
159 Ga0207704_10035985 3300025938 Bacteria 2844
160 Ga0207691_10073855 3300025940 Bacteria 3076
161 Ga0207691_10162255 3300025940 Bacteria 1960
162 Ga0207691_10239699 3300025940 Bacteria 1568
163 Ga0207711_10302423 3300025941 Bacteria 1475
164 Ga0207689_10229879 3300025942 Bacteria 1533
165 Ga0207661_10017127 3300025944 Bacteria 5355
166 Ga0207661_10089838 3300025944 Bacteria 2557
167 Ga0207679_10064374 3300025945 Bacteria 2740
168 Ga0207651_10144096 3300025960 Bacteria 1845
169 Ga0207712_10013843 3300025961 Bacteria 5173
170 Ga0207712_10078660 3300025961 Bacteria 2394
171 Ga0207668_10044799 3300025972 Bacteria 3013
172 Ga0207677_10105039 3300026023 Bacteria 2089
173 Ga0207678_10022056 3300026067 Bacteria 5579
174 Ga0207678_10216644 3300026067 Bacteria 1638
175 Ga0207678_10316769 3300026067 Bacteria 1342
176 Ga0207708_10014184 3300026075 Bacteria 5958
177 Ga0207708_10045554 3300026075 Bacteria 3343
178 Ga0207708_10207101 3300026075 Bacteria 1567
179 Ga0207641_10222035 3300026088 Bacteria 1753
180 Ga0207648_10218944 3300026089 Bacteria 1692
181 Ga0207676_10087645 3300026095 Bacteria 2546
182 Ga0207674_10172744 3300026116 Bacteria 2114
183 Ga0207675_100003216 3300026118 Bacteria 16023
184 Ga0207675_100017416 3300026118 Bacteria 6707
185 Ga0207675_100050048 3300026118 Bacteria 3899
186 Ga0207675_100053017 3300026118 Bacteria 3785
187 Ga0207675_100071027 3300026118 Bacteria 3254
188 Ga0207698_10117051 3300026142 Bacteria 2247
189 Ga0207698_10140646 3300026142 Bacteria 2079
190 Ga0207698_10492185 3300026142 Bacteria 1192
191 Ga0207428_10130675 3300027907 Bacteria 1921
192 Ga0268265_10068559 3300028380 Bacteria 2751
193 Ga0307408_100037699 3300031548 Bacteria 3406
194 Ga0307405_10016965 3300031731 Bacteria 3986
195 Ga0307405_10021644 3300031731 Bacteria 3618
196 Ga0307405_10144592 3300031731 Bacteria 1663
197 Ga0307413_10077924 3300031824 Bacteria 2113
198 Ga0307413_10164007 3300031824 Bacteria 1564
199 Ga0307410_10149896 3300031852 Bacteria 1735
200 Ga0307406_10014693 3300031901 Bacteria 4509
201 Ga0307406_10034162 3300031901 Bacteria 3118
202 Ga0307406_10273537 3300031901 Bacteria 1284
203 Ga0307407_10050869 3300031903 Bacteria 2372
204 Ga0307412_10097751 3300031911 Bacteria 2069
205 Ga0307409_100005435 3300031995 Bacteria 7333
206 Ga0307409_100008161 3300031995 Bacteria 6329
207 Ga0307409_100034234 3300031995 Bacteria 3707
208 Ga0307409_100050753 3300031995 Bacteria 3170
209 Ga0307409_100141643 3300031995 Bacteria 2073
210 Ga0307409_100418623 3300031995 Bacteria 1285
211 Ga0307416_100396552 3300032002 Bacteria 1416
212 Ga0307411_10079146 3300032005 Bacteria 2256
213 Ga0307411_10110403 3300032005 Bacteria 1966
214 Ga0307411_10190375 3300032005 Bacteria 1566
215 Ga0307411_10212405 3300032005 Bacteria 1495
216 Ga0307415_100001648 3300032126 Bacteria 10821
217 Ga0307415_100045633 3300032126 Bacteria 2939
218 Ga0373939_0020187 3300035114 Bacteria 1807
219 Ga0373953_0080324 3300035117 Bacteria 1355
220 Ga0395900_0091085 3300037418 Bacteria 3134
221 Ga0395900_0181010 3300037418 Bacteria 2142
222 Ga0395898_0018658 3300037466 Bacteria 7072
223 Ga0436364_0446067 3300037853 Bacteria 12354
224 Ga0436364_0566692 3300037853 Bacteria 10067
225 Ga0436364_0737053 3300037853 Bacteria 5291
226 Ga0436364_0801814 3300037853 Bacteria 17054
227 Ga0436364_1133835 3300037853 Bacteria 8611
228 Ga0436364_1242867 3300037853 Bacteria 5440
229 Ga0436364_1562323 3300037853 Bacteria 1163
230 Ga0395901_0201395 3300038443 Bacteria 2087
231 Ga0395901_0240387 3300038443 Bacteria 1889
232 Ga0395901_0357783 3300038443 Bacteria 1506
233 Ga0436365_0161148 3300039437 Bacteria 6183
234 Ga0436365_0165369 3300039437 Bacteria 10442
235 Ga0436365_0392863 3300039437 Bacteria 8115
236 Ga0436365_0494652 3300039437 Bacteria 13610
237 Ga0436365_1195088 3300039437 Bacteria 9675
238 Ga0436365_1417576 3300039437 Bacteria 7851
239 Ga0436365_1484549 3300039437 Bacteria 2933
240 Ga0436365_1503942 3300039437 Bacteria 3432
241 Ga0436365_1590404 3300039437 Unclassified 2070
242 Ga0436365_1901512 3300039437 Bacteria 29147
243 Ga0436363_0157524 3300039450 Bacteria 29691
244 Ga0436363_0454374 3300039450 Bacteria 6037
245 Ga0436363_0500798 3300039450 Bacteria 2325
246 Ga0436363_1026006 3300039450 Bacteria 1905
247 Ga0436362_0343470 3300039453 Bacteria 2488
248 Ga0436362_0456692 3300039453 Bacteria 2096
249 Ga0436362_0730281 3300039453 Bacteria 2800
250 Ga0439463_040802 3300042016 Unclassified 1179
251 Ga0466966_0127485 3300044684 Bacteria 1560
252 Ga0466963_0004304 3300044694 Bacteria 8259
253 Ga0466963_0022295 3300044694 Bacteria 4009
254 Ga0466963_0030664 3300044694 Bacteria 3471
255 Ga0466963_0064140 3300044694 Bacteria 2460
256 Ga0466971_0029406 3300044719 Bacteria 2457
257 Ga0466971_0045403 3300044719 Bacteria 1973
258 Ga0466968_0067800 3300044735 Bacteria 1548
259 Ga0466957_0006833 3300044842 Bacteria 6448
260 Ga0466957_0009925 3300044842 Bacteria 5445
261 Ga0466957_0220155 3300044842 Bacteria 1253
262 Ga0466960_0004812 3300044901 Bacteria 5304
263 Ga0466959_0027173 3300045049 Bacteria 4245
264 Ga0466958_0012489 3300045836 Bacteria 4814
265 Ga0466958_0021741 3300045836 Bacteria 3752
266 Ga0466958_0097183 3300045836 Bacteria 1827
267 Ga0466958_0097882 3300045836 Unclassified 1821
268 Ga0466958_0099357 3300045836 Unclassified 1808
269 Ga0466958_0268395 3300045836 Bacteria 1093
270 Ga0466967_0044631 3300045976 Bacteria 3846
271 Ga0466967_0052175 3300045976 Bacteria 3588
272 Ga0466967_0097753 3300045976 Unclassified 2680
273 Ga0466967_0122170 3300045976 Bacteria 2408
274 Ga0466967_0239382 3300045976 Unclassified 1731
275 Ga0466967_0317192 3300045976 Bacteria 1503
276 Ga0495629_0001200 3300046459 Bacteria 20408
277 Ga0495629_0002275 3300046459 Bacteria 14808
278 Ga0495641_0037102 3300046461 Bacteria 2287
279 Ga0495653_0073999 3300046463 Bacteria 2540
280 Ga0495582_0095252 3300046473 Bacteria 1663
281 Ga0495608_0142314 3300046511 Bacteria 1530
282 Ga0495630_0102043 3300046517 Bacteria 2170
283 Ga0495652_0185116 3300046529 Bacteria 1594
284 Ga0495635_0207806 3300046663 Bacteria 1326
285 Ga0495657_0114089 3300046675 Bacteria 1708
286 Ga0495613_0156746 3300046689 Bacteria 1622
287 Ga0495604_0241922 3300047317 Bacteria 1233
288 Ga0495676_0006614 3300047321 Bacteria 10687
289 Ga0495676_0017214 3300047321 Bacteria 6396
290 Ga0495680_0074126 3300047322 Bacteria 2585
291 Ga0495684_0040569 3300047471 Bacteria 3568
292 Ga0496100_0000019 3300048903 Bacteria 149995
293 Ga0496100_0171118 3300048903 Bacteria 1564
294 Ga0496101_0000005 3300048904 Bacteria 331455
295 Ga0496101_0053897 3300048904 Bacteria 2903
296 Ga0496101_0097096 3300048904 Bacteria 2200
297 Ga0496102_0000021 3300048905 Bacteria 246920
298 Ga0496102_0015487 3300048905 Bacteria 6643
299 Ga0496102_0390736 3300048905 Bacteria 1309
300 Ga0496103_0000001 3300048906 Bacteria 643471
301 Ga0496104_0004900 3300048907 Bacteria 11674
302 Ga0496104_0057173 3300048907 Bacteria 3691
303 Ga0496104_0059865 3300048907 Bacteria 3606
304 Ga0496104_0095931 3300048907 Bacteria 2837
305 Ga0496104_0337918 3300048907 Bacteria 1419
306 Ga0496105_0088199 3300048908 Bacteria 2563
307 Ga0496105_0093986 3300048908 Bacteria 2476
308 Ga0496106_0000033 3300048909 Bacteria 131412
309 Ga0496106_0038329 3300048909 Bacteria 3586
310 Ga0496106_0114107 3300048909 Bacteria 2107
311 Ga0496107_0000004 3300048910 Bacteria 297680
312 Ga0496107_0068324 3300048910 Bacteria 2579
313 Ga0496108_0003495 3300048911 Bacteria 12594
314 Ga0496108_0158029 3300048911 Bacteria 1958
315 Ga0496108_0236567 3300048911 Bacteria 1589
316 Ga0496108_0299950 3300048911 Bacteria 1399
317 Ga0496109_0000666 3300048912 Bacteria 28474
318 Ga0496109_0028897 3300048912 Bacteria 4963
319 Ga0496109_0135692 3300048912 Bacteria 2299
320 Ga0496109_0162136 3300048912 Bacteria 2095
321 Ga0496109_0223029 3300048912 Bacteria 1773
322 Ga0496110_0006699 3300048913 Bacteria 9158
323 Ga0496110_0025288 3300048913 Bacteria 5072
324 Ga0496110_0168579 3300048913 Bacteria 1986
325 Ga0496111_0022395 3300048914 Bacteria 4423
326 Ga0496111_0165558 3300048914 Bacteria 1642
327 Ga0496112_0007474 3300048915 Bacteria 9698
328 Ga0496112_0017537 3300048915 Bacteria 6729
329 Ga0496112_0049344 3300048915 Bacteria 4126
330 Ga0496112_0142439 3300048915 Bacteria 2366
331 Ga0496112_0197090 3300048915 Bacteria 1974
332 Ga0496112_0419573 3300048915 Bacteria 1277
333 Ga0496113_0016279 3300048916 Bacteria 5133
334 Ga0496113_0018972 3300048916 Bacteria 4802
335 Ga0496113_0032225 3300048916 Bacteria 3808
336 Ga0496113_0057823 3300048916 Bacteria 2916
337 Ga0496114_0138869 3300048917 Bacteria 2103
338 Ga0496115_0134401 3300048918 Bacteria 2039
339 Ga0501034_0365851 3300049571 Bacteria 1369
340 Ga0501036_0478121 3300049572 Bacteria 1037
341 Ga0501038_0143579 3300049574 Bacteria 1951
342 Ga0501039_0126851 3300049575 Bacteria 2002
343 Ga0501040_0009115 3300049576 Bacteria 6460
344 Ga0501041_0099532 3300049577 Bacteria 1799
345 Ga0501041_0202865 3300049577 Bacteria 1243
346 Ga0501042_0050115 3300049578 Bacteria 2978
347 Ga0501046_0215758 3300049580 Bacteria 1423
348 Ga0501068_0246073 3300049584 Bacteria 1139
349 Ga0501069_0033781 3300049585 Bacteria 2818
350 Ga0501071_0056081 3300049587 Bacteria 2845
351 Ga0501071_0110133 3300049587 Bacteria 2035
352 Ga0501072_0094835 3300049588 Bacteria 2371
353 Ga0501072_0173057 3300049588 Bacteria 1723
354 Ga0501074_0277549 3300049590 Bacteria 1191
355 Ga0501075_0344740 3300049591 Bacteria 1135
356 Ga0501076_0046819 3300049592 Bacteria 3418
357 Ga0501076_0121479 3300049592 Bacteria 2115
358 Ga0501076_0122796 3300049592 Bacteria 2103
359 Ga0501076_0287002 3300049592 Bacteria 1348
360 Ga0501077_0047991 3300049593 Bacteria 2713
361 Ga0501079_0028951 3300049741 Bacteria 4252
362 Ga0501079_0077499 3300049741 Bacteria 2571
363 Ga0501079_0079871 3300049741 Bacteria 2529
364 Ga0501083_0197403 3300049744 Bacteria 1313
365 Ga0501035_0159434 3300049822 Bacteria 1954
366 Ga0501045_0040783 3300049824 Bacteria 3376
367 nmdc:mga05p37_111869_c1 3300050507 Bacteria 3358
368 nmdc:mga05p37_197845_c1 3300050507 Bacteria 2436
369 nmdc:mga05p37_3676_c1 3300050507 Bacteria 17933
370 nmdc:mga09592_69131_c1 3300050508 Bacteria 2996
371 nmdc:mga0qj67_173154_c1 3300050509 Unclassified 1753
372 nmdc:mga0qj67_230132_c1 3300050509 Bacteria 1504
373 nmdc:mga0qj67_377976_c1 3300050509 Bacteria 1144
374 nmdc:mga0qj67_40326_c1 3300050509 Bacteria 3670
375 nmdc:mga06r32_500470_c1 3300050510 Bacteria 1192
376 nmdc:mga08y16_104202_c1 3300050511 Bacteria 2953
377 nmdc:mga08y16_18646_c1 3300050511 Bacteria 7309
378 nmdc:mga08y16_286585_c1 3300050511 Bacteria 1698
379 nmdc:mga0a205_120860_c1 3300050515 Bacteria 2518
380 Ga0495655_0000008 3300053083 Bacteria 153535
381 Ga0495595_0102231 3300053084 Bacteria 1384
382 Ga0495619_0139428 3300053085 Bacteria 1669
383 Ga0495619_0303912 3300053085 Bacteria 1105
384 Ga0500628_000023 3300053129 Bacteria 77818
385 Ga0500616_0092028 3300053153 Bacteria 1500
386 Ga0501084_0152830 3300054114 Bacteria 1946
387 Ga0501082_0129701 3300060353 Bacteria 2187
388 Ga0466962_0023132 3300061719 Bacteria 2987
389 Ga0466962_0109353 3300061719 Bacteria 1330
390 8054285039 8054280661 Bacteria 4232245
391 Ga0307405_10083405
392 JGI24740J21852_10026799
393 JGI25407J50210_10008339
394 Ga0070683_100031494
395 Ga0070683_100044155
396 Ga0070683_100084180
397 Ga0070683_100087013
398 Ga0070683_100142027
399 Ga0068869_100148588
400 Ga0070682_100037359
401 Ga0070660_100003729
402 Ga0070689_100041608
403 Ga0070691_10000249
404 Ga0070661_100000032
405 Ga0070692_10047257
406 Ga0070668_100002340
407 Ga0070668_100223531
408 Ga0070668_100224531
409 Ga0070668_100226568
410 Ga0070669_100005245
411 Ga0070669_100269486
412 Ga0070674_100121827
413 Ga0070674_100253798
414 Ga0070673_100462985
415 Ga0070688_100068425
416 Ga0070659_100000224
417 Ga0070659_100007141
418 Ga0070659_100173074
419 Ga0070714_100328871
420 Ga0070713_100245061
421 Ga0070710_10000010
422 Ga0070710_10033168
423 Ga0070711_100023801
424 Ga0070705_100007822
425 Ga0070705_100077555
426 Ga0070700_100024981
427 Ga0070700_100161084
428 Ga0070663_100231656
429 Ga0070678_100242007
430 Ga0070662_100004478
431 Ga0068867_100103701
432 Ga0070685_10051285
433 Ga0070684_100049885
434 Ga0068853_100143097
435 Ga0070672_100142683
436 Ga0070672_100404280
437 Ga0070672_100412157
438 Ga0070696_100061341
439 Ga0070693_100118675
440 Ga0070693_100153984
441 Ga0070704_100189185
442 Ga0070664_100047120
443 Ga0070664_100097624
444 Ga0070664_100184783
445 Ga0068854_100092171
446 Ga0068856_100081659
447 Ga0070702_100005708
448 Ga0068852_100318082
449 Ga0068859_100039658
450 Ga0068859_100230811
451 Ga0068864_100107708
452 Ga0068866_10079285
453 Ga0068861_100026935
454 Ga0068861_100053750
455 Ga0068861_100143800
456 Ga0068863_100008400
457 Ga0068863_100423922
458 Ga0068858_100343636
459 Ga0081455_10100567
460 Ga0081455_10244743
461 Ga0081538_10000067
462 Ga0081538_10000084
463 Ga0081538_10001633
464 Ga0081538_10009803
465 Ga0081538_10010870
466 Ga0081538_10011207
467 Ga0081538_10018414
468 Ga0081538_10030536
469 Ga0081538_10053317
470 Ga0070717_10082701
471 Ga0075432_10037043
472 Ga0070712_100007973
473 Ga0070712_100125658
474 Ga0070712_100166448
475 Ga0075428_100014027
476 Ga0075428_100042812
477 Ga0075428_100267790
478 Ga0075430_100002921
479 Ga0075430_100048550
480 Ga0075430_100089292
481 Ga0075430_100108766
482 Ga0075429_100028965
483 Ga0068865_100063678
484 Ga0068865_100096231
485 Ga0097620_100039659
486 Ga0097620_100230791
487 Ga0111539_10011305
488 Ga0111539_10493877
489 Ga0105245_10097463
490 Ga0114129_10004853
491 Ga0114129_10189745
492 Ga0114129_10312777
493 Ga0114129_10624015
494 Ga0105243_10014403
495 Ga0105243_10069067
496 Ga0105243_10555356
497 Ga0105242_10002217
498 Ga0105248_10184937
499 Ga0105237_10156784
500 Ga0105238_10315574
501 Ga0105249_10001019
502 Ga0105249_10262313
503 Ga0105249_10506486
504 Ga0105239_10398111
505 Ga0163162_10177309
506 Ga0157372_10101459
507 Ga0163163_10058810
508 Ga0163163_10172910
509 Ga0157380_10480030
510 Ga0157376_10178285
511 Ga0213873_10020740
512 Ga0213874_10000391
513 Ga0213874_10050499
514 Ga0213876_10013682
515 Ga0213876_10039300
516 Ga0213876_10049345
517 Ga0213876_10054778
518 Ga0213876_10094071
519 Ga0213876_10145871
520 Ga0213875_10018480
521 Ga0207692_10000006
522 Ga0207642_10032933
523 Ga0207710_10033591
524 Ga0207688_10002274
525 Ga0207688_10020414
526 Ga0207643_10030486
527 Ga0207705_10130155
528 Ga0207693_10010492
529 Ga0207693_10125816
530 Ga0207660_10115895
531 Ga0207662_10021012
532 Ga0207657_10229197
533 Ga0207649_10000015
534 Ga0207649_10124905
535 Ga0207681_10009344
536 Ga0207687_10098684
537 Ga0207700_10171114
538 Ga0207700_10422296
539 Ga0207664_10230309
540 Ga0207644_10289174
541 Ga0207690_10000276
542 Ga0207690_10050886
543 Ga0207706_10001024
544 Ga0207706_10159982
545 Ga0207709_10059982
546 Ga0207670_10025055
547 Ga0207669_10027805
548 Ga0207669_10141294
549 Ga0207704_10035985
550 Ga0207691_10073855
551 Ga0207691_10162255
552 Ga0207691_10239699
553 Ga0207711_10302423
554 Ga0207689_10229879
555 Ga0207661_10017127
556 Ga0207661_10089838
557 Ga0207679_10064374
558 Ga0207651_10144096
559 Ga0207712_10013843
560 Ga0207712_10078660
561 Ga0207668_10044799
562 Ga0207677_10105039
563 Ga0207678_10022056
564 Ga0207678_10216644
565 Ga0207678_10316769
566 Ga0207708_10014184
567 Ga0207708_10045554
568 Ga0207708_10207101
569 Ga0207641_10222035
570 Ga0207648_10218944
571 Ga0207676_10087645
572 Ga0207674_10172744
573 Ga0207675_100003216
574 Ga0207675_100017416
575 Ga0207675_100050048
576 Ga0207675_100053017
577 Ga0207675_100071027
578 Ga0207698_10117051
579 Ga0207698_10140646
580 Ga0207698_10492185
581 Ga0207428_10130675
582 Ga0268265_10068559
583 Ga0307408_100037699
584 Ga0307405_10016965
585 Ga0307405_10021644
586 Ga0307405_10144592
587 Ga0307413_10077924
588 Ga0307413_10164007
589 Ga0307410_10149896
590 Ga0307406_10014693
591 Ga0307406_10034162
592 Ga0307406_10273537
593 Ga0307407_10050869
594 Ga0307412_10097751
595 Ga0307409_100005435
596 Ga0307409_100008161
597 Ga0307409_100034234
598 Ga0307409_100050753
599 Ga0307409_100141643
600 Ga0307409_100418623
601 Ga0307416_100396552
602 Ga0307411_10079146
603 Ga0307411_10110403
604 Ga0307411_10190375
605 Ga0307411_10212405
606 Ga0307415_100001648
607 Ga0307415_100045633
608 Ga0373939_0020187
609 Ga0373953_0080324
610 Ga0395900_0091085
611 Ga0395900_0181010
612 Ga0395898_0018658
613 Ga0436364_0446067
614 Ga0436364_0566692
615 Ga0436364_0737053
616 Ga0436364_0801814
617 Ga0436364_1133835
618 Ga0436364_1242867
619 Ga0436364_1562323
620 Ga0395901_0201395
621 Ga0395901_0240387
622 Ga0395901_0357783
623 Ga0436365_0161148
624 Ga0436365_0165369
625 Ga0436365_0392863
626 Ga0436365_0494652
627 Ga0436365_1195088
628 Ga0436365_1417576
629 Ga0436365_1484549
630 Ga0436365_1503942
631 Ga0436365_1590404
632 Ga0436365_1901512
633 Ga0436363_0157524
634 Ga0436363_0454374
635 Ga0436363_0500798
636 Ga0436363_1026006
637 Ga0436362_0343470
638 Ga0436362_0456692
639 Ga0436362_0730281
640 Ga0439463_040802
641 Ga0466966_0127485
642 Ga0466963_0004304
643 Ga0466963_0022295
644 Ga0466963_0030664
645 Ga0466963_0064140
646 Ga0466971_0029406
647 Ga0466971_0045403
648 Ga0466968_0067800
649 Ga0466957_0006833
650 Ga0466957_0009925
651 Ga0466957_0220155
652 Ga0466960_0004812
653 Ga0466959_0027173
654 Ga0466958_0012489
655 Ga0466958_0021741
656 Ga0466958_0097183
657 Ga0466958_0097882
658 Ga0466958_0099357
659 Ga0466958_0268395
660 Ga0466967_0044631
661 Ga0466967_0052175
662 Ga0466967_0097753
663 Ga0466967_0122170
664 Ga0466967_0239382
665 Ga0466967_0317192
666 Ga0495629_0001200
667 Ga0495629_0002275
668 Ga0495641_0037102
669 Ga0495653_0073999
670 Ga0495582_0095252
671 Ga0495608_0142314
672 Ga0495630_0102043
673 Ga0495652_0185116
674 Ga0495635_0207806
675 Ga0495657_0114089
676 Ga0495613_0156746
677 Ga0495604_0241922
678 Ga0495676_0006614
679 Ga0495676_0017214
680 Ga0495680_0074126
681 Ga0495684_0040569
682 Ga0496100_0000019
683 Ga0496100_0171118
684 Ga0496101_0000005
685 Ga0496101_0053897
686 Ga0496101_0097096
687 Ga0496102_0000021
688 Ga0496102_0015487
689 Ga0496102_0390736
690 Ga0496103_0000001
691 Ga0496104_0004900
692 Ga0496104_0057173
693 Ga0496104_0059865
694 Ga0496104_0095931
695 Ga0496104_0337918
696 Ga0496105_0088199
697 Ga0496105_0093986
698 Ga0496106_0000033
699 Ga0496106_0038329
700 Ga0496106_0114107
701 Ga0496107_0000004
702 Ga0496107_0068324
703 Ga0496108_0003495
704 Ga0496108_0158029
705 Ga0496108_0236567
706 Ga0496108_0299950
707 Ga0496109_0000666
708 Ga0496109_0028897
709 Ga0496109_0135692
710 Ga0496109_0162136
711 Ga0496109_0223029
712 Ga0496110_0006699
713 Ga0496110_0025288
714 Ga0496110_0168579
715 Ga0496111_0022395
716 Ga0496111_0165558
717 Ga0496112_0007474
718 Ga0496112_0017537
719 Ga0496112_0049344
720 Ga0496112_0142439
721 Ga0496112_0197090
722 Ga0496112_0419573
723 Ga0496113_0016279
724 Ga0496113_0018972
725 Ga0496113_0032225
726 Ga0496113_0057823
727 Ga0496114_0138869
728 Ga0496115_0134401
729 Ga0501034_0365851
730 Ga0501036_0478121
731 Ga0501038_0143579
732 Ga0501039_0126851
733 Ga0501040_0009115
734 Ga0501041_0099532
735 Ga0501041_0202865
736 Ga0501042_0050115
737 Ga0501046_0215758
738 Ga0501068_0246073
739 Ga0501069_0033781
740 Ga0501071_0056081
741 Ga0501071_0110133
742 Ga0501072_0094835
743 Ga0501072_0173057
744 Ga0501074_0277549
745 Ga0501075_0344740
746 Ga0501076_0046819
747 Ga0501076_0121479
748 Ga0501076_0122796
749 Ga0501076_0287002
750 Ga0501077_0047991
751 Ga0501079_0028951
752 Ga0501079_0077499
753 Ga0501079_0079871
754 Ga0501083_0197403
755 Ga0501035_0159434
756 Ga0501045_0040783
757 nmdc:mga05p37_111869_c1
758 nmdc:mga05p37_197845_c1
759 nmdc:mga05p37_3676_c1
760 nmdc:mga09592_69131_c1
761 nmdc:mga0qj67_173154_c1
762 nmdc:mga0qj67_230132_c1
763 nmdc:mga0qj67_377976_c1
764 nmdc:mga0qj67_40326_c1
765 nmdc:mga06r32_500470_c1
766 nmdc:mga08y16_104202_c1
767 nmdc:mga08y16_18646_c1
768 nmdc:mga08y16_286585_c1
769 nmdc:mga0a205_120860_c1
770 Ga0495655_0000008
771 Ga0495595_0102231
772 Ga0495619_0139428
773 Ga0495619_0303912
774 Ga0500628_000023
775 Ga0500616_0092028
776 Ga0501084_0152830
777 Ga0501082_0129701
778 Ga0466962_0023132
779 Ga0466962_0109353
780 8054285039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

50

265

0.98

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

61

274

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ix1-assembly1.cif.gz_A periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans 0.8713 39 332
4nmy-assembly2.cif.gz_B crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile 0.8677 39 338
4nmy-assembly2.cif.gz_B crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile 0.8624 39 338
3ix1-assembly1.cif.gz_A periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans 0.8502 39 332
4h6d-assembly2.cif.gz_B crystal structure of plp-soaked hmp synthase thi5 from s. cerevisiae 0.8355 39 342
ID Description Score Start End Superfamily
3ix1B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9337 122 222 3.40.190.10
3ix1B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9138 39 332 3.40.190.10
3ix1B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9083 122 222 3.40.190.10
3ix1B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8872 39 332 3.40.190.10
4nmyB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8857 39 338 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0L7SVS0-F1-model_v4 Thiamine biosynthesis protein 0.9311 93 333 GO:0009228
AF-A0A6J4TTZ4-F1-model_v4 Thiamine pyrimidine synthase 0.931 129 338 GO:0009228
GO:0016740
GO:0046872
AF-A0A2P8EQB8-F1-model_v4 deleted 0.9281 21 338
AF-A0A7W0TFI1-F1-model_v4 Thiamine pyrimidine synthase 0.9249 27 337 GO:0009228
GO:0016740
GO:0046872
AF-A0A4Q0Z2T6-F1-model_v4 Diguanylate cyclase 0.9223 37 335 GO:0005886
GO:0043709
GO:0052621
GO:1902201

Map