F431701

General Info

Members Datasets Scaffolds Average Seq Length
390 219 780 61

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100372936|Ga0075431_1003729362
Length 68
Sequence VPDRKPFLLRIDREVLDAIQRWADDDLRSLNGQIEFLLREALKKAKRLQTGEHVIRGTGERRKGQDSS

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
132 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
133 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
136 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
137 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
138 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
139 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
163 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
164 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
186 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
187 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
188 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
189 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
190 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
191 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
201 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
202 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 4.87
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100372936 3300006847 Bacteria 1432
2 Ga0065712_10068773 3300005290 Bacteria 9064
3 Ga0065715_10000855 3300005293 Bacteria 11839
4 Ga0065715_10161373 3300005293 Bacteria 1626
5 Ga0065715_10237187 3300005293 Bacteria 1143
6 Ga0065715_10241994 3300005293 Bacteria 1196
7 Ga0065715_10295041 3300005293 Bacteria 1054
8 Ga0070676_10655618 3300005328 Bacteria 762
9 Ga0070676_10752081 3300005328 Bacteria 716
10 Ga0070683_100044944 3300005329 Bacteria 4075
11 Ga0070690_100747053 3300005330 Bacteria 755
12 Ga0070670_100018693 3300005331 Bacteria 5941
13 Ga0068869_100909180 3300005334 Bacteria 762
14 Ga0068869_101017299 3300005334 Bacteria 722
15 Ga0070682_101405569 3300005337 Bacteria 597
16 Ga0070660_100491123 3300005339 Bacteria 1021
17 Ga0070660_101423479 3300005339 Bacteria 589
18 Ga0070689_100267590 3300005340 Bacteria 1414
19 Ga0070687_100730248 3300005343 Bacteria 695
20 Ga0070661_100159843 3300005344 Bacteria 1706
21 Ga0070661_101249070 3300005344 Bacteria 622
22 Ga0070668_102250767 3300005347 Bacteria 504
23 Ga0070669_100000559 3300005353 Bacteria 27684
24 Ga0070669_100343634 3300005353 Bacteria 1210
25 Ga0070675_100752996 3300005354 Bacteria 889
26 Ga0070675_101036075 3300005354 Bacteria 754
27 Ga0070675_101702792 3300005354 Bacteria 582
28 Ga0070671_100237201 3300005355 Bacteria 1548
29 Ga0070673_100386924 3300005364 Bacteria 1248
30 Ga0070688_100262004 3300005365 Bacteria 1235
31 Ga0070688_100915857 3300005365 Bacteria 692
32 Ga0070659_101055256 3300005366 Bacteria 715
33 Ga0070659_101182792 3300005366 Bacteria 676
34 Ga0070701_10054642 3300005438 Bacteria 2083
35 Ga0070701_10233954 3300005438 Bacteria 1102
36 Ga0070711_100020056 3300005439 Bacteria 4301
37 Ga0070700_100204955 3300005441 Bacteria 1388
38 Ga0070694_101909375 3300005444 Bacteria 507
39 Ga0068867_100650324 3300005459 Bacteria 925
40 Ga0070685_10264017 3300005466 Bacteria 1146
41 Ga0070707_102111930 3300005468 Unclassified 531
42 Ga0070698_100723362 3300005471 Bacteria 938
43 Ga0070698_101768246 3300005471 Bacteria 571
44 Ga0070679_100277417 3300005530 Bacteria 1629
45 Ga0070684_100003188 3300005535 Bacteria 12265
46 Ga0070672_100093181 3300005543 Bacteria 2433
47 Ga0070672_101913899 3300005543 Bacteria 534
48 Ga0070686_100297928 3300005544 Bacteria 1195
49 Ga0070686_101104755 3300005544 Bacteria 655
50 Ga0070695_100649372 3300005545 Bacteria 833
51 Ga0070693_100283095 3300005547 Bacteria 1111
52 Ga0070704_100178849 3300005549 Bacteria 1695
53 Ga0070664_100000686 3300005564 Bacteria 25845
54 Ga0070664_100537519 3300005564 Bacteria 1080
55 Ga0070664_101289453 3300005564 Bacteria 690
56 Ga0070664_101543399 3300005564 Bacteria 629
57 Ga0070664_101984718 3300005564 Bacteria 552
58 Ga0068857_100014864 3300005577 Bacteria 6789
59 Ga0068854_102142985 3300005578 Bacteria 517
60 Ga0068852_100610170 3300005616 Bacteria 1096
61 Ga0068859_100090328 3300005617 Bacteria 3114
62 Ga0068859_101651196 3300005617 Bacteria 708
63 Ga0068864_100151933 3300005618 Bacteria 2098
64 Ga0068861_101780690 3300005719 Bacteria 611
65 Ga0068870_10216502 3300005840 Bacteria 1170
66 Ga0068863_101171815 3300005841 Bacteria 774
67 Ga0068858_101521420 3300005842 Bacteria 660
68 Ga0068860_102076312 3300005843 Bacteria 590
69 Ga0068862_102176641 3300005844 Bacteria 566
70 Ga0075363_101043227 3300006048 Bacteria 505
71 Ga0075432_10336796 3300006058 Bacteria 636
72 Ga0075367_10003658 3300006178 Bacteria 7378
73 Ga0075366_10025244 3300006195 Bacteria 3469
74 Ga0075366_10937330 3300006195 Bacteria 540
75 Ga0075370_10199593 3300006353 Bacteria 1180
76 Ga0075428_100024579 3300006844 Bacteria 6667
77 Ga0075428_100050366 3300006844 Bacteria 4568
78 Ga0075428_100131597 3300006844 Bacteria 2721
79 Ga0075428_100206600 3300006844 Bacteria 2122
80 Ga0075430_100001245 3300006846 Bacteria 20493
81 Ga0075430_100012029 3300006846 Bacteria 7365
82 Ga0075430_100039193 3300006846 Bacteria 4012
83 Ga0075430_100074077 3300006846 Bacteria 2854
84 Ga0075430_100302090 3300006846 Bacteria 1324
85 Ga0075431_100013390 3300006847 Bacteria 8286
86 Ga0075431_100016294 3300006847 Bacteria 7541
87 Ga0075431_100018815 3300006847 Bacteria 7037
88 Ga0075431_100093936 3300006847 Bacteria 3095
89 Ga0075431_100348476 3300006847 Bacteria 1489
90 Ga0075433_10094606 3300006852 Bacteria 2644
91 Ga0075434_100095855 3300006871 Bacteria 2972
92 Ga0075434_100533377 3300006871 Bacteria 1194
93 Ga0075434_100821047 3300006871 Bacteria 946
94 Ga0075434_100877593 3300006871 Bacteria 912
95 Ga0075429_100007563 3300006880 Bacteria 9436
96 Ga0075429_100036322 3300006880 Bacteria 4285
97 Ga0075429_100093673 3300006880 Bacteria 2620
98 Ga0075429_100141428 3300006880 Bacteria 2106
99 Ga0075429_100889104 3300006880 Bacteria 780
100 Ga0097620_100090330 3300006931 Bacteria 3114
101 Ga0097620_101651023 3300006931 Bacteria 708
102 Ga0075435_100589374 3300007076 Bacteria 964
103 Ga0111539_10000560 3300009094 Bacteria 47624
104 Ga0111539_10005252 3300009094 Bacteria 16779
105 Ga0111539_10015842 3300009094 Bacteria 9366
106 Ga0111539_10043339 3300009094 Bacteria 5394
107 Ga0111539_12626524 3300009094 Bacteria 584
108 Ga0111539_13303295 3300009094 Unclassified 519
109 Ga0105245_12534503 3300009098 Bacteria 566
110 Ga0114129_10005586 3300009147 Bacteria 17791
111 Ga0114129_10006660 3300009147 Bacteria 16404
112 Ga0114129_10025123 3300009147 Bacteria 8444
113 Ga0114129_10039906 3300009147 Bacteria 6622
114 Ga0114129_10106572 3300009147 Bacteria 3871
115 Ga0114129_10424286 3300009147 Bacteria 1749
116 Ga0114129_12711423 3300009147 Bacteria 590
117 Ga0105243_12117313 3300009148 Bacteria 598
118 Ga0105241_10514804 3300009174 Bacteria 1069
119 Ga0105248_10368471 3300009177 Bacteria 1617
120 Ga0105249_10037108 3300009553 Bacteria 4422
121 Ga0105249_10221984 3300009553 Bacteria 1860
122 Ga0105249_12244438 3300009553 Bacteria 619
123 Ga0105239_12124625 3300010375 Bacteria 653
124 Ga0105246_10696746 3300011119 Bacteria 890
125 Ga0105246_12452430 3300011119 Bacteria 512
126 Ga0157374_10192281 3300013296 Bacteria 1996
127 Ga0157378_10606728 3300013297 Bacteria 1106
128 Ga0163162_10737366 3300013306 Bacteria 1105
129 Ga0157372_12802389 3300013307 Bacteria 559
130 Ga0157375_12578923 3300013308 Bacteria 607
131 Ga0163163_10005977 3300014325 Bacteria 10586
132 Ga0157380_10770839 3300014326 Bacteria 976
133 Ga0157380_11192099 3300014326 Bacteria 805
134 Ga0157380_12230637 3300014326 Bacteria 612
135 Ga0157380_12865371 3300014326 Bacteria 549
136 Ga0157377_10195500 3300014745 Bacteria 1281
137 Ga0157377_11340124 3300014745 Bacteria 561
138 Ga0157377_11699065 3300014745 Bacteria 509
139 Ga0157376_13092849 3300014969 Bacteria 504
140 Ga0207697_10084434 3300025315 Bacteria 1340
141 Ga0207688_10095694 3300025901 Bacteria 1709
142 Ga0207645_10223254 3300025907 Bacteria 1242
143 Ga0207643_10256313 3300025908 Bacteria 1079
144 Ga0207707_10693336 3300025912 Bacteria 856
145 Ga0207663_10111611 3300025916 Bacteria 1856
146 Ga0207657_10466249 3300025919 Bacteria 991
147 Ga0207657_10837843 3300025919 Bacteria 710
148 Ga0207657_10925557 3300025919 Bacteria 671
149 Ga0207649_10031664 3300025920 Bacteria 3146
150 Ga0207649_10277413 3300025920 Bacteria 1217
151 Ga0207646_10759515 3300025922 Bacteria 865
152 Ga0207681_10023622 3300025923 Bacteria 3935
153 Ga0207681_10081669 3300025923 Bacteria 2283
154 Ga0207650_10051924 3300025925 Bacteria 3035
155 Ga0207650_10380893 3300025925 Bacteria 1165
156 Ga0207650_11802504 3300025925 Bacteria 518
157 Ga0207659_10624096 3300025926 Bacteria 920
158 Ga0207690_10425561 3300025932 Bacteria 1063
159 Ga0207690_11503292 3300025932 Bacteria 563
160 Ga0207706_10242540 3300025933 Bacteria 1575
161 Ga0207670_11850808 3300025936 Bacteria 513
162 Ga0207691_10105479 3300025940 Bacteria 2511
163 Ga0207691_10875908 3300025940 Bacteria 752
164 Ga0207711_10402292 3300025941 Bacteria 1272
165 Ga0207661_10037254 3300025944 Bacteria 3802
166 Ga0207679_10000849 3300025945 Bacteria 19640
167 Ga0207679_11112263 3300025945 Bacteria 725
168 Ga0207651_10399172 3300025960 Bacteria 1169
169 Ga0207712_10002138 3300025961 Bacteria 12920
170 Ga0207712_10148766 3300025961 Bacteria 1806
171 Ga0207668_12003681 3300025972 Bacteria 522
172 Ga0207640_11016920 3300025981 Bacteria 730
173 Ga0207640_11541518 3300025981 Bacteria 598
174 Ga0207658_10127385 3300025986 Bacteria 2040
175 Ga0207639_11817741 3300026041 Bacteria 570
176 Ga0207708_10193382 3300026075 Bacteria 1620
177 Ga0207708_11220090 3300026075 Bacteria 658
178 Ga0207641_11274665 3300026088 Bacteria 735
179 Ga0207648_10083233 3300026089 Bacteria 2791
180 Ga0207676_10135071 3300026095 Bacteria 2103
181 Ga0207674_10012610 3300026116 Bacteria 9446
182 Ga0207675_101131173 3300026118 Bacteria 803
183 Ga0207698_10794346 3300026142 Bacteria 948
184 Ga0209970_1039035 3300027614 Bacteria 841
185 Ga0207428_10006014 3300027907 Bacteria 11228
186 Ga0207428_10030608 3300027907 Bacteria 4449
187 Ga0207428_10486092 3300027907 Bacteria 898
188 Ga0268266_10112660 3300028379 Bacteria 2412
189 Ga0268265_10036987 3300028380 Bacteria 3579
190 Ga0268265_11628185 3300028380 Bacteria 651
191 Ga0268265_12166162 3300028380 Bacteria 563
192 Ga0268264_11377174 3300028381 Bacteria 716
193 Ga0307408_100239474 3300031548 Bacteria 1490
194 Ga0307408_100547556 3300031548 Bacteria 1020
195 Ga0307408_102176166 3300031548 Bacteria 536
196 Ga0307405_11521870 3300031731 Bacteria 588
197 Ga0307413_11059462 3300031824 Bacteria 698
198 Ga0307413_11898366 3300031824 Bacteria 535
199 Ga0307413_12113642 3300031824 Bacteria 509
200 Ga0307410_10736251 3300031852 Bacteria 834
201 Ga0307410_10788715 3300031852 Bacteria 807
202 Ga0307410_11013268 3300031852 Bacteria 717
203 Ga0307406_10231104 3300031901 Bacteria 1381
204 Ga0307406_10948937 3300031901 Bacteria 735
205 Ga0307407_10058925 3300031903 Bacteria 2234
206 Ga0307407_10809176 3300031903 Bacteria 713
207 Ga0307412_10400711 3300031911 Bacteria 1117
208 Ga0307412_10477204 3300031911 Bacteria 1033
209 Ga0307412_10523089 3300031911 Bacteria 991
210 Ga0307409_100310103 3300031995 Bacteria 1472
211 Ga0307409_100426043 3300031995 Bacteria 1274
212 Ga0307409_100426069 3300031995 Bacteria 1274
213 Ga0307409_100515828 3300031995 Bacteria 1167
214 Ga0307416_100105085 3300032002 Bacteria 2471
215 Ga0307416_100113651 3300032002 Bacteria 2393
216 Ga0307416_101105184 3300032002 Bacteria 897
217 Ga0307416_102372151 3300032002 Bacteria 630
218 Ga0307414_10930978 3300032004 Bacteria 798
219 Ga0307411_10417796 3300032005 Bacteria 1113
220 Ga0307411_10433129 3300032005 Bacteria 1095
221 Ga0307411_10559026 3300032005 Bacteria 977
222 Ga0307411_11445408 3300032005 Bacteria 630
223 Ga0307415_100298842 3300032126 Bacteria 1333
224 Ga0307415_100577064 3300032126 Bacteria 997
225 Ga0307415_101284971 3300032126 Bacteria 692
226 Ga0307415_101315227 3300032126 Unclassified 685
227 Ga0373946_0311665 3300035171 Bacteria 780
228 Ga0439439_0210408 3300041406 Bacteria 568
229 Ga0451853_0010467 3300041512 Bacteria 569
230 Ga0439431_0130778 3300041997 Bacteria 704
231 Ga0439431_0218207 3300041997 Bacteria 559
232 Ga0439433_0101531 3300041999 Bacteria 714
233 Ga0439441_056904 3300042001 Bacteria 816
234 Ga0439443_111975 3300042003 Bacteria 530
235 Ga0439449_0127877 3300042007 Bacteria 944
236 Ga0439450_070111 3300042008 Bacteria 859
237 Ga0439450_102879 3300042008 Bacteria 726
238 Ga0450914_058847 3300042118 Bacteria 518
239 Ga0450921_016792 3300042123 Bacteria 667
240 Ga0450890_026706 3300042127 Bacteria 805
241 Ga0450898_113340 3300042134 Bacteria 575
242 Ga0439434_0070976 3300042435 Bacteria 1096
243 Ga0439464_0035965 3300042439 Bacteria 1400
244 Ga0439460_0028081 3300042461 Bacteria 1585
245 Ga0439460_0080778 3300042461 Bacteria 1020
246 Ga0439460_0339494 3300042461 Bacteria 529
247 Ga0451577_1834090 3300042876 Bacteria 532
248 Ga0439440_0041296 3300042993 Bacteria 1125
249 Ga0439440_0070387 3300042993 Bacteria 909
250 Ga0439440_0084035 3300042993 Bacteria 846
251 Ga0451576_0526715 3300045051 Bacteria 1242
252 Ga0451576_1022842 3300045051 Bacteria 866
253 Ga0451576_1491963 3300045051 Bacteria 702
254 Ga0495603_0100548 3300046455 Bacteria 1688
255 Ga0495580_0984447 3300046472 Bacteria 538
256 Ga0495669_0613836 3300046684 Bacteria 529
257 Ga0495676_1049875 3300047321 Unclassified 519
258 Ga0496101_0100290 3300048904 Bacteria 2166
259 Ga0496102_0025154 3300048905 Bacteria 5296
260 Ga0496102_0777232 3300048905 Bacteria 880
261 Ga0496104_0003263 3300048907 Bacteria 13992
262 Ga0496104_1791506 3300048907 Bacteria 516
263 Ga0496105_0282705 3300048908 Bacteria 1337
264 Ga0496106_0081902 3300048909 Bacteria 2480
265 Ga0496108_0001373 3300048911 Bacteria 19156
266 Ga0496108_0108968 3300048911 Bacteria 2366
267 Ga0496109_0001103 3300048912 Bacteria 22385
268 Ga0496109_1459354 3300048912 Bacteria 619
269 Ga0496110_0000490 3300048913 Bacteria 26916
270 Ga0496110_0223825 3300048913 Bacteria 1711
271 Ga0496111_0010866 3300048914 Bacteria 6123
272 Ga0496112_0000535 3300048915 Bacteria 26020
273 Ga0496112_0023381 3300048915 Bacteria 5905
274 Ga0496113_0032577 3300048916 Bacteria 3788
275 Ga0496113_0237847 3300048916 Bacteria 1453
276 Ga0496114_0329443 3300048917 Bacteria 1350
277 Ga0501291_014078 3300049514 Bacteria 1192
278 Ga0501298_027849 3300049521 Bacteria 1094
279 Ga0501298_065070 3300049521 Bacteria 778
280 Ga0501299_009347 3300049522 Bacteria 1614
281 Ga0501031_0056276 3300049568 Bacteria 2562
282 Ga0501033_0602966 3300049570 Bacteria 753
283 Ga0501036_0223998 3300049572 Bacteria 1579
284 Ga0501036_0509279 3300049572 Bacteria 1001
285 Ga0501036_0536385 3300049572 Bacteria 973
286 Ga0501036_1084927 3300049572 Bacteria 654
287 Ga0501036_1431473 3300049572 Bacteria 560
288 Ga0501037_0810276 3300049573 Bacteria 618
289 Ga0501038_0920067 3300049574 Bacteria 645
290 Ga0501039_0028692 3300049575 Bacteria 4285
291 Ga0501039_1015787 3300049575 Bacteria 644
292 Ga0501040_0684097 3300049576 Bacteria 742
293 Ga0501041_0180478 3300049577 Bacteria 1321
294 Ga0501041_0194108 3300049577 Bacteria 1272
295 Ga0501042_0183181 3300049578 Bacteria 1511
296 Ga0501042_0629592 3300049578 Bacteria 780
297 Ga0501042_0640199 3300049578 Bacteria 773
298 Ga0501046_0518849 3300049580 Bacteria 852
299 Ga0501048_0377328 3300049582 Bacteria 1012
300 Ga0501068_1101862 3300049584 Bacteria 525
301 Ga0501069_0571584 3300049585 Bacteria 677
302 Ga0501070_0607739 3300049586 Bacteria 871
303 Ga0501071_0007655 3300049587 Bacteria 7117
304 Ga0501071_0068579 3300049587 Bacteria 2581
305 Ga0501071_0652514 3300049587 Bacteria 810
306 Ga0501072_0015911 3300049588 Bacteria 5767
307 Ga0501072_0075852 3300049588 Bacteria 2660
308 Ga0501072_0827819 3300049588 Bacteria 724
309 Ga0501074_0721057 3300049590 Bacteria 703
310 Ga0501075_0872301 3300049591 Bacteria 684
311 Ga0501076_1640887 3300049592 Bacteria 527
312 Ga0501077_0124956 3300049593 Bacteria 1631
313 Ga0501077_0702911 3300049593 Bacteria 650
314 Ga0501077_1149585 3300049593 Bacteria 500
315 Ga0501198_050032 3300049649 Bacteria 743
316 Ga0501206_039756 3300049653 Bacteria 722
317 Ga0501207_035799 3300049654 Bacteria 850
318 Ga0501216_005801 3300049660 Bacteria 1873
319 Ga0501217_032171 3300049661 Bacteria 1297
320 Ga0501230_077170 3300049667 Bacteria 693
321 Ga0501233_109695 3300049668 Bacteria 737
322 Ga0501235_060862 3300049669 Bacteria 884
323 Ga0501225_0049244 3300049705 Bacteria 1171
324 Ga0501079_1368246 3300049741 Bacteria 557
325 Ga0501080_0322229 3300049742 Bacteria 1399
326 Ga0501080_0899597 3300049742 Bacteria 772
327 Ga0501081_0161356 3300049743 Bacteria 1615
328 Ga0501081_0506866 3300049743 Bacteria 900
329 Ga0501081_0960864 3300049743 Bacteria 645
330 Ga0501083_0076254 3300049744 Bacteria 2225
331 Ga0501083_0468207 3300049744 Bacteria 820
332 Ga0501263_070117 3300049760 Bacteria 564
333 Ga0501268_175628 3300049765 Bacteria 507
334 Ga0501272_035017 3300049769 Bacteria 652
335 Ga0501273_041190 3300049770 Bacteria 684
336 Ga0501273_080507 3300049770 Bacteria 541
337 Ga0501275_083390 3300049772 Bacteria 521
338 Ga0501045_0151509 3300049824 Bacteria 1725
339 Ga0501212_104897 3300049851 Bacteria 534
340 nmdc:mga0k408_1607_c1 3300050493 Bacteria 12232
341 nmdc:mga0k408_880129_c1 3300050493 Bacteria 520
342 nmdc:mga06z11_171628_c1 3300050494 Bacteria 1246
343 nmdc:mga07m45_122229_c1 3300050496 Bacteria 1504
344 nmdc:mga05p37_1618006_c1 3300050507 Bacteria 637
345 nmdc:mga05p37_1751550_c1 3300050507 Bacteria 602
346 nmdc:mga05p37_208081_c1 3300050507 Bacteria 2366
347 nmdc:mga05p37_22191_c1 3300050507 Bacteria 7696
348 nmdc:mga05p37_23121_c1 3300050507 Bacteria 7542
349 nmdc:mga05p37_5652_c1 3300050507 Bacteria 14705
350 nmdc:mga05p37_573801_c1 3300050507 Bacteria 1279
351 nmdc:mga05p37_5981_c1 3300050507 Bacteria 14322
352 nmdc:mga05p37_89757_c1 3300050507 Bacteria 3787
353 nmdc:mga09592_100804_c1 3300050508 Bacteria 2473
354 nmdc:mga09592_105133_c1 3300050508 Bacteria 2420
355 nmdc:mga09592_109117_c1 3300050508 Bacteria 2374
356 nmdc:mga09592_1170352_c1 3300050508 Bacteria 637
357 nmdc:mga09592_15098_c1 3300050508 Bacteria 6309
358 nmdc:mga09592_834984_c1 3300050508 Bacteria 778
359 nmdc:mga09592_9385_c1 3300050508 Bacteria 7954
360 nmdc:mga0qj67_123689_c1 3300050509 Bacteria 2093
361 nmdc:mga0qj67_131432_c1 3300050509 Bacteria 2028
362 nmdc:mga0qj67_161549_c1 3300050509 Bacteria 1819
363 nmdc:mga0qj67_266937_c1 3300050509 Bacteria 1388
364 nmdc:mga0qj67_556577_c1 3300050509 Bacteria 920
365 nmdc:mga06r32_103235_c1 3300050510 Bacteria 2799
366 nmdc:mga06r32_153428_c1 3300050510 Bacteria 2283
367 nmdc:mga06r32_16708_c1 3300050510 Bacteria 6689
368 nmdc:mga06r32_1953965_c1 3300050510 Bacteria 521
369 nmdc:mga06r32_2076360_c1 3300050510 Unclassified 501
370 nmdc:mga06r32_27447_c1 3300050510 Bacteria 5318
371 nmdc:mga06r32_47496_c1 3300050510 Bacteria 4101
372 nmdc:mga06r32_73459_c1 3300050510 Bacteria 3314
373 nmdc:mga08y16_11000_c1 3300050511 Bacteria 9500
374 nmdc:mga08y16_26830_c1 3300050511 Bacteria 6070
375 nmdc:mga08y16_443433_c1 3300050511 Bacteria 1325
376 nmdc:mga08y16_69740_c1 3300050511 Bacteria 3665
377 nmdc:mga08y16_82149_c1 3300050511 Bacteria 3359
378 nmdc:mga0n895_101545_c1 3300050512 Bacteria 2886
379 nmdc:mga0n895_1274380_c1 3300050512 Bacteria 707
380 nmdc:mga0n895_361807_c1 3300050512 Bacteria 1469
381 nmdc:mga0n895_95228_c1 3300050512 Bacteria 2982
382 nmdc:mga0rr50_520548_c1 3300050513 Bacteria 1012
383 nmdc:mga0a205_232299_c1 3300050515 Bacteria 1727
384 nmdc:mga0a205_503920_c1 3300050515 Bacteria 1067
385 Ga0501084_0600443 3300054114 Bacteria 930
386 Ga0590075_060028 3300059424 Bacteria 980
387 Ga0501082_0162352 3300060353 Bacteria 1942
388 Ga0501082_0198839 3300060353 Bacteria 1744
389 Ga0501082_0633110 3300060353 Bacteria 936
390 Ga0530510_0481255 3300061734 Bacteria 940
391 Ga0075431_100372936
392 Ga0065712_10068773
393 Ga0065715_10000855
394 Ga0065715_10161373
395 Ga0065715_10237187
396 Ga0065715_10241994
397 Ga0065715_10295041
398 Ga0070676_10655618
399 Ga0070676_10752081
400 Ga0070683_100044944
401 Ga0070690_100747053
402 Ga0070670_100018693
403 Ga0068869_100909180
404 Ga0068869_101017299
405 Ga0070682_101405569
406 Ga0070660_100491123
407 Ga0070660_101423479
408 Ga0070689_100267590
409 Ga0070687_100730248
410 Ga0070661_100159843
411 Ga0070661_101249070
412 Ga0070668_102250767
413 Ga0070669_100000559
414 Ga0070669_100343634
415 Ga0070675_100752996
416 Ga0070675_101036075
417 Ga0070675_101702792
418 Ga0070671_100237201
419 Ga0070673_100386924
420 Ga0070688_100262004
421 Ga0070688_100915857
422 Ga0070659_101055256
423 Ga0070659_101182792
424 Ga0070701_10054642
425 Ga0070701_10233954
426 Ga0070711_100020056
427 Ga0070700_100204955
428 Ga0070694_101909375
429 Ga0068867_100650324
430 Ga0070685_10264017
431 Ga0070707_102111930
432 Ga0070698_100723362
433 Ga0070698_101768246
434 Ga0070679_100277417
435 Ga0070684_100003188
436 Ga0070672_100093181
437 Ga0070672_101913899
438 Ga0070686_100297928
439 Ga0070686_101104755
440 Ga0070695_100649372
441 Ga0070693_100283095
442 Ga0070704_100178849
443 Ga0070664_100000686
444 Ga0070664_100537519
445 Ga0070664_101289453
446 Ga0070664_101543399
447 Ga0070664_101984718
448 Ga0068857_100014864
449 Ga0068854_102142985
450 Ga0068852_100610170
451 Ga0068859_100090328
452 Ga0068859_101651196
453 Ga0068864_100151933
454 Ga0068861_101780690
455 Ga0068870_10216502
456 Ga0068863_101171815
457 Ga0068858_101521420
458 Ga0068860_102076312
459 Ga0068862_102176641
460 Ga0075363_101043227
461 Ga0075432_10336796
462 Ga0075367_10003658
463 Ga0075366_10025244
464 Ga0075366_10937330
465 Ga0075370_10199593
466 Ga0075428_100024579
467 Ga0075428_100050366
468 Ga0075428_100131597
469 Ga0075428_100206600
470 Ga0075430_100001245
471 Ga0075430_100012029
472 Ga0075430_100039193
473 Ga0075430_100074077
474 Ga0075430_100302090
475 Ga0075431_100013390
476 Ga0075431_100016294
477 Ga0075431_100018815
478 Ga0075431_100093936
479 Ga0075431_100348476
480 Ga0075433_10094606
481 Ga0075434_100095855
482 Ga0075434_100533377
483 Ga0075434_100821047
484 Ga0075434_100877593
485 Ga0075429_100007563
486 Ga0075429_100036322
487 Ga0075429_100093673
488 Ga0075429_100141428
489 Ga0075429_100889104
490 Ga0097620_100090330
491 Ga0097620_101651023
492 Ga0075435_100589374
493 Ga0111539_10000560
494 Ga0111539_10005252
495 Ga0111539_10015842
496 Ga0111539_10043339
497 Ga0111539_12626524
498 Ga0111539_13303295
499 Ga0105245_12534503
500 Ga0114129_10005586
501 Ga0114129_10006660
502 Ga0114129_10025123
503 Ga0114129_10039906
504 Ga0114129_10106572
505 Ga0114129_10424286
506 Ga0114129_12711423
507 Ga0105243_12117313
508 Ga0105241_10514804
509 Ga0105248_10368471
510 Ga0105249_10037108
511 Ga0105249_10221984
512 Ga0105249_12244438
513 Ga0105239_12124625
514 Ga0105246_10696746
515 Ga0105246_12452430
516 Ga0157374_10192281
517 Ga0157378_10606728
518 Ga0163162_10737366
519 Ga0157372_12802389
520 Ga0157375_12578923
521 Ga0163163_10005977
522 Ga0157380_10770839
523 Ga0157380_11192099
524 Ga0157380_12230637
525 Ga0157380_12865371
526 Ga0157377_10195500
527 Ga0157377_11340124
528 Ga0157377_11699065
529 Ga0157376_13092849
530 Ga0207697_10084434
531 Ga0207688_10095694
532 Ga0207645_10223254
533 Ga0207643_10256313
534 Ga0207707_10693336
535 Ga0207663_10111611
536 Ga0207657_10466249
537 Ga0207657_10837843
538 Ga0207657_10925557
539 Ga0207649_10031664
540 Ga0207649_10277413
541 Ga0207646_10759515
542 Ga0207681_10023622
543 Ga0207681_10081669
544 Ga0207650_10051924
545 Ga0207650_10380893
546 Ga0207650_11802504
547 Ga0207659_10624096
548 Ga0207690_10425561
549 Ga0207690_11503292
550 Ga0207706_10242540
551 Ga0207670_11850808
552 Ga0207691_10105479
553 Ga0207691_10875908
554 Ga0207711_10402292
555 Ga0207661_10037254
556 Ga0207679_10000849
557 Ga0207679_11112263
558 Ga0207651_10399172
559 Ga0207712_10002138
560 Ga0207712_10148766
561 Ga0207668_12003681
562 Ga0207640_11016920
563 Ga0207640_11541518
564 Ga0207658_10127385
565 Ga0207639_11817741
566 Ga0207708_10193382
567 Ga0207708_11220090
568 Ga0207641_11274665
569 Ga0207648_10083233
570 Ga0207676_10135071
571 Ga0207674_10012610
572 Ga0207675_101131173
573 Ga0207698_10794346
574 Ga0209970_1039035
575 Ga0207428_10006014
576 Ga0207428_10030608
577 Ga0207428_10486092
578 Ga0268266_10112660
579 Ga0268265_10036987
580 Ga0268265_11628185
581 Ga0268265_12166162
582 Ga0268264_11377174
583 Ga0307408_100239474
584 Ga0307408_100547556
585 Ga0307408_102176166
586 Ga0307405_11521870
587 Ga0307413_11059462
588 Ga0307413_11898366
589 Ga0307413_12113642
590 Ga0307410_10736251
591 Ga0307410_10788715
592 Ga0307410_11013268
593 Ga0307406_10231104
594 Ga0307406_10948937
595 Ga0307407_10058925
596 Ga0307407_10809176
597 Ga0307412_10400711
598 Ga0307412_10477204
599 Ga0307412_10523089
600 Ga0307409_100310103
601 Ga0307409_100426043
602 Ga0307409_100426069
603 Ga0307409_100515828
604 Ga0307416_100105085
605 Ga0307416_100113651
606 Ga0307416_101105184
607 Ga0307416_102372151
608 Ga0307414_10930978
609 Ga0307411_10417796
610 Ga0307411_10433129
611 Ga0307411_10559026
612 Ga0307411_11445408
613 Ga0307415_100298842
614 Ga0307415_100577064
615 Ga0307415_101284971
616 Ga0307415_101315227
617 Ga0373946_0311665
618 Ga0439439_0210408
619 Ga0451853_0010467
620 Ga0439431_0130778
621 Ga0439431_0218207
622 Ga0439433_0101531
623 Ga0439441_056904
624 Ga0439443_111975
625 Ga0439449_0127877
626 Ga0439450_070111
627 Ga0439450_102879
628 Ga0450914_058847
629 Ga0450921_016792
630 Ga0450890_026706
631 Ga0450898_113340
632 Ga0439434_0070976
633 Ga0439464_0035965
634 Ga0439460_0028081
635 Ga0439460_0080778
636 Ga0439460_0339494
637 Ga0451577_1834090
638 Ga0439440_0041296
639 Ga0439440_0070387
640 Ga0439440_0084035
641 Ga0451576_0526715
642 Ga0451576_1022842
643 Ga0451576_1491963
644 Ga0495603_0100548
645 Ga0495580_0984447
646 Ga0495669_0613836
647 Ga0495676_1049875
648 Ga0496101_0100290
649 Ga0496102_0025154
650 Ga0496102_0777232
651 Ga0496104_0003263
652 Ga0496104_1791506
653 Ga0496105_0282705
654 Ga0496106_0081902
655 Ga0496108_0001373
656 Ga0496108_0108968
657 Ga0496109_0001103
658 Ga0496109_1459354
659 Ga0496110_0000490
660 Ga0496110_0223825
661 Ga0496111_0010866
662 Ga0496112_0000535
663 Ga0496112_0023381
664 Ga0496113_0032577
665 Ga0496113_0237847
666 Ga0496114_0329443
667 Ga0501291_014078
668 Ga0501298_027849
669 Ga0501298_065070
670 Ga0501299_009347
671 Ga0501031_0056276
672 Ga0501033_0602966
673 Ga0501036_0223998
674 Ga0501036_0509279
675 Ga0501036_0536385
676 Ga0501036_1084927
677 Ga0501036_1431473
678 Ga0501037_0810276
679 Ga0501038_0920067
680 Ga0501039_0028692
681 Ga0501039_1015787
682 Ga0501040_0684097
683 Ga0501041_0180478
684 Ga0501041_0194108
685 Ga0501042_0183181
686 Ga0501042_0629592
687 Ga0501042_0640199
688 Ga0501046_0518849
689 Ga0501048_0377328
690 Ga0501068_1101862
691 Ga0501069_0571584
692 Ga0501070_0607739
693 Ga0501071_0007655
694 Ga0501071_0068579
695 Ga0501071_0652514
696 Ga0501072_0015911
697 Ga0501072_0075852
698 Ga0501072_0827819
699 Ga0501074_0721057
700 Ga0501075_0872301
701 Ga0501076_1640887
702 Ga0501077_0124956
703 Ga0501077_0702911
704 Ga0501077_1149585
705 Ga0501198_050032
706 Ga0501206_039756
707 Ga0501207_035799
708 Ga0501216_005801
709 Ga0501217_032171
710 Ga0501230_077170
711 Ga0501233_109695
712 Ga0501235_060862
713 Ga0501225_0049244
714 Ga0501079_1368246
715 Ga0501080_0322229
716 Ga0501080_0899597
717 Ga0501081_0161356
718 Ga0501081_0506866
719 Ga0501081_0960864
720 Ga0501083_0076254
721 Ga0501083_0468207
722 Ga0501263_070117
723 Ga0501268_175628
724 Ga0501272_035017
725 Ga0501273_041190
726 Ga0501273_080507
727 Ga0501275_083390
728 Ga0501045_0151509
729 Ga0501212_104897
730 nmdc:mga0k408_1607_c1
731 nmdc:mga0k408_880129_c1
732 nmdc:mga06z11_171628_c1
733 nmdc:mga07m45_122229_c1
734 nmdc:mga05p37_1618006_c1
735 nmdc:mga05p37_1751550_c1
736 nmdc:mga05p37_208081_c1
737 nmdc:mga05p37_22191_c1
738 nmdc:mga05p37_23121_c1
739 nmdc:mga05p37_5652_c1
740 nmdc:mga05p37_573801_c1
741 nmdc:mga05p37_5981_c1
742 nmdc:mga05p37_89757_c1
743 nmdc:mga09592_100804_c1
744 nmdc:mga09592_105133_c1
745 nmdc:mga09592_109117_c1
746 nmdc:mga09592_1170352_c1
747 nmdc:mga09592_15098_c1
748 nmdc:mga09592_834984_c1
749 nmdc:mga09592_9385_c1
750 nmdc:mga0qj67_123689_c1
751 nmdc:mga0qj67_131432_c1
752 nmdc:mga0qj67_161549_c1
753 nmdc:mga0qj67_266937_c1
754 nmdc:mga0qj67_556577_c1
755 nmdc:mga06r32_103235_c1
756 nmdc:mga06r32_153428_c1
757 nmdc:mga06r32_16708_c1
758 nmdc:mga06r32_1953965_c1
759 nmdc:mga06r32_2076360_c1
760 nmdc:mga06r32_27447_c1
761 nmdc:mga06r32_47496_c1
762 nmdc:mga06r32_73459_c1
763 nmdc:mga08y16_11000_c1
764 nmdc:mga08y16_26830_c1
765 nmdc:mga08y16_443433_c1
766 nmdc:mga08y16_69740_c1
767 nmdc:mga08y16_82149_c1
768 nmdc:mga0n895_101545_c1
769 nmdc:mga0n895_1274380_c1
770 nmdc:mga0n895_361807_c1
771 nmdc:mga0n895_95228_c1
772 nmdc:mga0rr50_520548_c1
773 nmdc:mga0a205_232299_c1
774 nmdc:mga0a205_503920_c1
775 Ga0501084_0600443
776 Ga0590075_060028
777 Ga0501082_0162352
778 Ga0501082_0198839
779 Ga0501082_0633110
780 Ga0530510_0481255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03869

Arc

Arc-like DNA binding domain

2

50

0.94

Map