F431677

General Info

Members Datasets Scaffolds Average Seq Length
390 173 780 386

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100084387|Ga0070704_1000843872
Length 411
Sequence MRTADAVIIGGGVTGVSIAFHLAGSGLRRVLVLERKFLGAGGTGRSVGIIRQLYPTRETSEMVLRSLAIFERFGEAVGGEAGFVRTGALIGVSPSMRPTLERTLALQRGIGIQAEIVDPADLARIEPRIETSGLGAVLWEPGSGYGDPSAVTAGFAAAARRRGAVIEQGVEVIAIRRQADQVVGVDTATGERIDAPVVINAAGLWSPGVARLAGVELPIVIGRHPVFTVARDAGFGPAHTVYLDLAGGSYVRPETGNLTLTGSLTDDETQHPMDPELLGSEAGFDEAEDVLARTARAIPALADARFSGGYAGAFDITPDWMPILDESPVRGLWIAAGMSGHGFKLSPAVGEMVAALVTGRTPTVSSAPFRFDRFAESEASTTFVSSYLPPAGSSVAATHPNTVPGGSNTHE

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
167 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
168 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
169 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
170 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
171 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
172 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
173 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.77
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.26
Rhizoplane 0.26
Rhizosphere 97.18
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100084387 3300005549 Bacteria 2348
2 JGI24735J21928_10002743 3300002067 Bacteria 6076
3 Ga0070676_10042300 3300005328 Bacteria 2644
4 Ga0070670_100001289 3300005331 Bacteria 20007
5 Ga0068869_100003857 3300005334 Bacteria 9251
6 Ga0068869_100010169 3300005334 Bacteria 6126
7 Ga0070680_100001395 3300005336 Bacteria 17457
8 Ga0070682_100087485 3300005337 Bacteria 2031
9 Ga0070660_100019575 3300005339 Bacteria 4963
10 Ga0070691_10024303 3300005341 Unclassified 2816
11 Ga0070661_100009543 3300005344 Bacteria 6722
12 Ga0070692_10001432 3300005345 Bacteria 8653
13 Ga0070692_10023317 3300005345 Unclassified 3032
14 Ga0070669_100172441 3300005353 Bacteria 1687
15 Ga0070673_100137040 3300005364 Bacteria 2061
16 Ga0070659_100012916 3300005366 Bacteria 6207
17 Ga0070701_10013056 3300005438 Unclassified 3768
18 Ga0070700_100095147 3300005441 Unclassified 1952
19 Ga0070694_100001362 3300005444 Bacteria 14276
20 Ga0070694_100004339 3300005444 Bacteria 8524
21 Ga0070694_100059539 3300005444 Bacteria 2602
22 Ga0070708_100015649 3300005445 Bacteria 6269
23 Ga0070708_100032687 3300005445 Bacteria 4515
24 Ga0070708_100039162 3300005445 Bacteria 4145
25 Ga0070708_100044174 3300005445 Bacteria 3917
26 Ga0070708_100052767 3300005445 Bacteria 3606
27 Ga0070708_100138065 3300005445 Bacteria 2259
28 Ga0070708_100224798 3300005445 Bacteria 1761
29 Ga0070662_100018535 3300005457 Bacteria 4710
30 Ga0070681_10021175 3300005458 Bacteria 6515
31 Ga0068867_100011008 3300005459 Bacteria 6377
32 Ga0068867_100038428 3300005459 Bacteria 3484
33 Ga0068867_100057031 3300005459 Unclassified 2891
34 Ga0070706_100007654 3300005467 Bacteria 10106
35 Ga0070706_100008822 3300005467 Bacteria 9394
36 Ga0070706_100010349 3300005467 Bacteria 8665
37 Ga0070706_100014021 3300005467 Bacteria 7405
38 Ga0070706_100020684 3300005467 Bacteria 6063
39 Ga0070706_100133243 3300005467 Bacteria 2319
40 Ga0070707_100001745 3300005468 Bacteria 20935
41 Ga0070707_100015991 3300005468 Bacteria 7041
42 Ga0070707_100017102 3300005468 Bacteria 6810
43 Ga0070707_100017919 3300005468 Bacteria 6659
44 Ga0070707_100029103 3300005468 Bacteria 5258
45 Ga0070707_100048484 3300005468 Bacteria 4069
46 Ga0070707_100054071 3300005468 Bacteria 3849
47 Ga0070698_100002999 3300005471 Bacteria 18592
48 Ga0070698_100017595 3300005471 Bacteria 7532
49 Ga0070698_100019521 3300005471 Bacteria 7113
50 Ga0070699_100007084 3300005518 Bacteria 9737
51 Ga0070699_100072852 3300005518 Bacteria 2988
52 Ga0070679_100020201 3300005530 Bacteria 6493
53 Ga0070697_100001193 3300005536 Bacteria 19656
54 Ga0070697_100006619 3300005536 Bacteria 8984
55 Ga0070697_100009658 3300005536 Bacteria 7536
56 Ga0070697_100040057 3300005536 Bacteria 3789
57 Ga0070697_100050597 3300005536 Unclassified 3373
58 Ga0070697_100115518 3300005536 Bacteria 2241
59 Ga0068853_100010688 3300005539 Bacteria 7432
60 Ga0070672_100193482 3300005543 Bacteria 1699
61 Ga0070695_100000048 3300005545 Bacteria 47033
62 Ga0070695_100004087 3300005545 Bacteria 8531
63 Ga0070695_100004673 3300005545 Bacteria 8054
64 Ga0070695_100015601 3300005545 Bacteria 4587
65 Ga0070695_100015719 3300005545 Bacteria 4573
66 Ga0070695_100147528 3300005545 Bacteria 1638
67 Ga0070696_100010584 3300005546 Bacteria 6181
68 Ga0070696_100014718 3300005546 Bacteria 5250
69 Ga0070696_100025626 3300005546 Bacteria 4010
70 Ga0070693_100000159 3300005547 Bacteria 30940
71 Ga0070693_100099005 3300005547 Bacteria 1773
72 Ga0070704_100000116 3300005549 Bacteria 28451
73 Ga0068855_100001156 3300005563 Bacteria 32706
74 Ga0068857_100329834 3300005577 Archaea 1410
75 Ga0068856_100185630 3300005614 Unclassified 2093
76 Ga0068856_100209939 3300005614 Unclassified 1962
77 Ga0068859_100150349 3300005617 Bacteria 2404
78 Ga0068861_100025732 3300005719 Bacteria 4272
79 Ga0068870_10002227 3300005840 Bacteria 8046
80 Ga0068870_10064977 3300005840 Unclassified 1972
81 Ga0068863_100190524 3300005841 Unclassified 1970
82 Ga0068860_100089714 3300005843 Bacteria 2927
83 Ga0068860_100155299 3300005843 Unclassified 2205
84 Ga0068860_100208681 3300005843 Unclassified 1894
85 Ga0068862_100025202 3300005844 Bacteria 4993
86 Ga0081455_10006197 3300005937 Bacteria 12894
87 Ga0081538_10002059 3300005981 Bacteria 20076
88 Ga0070716_100029742 3300006173 Bacteria 2956
89 Ga0070712_100116894 3300006175 Bacteria 2001
90 Ga0075428_100011091 3300006844 Bacteria 10027
91 Ga0075428_100211168 3300006844 Bacteria 2097
92 Ga0075430_100011109 3300006846 Bacteria 7633
93 Ga0075431_100000162 3300006847 Bacteria 46892
94 Ga0075431_100002607 3300006847 Bacteria 17443
95 Ga0075431_100083219 3300006847 Bacteria 3303
96 Ga0075431_100093946 3300006847 Bacteria 3095
97 Ga0075431_100177083 3300006847 Bacteria 2190
98 Ga0075433_10000094 3300006852 Bacteria 41881
99 Ga0075433_10001383 3300006852 Bacteria 17853
100 Ga0075433_10001866 3300006852 Bacteria 15837
101 Ga0075433_10027657 3300006852 Bacteria 4812
102 Ga0075433_10051245 3300006852 Bacteria 3594
103 Ga0075433_10117949 3300006852 Bacteria 2355
104 Ga0075433_10207208 3300006852 Bacteria 1743
105 Ga0075434_100000207 3300006871 Bacteria 39963
106 Ga0075434_100003606 3300006871 Bacteria 13818
107 Ga0075434_100009129 3300006871 Bacteria 9237
108 Ga0075434_100025372 3300006871 Bacteria 5798
109 Ga0075434_100079005 3300006871 Bacteria 3286
110 Ga0075434_100197980 3300006871 Bacteria 2029
111 Ga0075434_100203295 3300006871 Bacteria 2001
112 Ga0075429_100001320 3300006880 Bacteria 20236
113 Ga0075429_100021136 3300006880 Bacteria 5642
114 Ga0075429_100072183 3300006880 Bacteria 3006
115 Ga0075436_100002822 3300006914 Bacteria 11896
116 Ga0097620_100150351 3300006931 Bacteria 2404
117 Ga0075435_100011360 3300007076 Bacteria 6546
118 Ga0075435_100020589 3300007076 Bacteria 5058
119 Ga0075435_100034436 3300007076 Bacteria 4013
120 Ga0075435_100056770 3300007076 Bacteria 3165
121 Ga0075435_100072163 3300007076 Bacteria 2820
122 Ga0075435_100074898 3300007076 Bacteria 2770
123 Ga0099794_10055362 3300007265 Bacteria 1917
124 Ga0099794_10126749 3300007265 Bacteria 1287
125 Ga0105240_10172319 3300009093 Unclassified 2561
126 Ga0111539_10002279 3300009094 Bacteria 25538
127 Ga0111539_10004936 3300009094 Bacteria 17349
128 Ga0111539_10007623 3300009094 Bacteria 13830
129 Ga0114129_10000487 3300009147 Bacteria 47969
130 Ga0114129_10011558 3300009147 Bacteria 12573
131 Ga0114129_10083981 3300009147 Bacteria 4422
132 Ga0114129_10093295 3300009147 Bacteria 4170
133 Ga0114129_10244548 3300009147 Bacteria 2411
134 Ga0114129_10337357 3300009147 Bacteria 2000
135 Ga0105243_10005003 3300009148 Bacteria 10388
136 Ga0105241_10004152 3300009174 Bacteria 10696
137 Ga0105242_10131211 3300009176 Bacteria 2163
138 Ga0105248_10360023 3300009177 Bacteria 1638
139 Ga0105249_10099029 3300009553 Bacteria 2739
140 Ga0157373_10001579 3300013100 Bacteria 17390
141 Ga0157371_10066763 3300013102 Bacteria 2547
142 Ga0157370_10061928 3300013104 Unclassified 3550
143 Ga0157369_10000061 3300013105 Bacteria 151283
144 Ga0157369_10000366 3300013105 Bacteria 60297
145 Ga0157378_10260400 3300013297 Unclassified 1664
146 Ga0163162_10264597 3300013306 Bacteria 1851
147 Ga0157372_10009351 3300013307 Bacteria 10432
148 Ga0157372_10529704 3300013307 Bacteria 1373
149 Ga0206354_10039077 3300020081 Bacteria 3573
150 Ga0206354_11132685 3300020081 Bacteria 3918
151 Ga0224712_10000069 3300022467 Bacteria 15681
152 Ga0207699_10104500 3300025906 Unclassified 1804
153 Ga0207645_10000497 3300025907 Bacteria 32462
154 Ga0207643_10000696 3300025908 Bacteria 20944
155 Ga0207684_10001190 3300025910 Bacteria 29079
156 Ga0207684_10013794 3300025910 Bacteria 6981
157 Ga0207684_10017321 3300025910 Bacteria 6180
158 Ga0207684_10024086 3300025910 Bacteria 5193
159 Ga0207684_10029832 3300025910 Unclassified 4644
160 Ga0207684_10066570 3300025910 Bacteria 3060
161 Ga0207684_10188528 3300025910 Bacteria 1778
162 Ga0207707_10001074 3300025912 Bacteria 26185
163 Ga0207707_10058102 3300025912 Bacteria 3366
164 Ga0207695_10179070 3300025913 Bacteria 2041
165 Ga0207693_10127366 3300025915 Bacteria 2001
166 Ga0207663_10085707 3300025916 Bacteria 2075
167 Ga0207660_10022665 3300025917 Bacteria 4232
168 Ga0207657_10000681 3300025919 Bacteria 36192
169 Ga0207649_10009631 3300025920 Bacteria 5290
170 Ga0207646_10001440 3300025922 Bacteria 29536
171 Ga0207646_10006141 3300025922 Bacteria 12496
172 Ga0207646_10013235 3300025922 Bacteria 7893
173 Ga0207646_10020155 3300025922 Bacteria 6182
174 Ga0207646_10102661 3300025922 Bacteria 2564
175 Ga0207646_10121820 3300025922 Bacteria 2343
176 Ga0207646_10221323 3300025922 Bacteria 1710
177 Ga0207650_10026499 3300025925 Bacteria 4136
178 Ga0207690_10046641 3300025932 Bacteria 2871
179 Ga0207706_10018406 3300025933 Bacteria 6285
180 Ga0207704_10229672 3300025938 Unclassified 1379
181 Ga0207665_10045313 3300025939 Bacteria 2945
182 Ga0207689_10000721 3300025942 Bacteria 31658
183 Ga0207689_10008484 3300025942 Bacteria 8953
184 Ga0207679_10016483 3300025945 Bacteria 4908
185 Ga0207667_10016784 3300025949 Bacteria 8259
186 Ga0207640_10052946 3300025981 Bacteria 2647
187 Ga0207639_10017336 3300026041 Bacteria 5105
188 Ga0207678_10013487 3300026067 Bacteria 7174
189 Ga0207708_10075491 3300026075 Unclassified 2585
190 Ga0207702_10004238 3300026078 Bacteria 12805
191 Ga0207702_10115402 3300026078 Unclassified 2395
192 Ga0207641_10116399 3300026088 Unclassified 2378
193 Ga0207674_10000181 3300026116 Bacteria 77248
194 Ga0207674_10075076 3300026116 Unclassified 3391
195 Ga0207675_100028813 3300026118 Bacteria 5173
196 Ga0207675_100124526 3300026118 Bacteria 2441
197 Ga0207698_10309739 3300026142 Bacteria 1474
198 Ga0209971_1000068 3300027682 Bacteria 32081
199 Ga0209966_1008174 3300027695 Bacteria 1852
200 Ga0207428_10000095 3300027907 Bacteria 123199
201 Ga0207428_10001314 3300027907 Bacteria 26458
202 Ga0207428_10020675 3300027907 Bacteria 5586
203 Ga0268265_10035876 3300028380 Bacteria 3627
204 Ga0268265_10094174 3300028380 Bacteria 2402
205 Ga0268265_10187966 3300028380 Bacteria 1781
206 Ga0268264_10063310 3300028381 Bacteria 3108
207 Ga0268264_10151302 3300028381 Bacteria 2081
208 Ga0265332_10040860 3300031238 Bacteria 2007
209 Ga0395900_0000174 3300037418 Bacteria 103546
210 Ga0395900_0062289 3300037418 Bacteria 3834
211 Ga0395898_0002000 3300037466 Bacteria 25591
212 Ga0395898_0017632 3300037466 Bacteria 7289
213 Ga0395901_0000061 3300038443 Bacteria 151609
214 Ga0395901_0003811 3300038443 Bacteria 15194
215 Ga0439441_007455 3300042001 Bacteria 1763
216 Ga0439448_0004859 3300042005 Bacteria 3812
217 Ga0439460_0000662 3300042461 Bacteria 7592
218 Ga0451577_0047628 3300042876 Bacteria 3832
219 Ga0451577_0118568 3300042876 Bacteria 2370
220 Ga0453683_0015175 3300044673 Bacteria 4998
221 Ga0453683_0100000 3300044673 Bacteria 1820
222 Ga0466966_0001148 3300044684 Bacteria 17014
223 Ga0466961_0027888 3300044693 Unclassified 3631
224 Ga0466971_0003311 3300044719 Bacteria 6881
225 Ga0466957_0009315 3300044842 Bacteria 5603
226 Ga0451576_0001286 3300045051 Bacteria 43648
227 Ga0451576_0012493 3300045051 Bacteria 9535
228 Ga0451576_0016923 3300045051 Bacteria 8031
229 Ga0451576_0028394 3300045051 Bacteria 5994
230 Ga0451576_0127932 3300045051 Bacteria 2647
231 Ga0451576_0260823 3300045051 Bacteria 1811
232 Ga0451576_0263444 3300045051 Bacteria 1802
233 Ga0451576_0504438 3300045051 Unclassified 1271
234 Ga0466958_0143483 3300045836 Unclassified 1504
235 Ga0466967_0288165 3300045976 Bacteria 1577
236 Ga0495580_0000020 3300046472 Bacteria 91314
237 Ga0495642_0015397 3300046528 Bacteria 2973
238 Ga0495687_087890 3300047443 Bacteria 1198
239 Ga0496105_0145384 3300048908 Bacteria 1950
240 Ga0496116_0178013 3300048919 Bacteria 1142
241 Ga0496117_0015052 3300048920 Bacteria 6625
242 Ga0496118_0007459 3300048921 Bacteria 11581
243 Ga0496126_0001784 3300048929 Bacteria 31760
244 Ga0501036_0001816 3300049572 Bacteria 16542
245 Ga0501036_0043754 3300049572 Unclassified 3793
246 Ga0501036_0158918 3300049572 Bacteria 1906
247 Ga0501038_0008801 3300049574 Bacteria 9259
248 Ga0501038_0094171 3300049574 Bacteria 2504
249 Ga0501039_0086531 3300049575 Bacteria 2441
250 Ga0501039_0092503 3300049575 Bacteria 2357
251 Ga0501040_0002365 3300049576 Bacteria 12112
252 Ga0501040_0010113 3300049576 Bacteria 6166
253 Ga0501040_0017849 3300049576 Bacteria 4711
254 Ga0501040_0042763 3300049576 Bacteria 3087
255 Ga0501041_0006158 3300049577 Bacteria 7012
256 Ga0501041_0009524 3300049577 Bacteria 5726
257 Ga0501041_0052300 3300049577 Bacteria 2490
258 Ga0501041_0079439 3300049577 Bacteria 2019
259 Ga0501042_0009232 3300049578 Bacteria 6562
260 Ga0501042_0017409 3300049578 Bacteria 4956
261 Ga0501042_0048728 3300049578 Bacteria 3021
262 Ga0501042_0061424 3300049578 Bacteria 2685
263 Ga0501043_0113105 3300049579 Unclassified 2132
264 Ga0501043_0119959 3300049579 Bacteria 2062
265 Ga0501046_0003128 3300049580 Bacteria 15281
266 Ga0501046_0022343 3300049580 Bacteria 5211
267 Ga0501046_0110198 3300049580 Bacteria 2104
268 Ga0501048_0013635 3300049582 Bacteria 6032
269 Ga0501048_0014110 3300049582 Bacteria 5921
270 Ga0501048_0197603 3300049582 Bacteria 1425
271 Ga0501068_0033349 3300049584 Bacteria 3066
272 Ga0501068_0078206 3300049584 Bacteria 2027
273 Ga0501070_0284128 3300049586 Bacteria 1350
274 Ga0501071_0010522 3300049587 Bacteria 6204
275 Ga0501071_0021576 3300049587 Bacteria 4486
276 Ga0501072_0001514 3300049588 Bacteria 17397
277 Ga0501072_0063037 3300049588 Bacteria 2924
278 Ga0501072_0088843 3300049588 Bacteria 2452
279 Ga0501072_0108236 3300049588 Bacteria 2211
280 Ga0501075_0000129 3300049591 Bacteria 37236
281 Ga0501075_0016440 3300049591 Bacteria 5331
282 Ga0501075_0023835 3300049591 Bacteria 4482
283 Ga0501075_0084836 3300049591 Bacteria 2399
284 Ga0501075_0088115 3300049591 Bacteria 2353
285 Ga0501075_0131042 3300049591 Bacteria 1910
286 Ga0501076_0000046 3300049592 Bacteria 60108
287 Ga0501076_0006101 3300049592 Bacteria 8719
288 Ga0501076_0044090 3300049592 Bacteria 3517
289 Ga0501076_0067962 3300049592 Bacteria 2846
290 Ga0501076_0214249 3300049592 Bacteria 1574
291 Ga0501077_0003322 3300049593 Bacteria 9682
292 Ga0501077_0023894 3300049593 Bacteria 3878
293 Ga0501077_0027179 3300049593 Bacteria 3633
294 Ga0501077_0074337 3300049593 Bacteria 2153
295 Ga0501077_0074697 3300049593 Bacteria 2147
296 Ga0501077_0083257 3300049593 Bacteria 2027
297 Ga0501079_0001669 3300049741 Bacteria 15776
298 Ga0501079_0011419 3300049741 Bacteria 6778
299 Ga0501079_0018829 3300049741 Bacteria 5276
300 Ga0501079_0018933 3300049741 Bacteria 5261
301 Ga0501079_0030947 3300049741 Bacteria 4113
302 Ga0501080_0026333 3300049742 Bacteria 5404
303 Ga0501080_0176915 3300049742 Bacteria 1965
304 Ga0501080_0268634 3300049742 Bacteria 1553
305 Ga0501081_0002245 3300049743 Bacteria 12149
306 Ga0501081_0002487 3300049743 Bacteria 11615
307 Ga0501081_0012099 3300049743 Bacteria 5656
308 Ga0501081_0013234 3300049743 Bacteria 5426
309 Ga0501081_0015404 3300049743 Bacteria 5045
310 Ga0501081_0028381 3300049743 Bacteria 3777
311 Ga0501081_0081392 3300049743 Bacteria 2268
312 Ga0501083_0108527 3300049744 Bacteria 1826
313 Ga0501035_0035748 3300049822 Bacteria 4508
314 Ga0501035_0192544 3300049822 Bacteria 1753
315 Ga0501035_0270594 3300049822 Bacteria 1438
316 Ga0501045_0000941 3300049824 Bacteria 19037
317 Ga0501045_0008278 3300049824 Bacteria 7241
318 Ga0501045_0009376 3300049824 Bacteria 6844
319 nmdc:mga05p37_1076_c1 3300050507 Bacteria 31293
320 nmdc:mga05p37_11660_c1 3300050507 Bacteria 10476
321 nmdc:mga05p37_12344_c1 3300050507 Bacteria 10203
322 nmdc:mga05p37_306363_c1 3300050507 Unclassified 1885
323 nmdc:mga05p37_584320_c1 3300050507 Unclassified 1264
324 nmdc:mga05p37_69346_c1 3300050507 Bacteria 4337
325 nmdc:mga09592_30978_c1 3300050508 Bacteria 4455
326 nmdc:mga0qj67_116985_c1 3300050509 Bacteria 2155
327 nmdc:mga06r32_20812_c1 3300050510 Bacteria 6045
328 nmdc:mga06r32_208_c1 3300050510 Bacteria 47351
329 nmdc:mga06r32_211387_c1 3300050510 Bacteria 1928
330 nmdc:mga08y16_165841_c1 3300050511 Bacteria 2295
331 nmdc:mga08y16_731_c1 3300050511 Bacteria 31175
332 nmdc:mga08y16_74947_c1 3300050511 Bacteria 3527
333 nmdc:mga08y16_7813_c1 3300050511 Bacteria 11205
334 nmdc:mga0n895_421722_c1 3300050512 Bacteria 1349
335 nmdc:mga0n895_445363_c1 3300050512 Bacteria 1308
336 nmdc:mga0n895_48098_c1 3300050512 Bacteria 4173
337 nmdc:mga0n895_5058_c1 3300050512 Bacteria 10949
338 nmdc:mga0rr50_10338_c1 3300050513 Unclassified 1662
339 nmdc:mga0rr50_107246_c1 3300050513 Bacteria 2205
340 nmdc:mga0rr50_128888_c1 3300050513 Bacteria 2023
341 nmdc:mga0rr50_21332_c1 3300050513 Bacteria 4420
342 nmdc:mga0rr50_32542_c1 3300050513 Bacteria 3716
343 nmdc:mga0rr50_35498_c1 3300050513 Bacteria 3581
344 nmdc:mga0rr50_5359_c1 3300050513 Bacteria 7643
345 nmdc:mga0rr50_60373_c1 3300050513 Bacteria 2852
346 nmdc:mga08x19_133851_c1 3300050514 Bacteria 1670
347 nmdc:mga08x19_2367_c1 3300050514 Bacteria 11427
348 nmdc:mga08x19_53357_c1 3300050514 Bacteria 2601
349 nmdc:mga0a205_108866_c1 3300050515 Bacteria 2669
350 nmdc:mga0a205_1282_c1 3300050515 Bacteria 21168
351 nmdc:mga0a205_129934_c1 3300050515 Bacteria 2419
352 nmdc:mga0a205_13787_c1 3300050515 Bacteria 7536
353 nmdc:mga0a205_149243_c1 3300050515 Bacteria 2238
354 nmdc:mga0a205_15597_c1 3300050515 Bacteria 7101
355 nmdc:mga0a205_17129_c1 3300050515 Bacteria 6786
356 nmdc:mga0a205_1784_c1 3300050515 Bacteria 18598
357 nmdc:mga0a205_190331_c1 3300050515 Bacteria 1944
358 nmdc:mga0a205_33932_c1 3300050515 Bacteria 4894
359 nmdc:mga0a205_4320_c1 3300050515 Bacteria 12739
360 nmdc:mga0a205_59807_c1 3300050515 Unclassified 3680
361 nmdc:mga0a205_67605_c1 3300050515 Unclassified 3452
362 nmdc:mga0a205_959_c1 3300050515 Bacteria 23835
363 Ga0501084_0000764 3300054114 Bacteria 24541
364 Ga0501084_0003152 3300054114 Bacteria 13336
365 Ga0501084_0058494 3300054114 Bacteria 3225
366 Ga0501084_0090546 3300054114 Bacteria 2568
367 Ga0501084_0123110 3300054114 Bacteria 2181
368 Ga0501084_0134561 3300054114 Unclassified 2081
369 Ga0501084_0283211 3300054114 Bacteria 1400
370 Ga0501082_0006843 3300060353 Bacteria 9857
371 Ga0501082_0007688 3300060353 Bacteria 9304
372 Ga0501082_0038893 3300060353 Bacteria 4103
373 Ga0501082_0042200 3300060353 Bacteria 3933
374 Ga0501082_0115836 3300060353 Bacteria 2321
375 Ga0466962_0010871 3300061719 Unclassified 4376
376 Ga0530510_0000028 3300061734 Bacteria 64698
377 Ga0530510_0000625 3300061734 Bacteria 22816
378 Ga0530510_0017931 3300061734 Bacteria 5019
379 Ga0530510_0021782 3300061734 Bacteria 4561
380 Ga0530510_0057834 3300061734 Bacteria 2803
381 Ga0530510_0068733 3300061734 Bacteria 2570
382 Ga0530510_0218737 3300061734 Unclassified 1416
383 2512348262 2512047030 Bacteria 9031815
384 2621299490 2619619299 Bacteria 6649820
385 2738669506 2738541265 Bacteria 6594665
386 2738747899 2738541282 Bacteria 6593925
387 2738856941 2738541303 Bacteria 6591772
388 2817490852 2816332298 Bacteria 6852809
389 2945939602 2945934425 Bacteria 7444609
390 642619846 642555113 Bacteria 8214658
391 Ga0070704_100084387
392 JGI24735J21928_10002743
393 Ga0070676_10042300
394 Ga0070670_100001289
395 Ga0068869_100003857
396 Ga0068869_100010169
397 Ga0070680_100001395
398 Ga0070682_100087485
399 Ga0070660_100019575
400 Ga0070691_10024303
401 Ga0070661_100009543
402 Ga0070692_10001432
403 Ga0070692_10023317
404 Ga0070669_100172441
405 Ga0070673_100137040
406 Ga0070659_100012916
407 Ga0070701_10013056
408 Ga0070700_100095147
409 Ga0070694_100001362
410 Ga0070694_100004339
411 Ga0070694_100059539
412 Ga0070708_100015649
413 Ga0070708_100032687
414 Ga0070708_100039162
415 Ga0070708_100044174
416 Ga0070708_100052767
417 Ga0070708_100138065
418 Ga0070708_100224798
419 Ga0070662_100018535
420 Ga0070681_10021175
421 Ga0068867_100011008
422 Ga0068867_100038428
423 Ga0068867_100057031
424 Ga0070706_100007654
425 Ga0070706_100008822
426 Ga0070706_100010349
427 Ga0070706_100014021
428 Ga0070706_100020684
429 Ga0070706_100133243
430 Ga0070707_100001745
431 Ga0070707_100015991
432 Ga0070707_100017102
433 Ga0070707_100017919
434 Ga0070707_100029103
435 Ga0070707_100048484
436 Ga0070707_100054071
437 Ga0070698_100002999
438 Ga0070698_100017595
439 Ga0070698_100019521
440 Ga0070699_100007084
441 Ga0070699_100072852
442 Ga0070679_100020201
443 Ga0070697_100001193
444 Ga0070697_100006619
445 Ga0070697_100009658
446 Ga0070697_100040057
447 Ga0070697_100050597
448 Ga0070697_100115518
449 Ga0068853_100010688
450 Ga0070672_100193482
451 Ga0070695_100000048
452 Ga0070695_100004087
453 Ga0070695_100004673
454 Ga0070695_100015601
455 Ga0070695_100015719
456 Ga0070695_100147528
457 Ga0070696_100010584
458 Ga0070696_100014718
459 Ga0070696_100025626
460 Ga0070693_100000159
461 Ga0070693_100099005
462 Ga0070704_100000116
463 Ga0068855_100001156
464 Ga0068857_100329834
465 Ga0068856_100185630
466 Ga0068856_100209939
467 Ga0068859_100150349
468 Ga0068861_100025732
469 Ga0068870_10002227
470 Ga0068870_10064977
471 Ga0068863_100190524
472 Ga0068860_100089714
473 Ga0068860_100155299
474 Ga0068860_100208681
475 Ga0068862_100025202
476 Ga0081455_10006197
477 Ga0081538_10002059
478 Ga0070716_100029742
479 Ga0070712_100116894
480 Ga0075428_100011091
481 Ga0075428_100211168
482 Ga0075430_100011109
483 Ga0075431_100000162
484 Ga0075431_100002607
485 Ga0075431_100083219
486 Ga0075431_100093946
487 Ga0075431_100177083
488 Ga0075433_10000094
489 Ga0075433_10001383
490 Ga0075433_10001866
491 Ga0075433_10027657
492 Ga0075433_10051245
493 Ga0075433_10117949
494 Ga0075433_10207208
495 Ga0075434_100000207
496 Ga0075434_100003606
497 Ga0075434_100009129
498 Ga0075434_100025372
499 Ga0075434_100079005
500 Ga0075434_100197980
501 Ga0075434_100203295
502 Ga0075429_100001320
503 Ga0075429_100021136
504 Ga0075429_100072183
505 Ga0075436_100002822
506 Ga0097620_100150351
507 Ga0075435_100011360
508 Ga0075435_100020589
509 Ga0075435_100034436
510 Ga0075435_100056770
511 Ga0075435_100072163
512 Ga0075435_100074898
513 Ga0099794_10055362
514 Ga0099794_10126749
515 Ga0105240_10172319
516 Ga0111539_10002279
517 Ga0111539_10004936
518 Ga0111539_10007623
519 Ga0114129_10000487
520 Ga0114129_10011558
521 Ga0114129_10083981
522 Ga0114129_10093295
523 Ga0114129_10244548
524 Ga0114129_10337357
525 Ga0105243_10005003
526 Ga0105241_10004152
527 Ga0105242_10131211
528 Ga0105248_10360023
529 Ga0105249_10099029
530 Ga0157373_10001579
531 Ga0157371_10066763
532 Ga0157370_10061928
533 Ga0157369_10000061
534 Ga0157369_10000366
535 Ga0157378_10260400
536 Ga0163162_10264597
537 Ga0157372_10009351
538 Ga0157372_10529704
539 Ga0206354_10039077
540 Ga0206354_11132685
541 Ga0224712_10000069
542 Ga0207699_10104500
543 Ga0207645_10000497
544 Ga0207643_10000696
545 Ga0207684_10001190
546 Ga0207684_10013794
547 Ga0207684_10017321
548 Ga0207684_10024086
549 Ga0207684_10029832
550 Ga0207684_10066570
551 Ga0207684_10188528
552 Ga0207707_10001074
553 Ga0207707_10058102
554 Ga0207695_10179070
555 Ga0207693_10127366
556 Ga0207663_10085707
557 Ga0207660_10022665
558 Ga0207657_10000681
559 Ga0207649_10009631
560 Ga0207646_10001440
561 Ga0207646_10006141
562 Ga0207646_10013235
563 Ga0207646_10020155
564 Ga0207646_10102661
565 Ga0207646_10121820
566 Ga0207646_10221323
567 Ga0207650_10026499
568 Ga0207690_10046641
569 Ga0207706_10018406
570 Ga0207704_10229672
571 Ga0207665_10045313
572 Ga0207689_10000721
573 Ga0207689_10008484
574 Ga0207679_10016483
575 Ga0207667_10016784
576 Ga0207640_10052946
577 Ga0207639_10017336
578 Ga0207678_10013487
579 Ga0207708_10075491
580 Ga0207702_10004238
581 Ga0207702_10115402
582 Ga0207641_10116399
583 Ga0207674_10000181
584 Ga0207674_10075076
585 Ga0207675_100028813
586 Ga0207675_100124526
587 Ga0207698_10309739
588 Ga0209971_1000068
589 Ga0209966_1008174
590 Ga0207428_10000095
591 Ga0207428_10001314
592 Ga0207428_10020675
593 Ga0268265_10035876
594 Ga0268265_10094174
595 Ga0268265_10187966
596 Ga0268264_10063310
597 Ga0268264_10151302
598 Ga0265332_10040860
599 Ga0395900_0000174
600 Ga0395900_0062289
601 Ga0395898_0002000
602 Ga0395898_0017632
603 Ga0395901_0000061
604 Ga0395901_0003811
605 Ga0439441_007455
606 Ga0439448_0004859
607 Ga0439460_0000662
608 Ga0451577_0047628
609 Ga0451577_0118568
610 Ga0453683_0015175
611 Ga0453683_0100000
612 Ga0466966_0001148
613 Ga0466961_0027888
614 Ga0466971_0003311
615 Ga0466957_0009315
616 Ga0451576_0001286
617 Ga0451576_0012493
618 Ga0451576_0016923
619 Ga0451576_0028394
620 Ga0451576_0127932
621 Ga0451576_0260823
622 Ga0451576_0263444
623 Ga0451576_0504438
624 Ga0466958_0143483
625 Ga0466967_0288165
626 Ga0495580_0000020
627 Ga0495642_0015397
628 Ga0495687_087890
629 Ga0496105_0145384
630 Ga0496116_0178013
631 Ga0496117_0015052
632 Ga0496118_0007459
633 Ga0496126_0001784
634 Ga0501036_0001816
635 Ga0501036_0043754
636 Ga0501036_0158918
637 Ga0501038_0008801
638 Ga0501038_0094171
639 Ga0501039_0086531
640 Ga0501039_0092503
641 Ga0501040_0002365
642 Ga0501040_0010113
643 Ga0501040_0017849
644 Ga0501040_0042763
645 Ga0501041_0006158
646 Ga0501041_0009524
647 Ga0501041_0052300
648 Ga0501041_0079439
649 Ga0501042_0009232
650 Ga0501042_0017409
651 Ga0501042_0048728
652 Ga0501042_0061424
653 Ga0501043_0113105
654 Ga0501043_0119959
655 Ga0501046_0003128
656 Ga0501046_0022343
657 Ga0501046_0110198
658 Ga0501048_0013635
659 Ga0501048_0014110
660 Ga0501048_0197603
661 Ga0501068_0033349
662 Ga0501068_0078206
663 Ga0501070_0284128
664 Ga0501071_0010522
665 Ga0501071_0021576
666 Ga0501072_0001514
667 Ga0501072_0063037
668 Ga0501072_0088843
669 Ga0501072_0108236
670 Ga0501075_0000129
671 Ga0501075_0016440
672 Ga0501075_0023835
673 Ga0501075_0084836
674 Ga0501075_0088115
675 Ga0501075_0131042
676 Ga0501076_0000046
677 Ga0501076_0006101
678 Ga0501076_0044090
679 Ga0501076_0067962
680 Ga0501076_0214249
681 Ga0501077_0003322
682 Ga0501077_0023894
683 Ga0501077_0027179
684 Ga0501077_0074337
685 Ga0501077_0074697
686 Ga0501077_0083257
687 Ga0501079_0001669
688 Ga0501079_0011419
689 Ga0501079_0018829
690 Ga0501079_0018933
691 Ga0501079_0030947
692 Ga0501080_0026333
693 Ga0501080_0176915
694 Ga0501080_0268634
695 Ga0501081_0002245
696 Ga0501081_0002487
697 Ga0501081_0012099
698 Ga0501081_0013234
699 Ga0501081_0015404
700 Ga0501081_0028381
701 Ga0501081_0081392
702 Ga0501083_0108527
703 Ga0501035_0035748
704 Ga0501035_0192544
705 Ga0501035_0270594
706 Ga0501045_0000941
707 Ga0501045_0008278
708 Ga0501045_0009376
709 nmdc:mga05p37_1076_c1
710 nmdc:mga05p37_11660_c1
711 nmdc:mga05p37_12344_c1
712 nmdc:mga05p37_306363_c1
713 nmdc:mga05p37_584320_c1
714 nmdc:mga05p37_69346_c1
715 nmdc:mga09592_30978_c1
716 nmdc:mga0qj67_116985_c1
717 nmdc:mga06r32_20812_c1
718 nmdc:mga06r32_208_c1
719 nmdc:mga06r32_211387_c1
720 nmdc:mga08y16_165841_c1
721 nmdc:mga08y16_731_c1
722 nmdc:mga08y16_74947_c1
723 nmdc:mga08y16_7813_c1
724 nmdc:mga0n895_421722_c1
725 nmdc:mga0n895_445363_c1
726 nmdc:mga0n895_48098_c1
727 nmdc:mga0n895_5058_c1
728 nmdc:mga0rr50_10338_c1
729 nmdc:mga0rr50_107246_c1
730 nmdc:mga0rr50_128888_c1
731 nmdc:mga0rr50_21332_c1
732 nmdc:mga0rr50_32542_c1
733 nmdc:mga0rr50_35498_c1
734 nmdc:mga0rr50_5359_c1
735 nmdc:mga0rr50_60373_c1
736 nmdc:mga08x19_133851_c1
737 nmdc:mga08x19_2367_c1
738 nmdc:mga08x19_53357_c1
739 nmdc:mga0a205_108866_c1
740 nmdc:mga0a205_1282_c1
741 nmdc:mga0a205_129934_c1
742 nmdc:mga0a205_13787_c1
743 nmdc:mga0a205_149243_c1
744 nmdc:mga0a205_15597_c1
745 nmdc:mga0a205_17129_c1
746 nmdc:mga0a205_1784_c1
747 nmdc:mga0a205_190331_c1
748 nmdc:mga0a205_33932_c1
749 nmdc:mga0a205_4320_c1
750 nmdc:mga0a205_59807_c1
751 nmdc:mga0a205_67605_c1
752 nmdc:mga0a205_959_c1
753 Ga0501084_0000764
754 Ga0501084_0003152
755 Ga0501084_0058494
756 Ga0501084_0090546
757 Ga0501084_0123110
758 Ga0501084_0134561
759 Ga0501084_0283211
760 Ga0501082_0006843
761 Ga0501082_0007688
762 Ga0501082_0038893
763 Ga0501082_0042200
764 Ga0501082_0115836
765 Ga0466962_0010871
766 Ga0530510_0000028
767 Ga0530510_0000625
768 Ga0530510_0017931
769 Ga0530510_0021782
770 Ga0530510_0057834
771 Ga0530510_0068733
772 Ga0530510_0218737
773 2512348262
774 2621299490
775 2738669506
776 2738747899
777 2738856941
778 2817490852
779 2945939602
780 642619846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

5

356

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a3x-assembly1.cif.gz_B imine reductase from ensifer adhaerens in complex with nadp+ 0.962 6 35
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9543 6 36
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.9512 5 35
8a5z-assembly1.cif.gz_A imine reductase from ensifer adhaerens a208n mutant in complex with nadp+ 0.943 5 35
7cb2-assembly1.cif.gz_A the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus 0.9385 4 35
ID Description Score Start End Superfamily
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.999 7 36 3.50.50.60
af_Q4CWB6_396_583_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9879 7 36 3.40.50.720
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9855 7 36 3.40.50.720
3ojoB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9807 7 36 3.40.50.720
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9765 7 36 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A494X3I2-F1-model_v4 FAD-binding oxidoreductase 0.9781 1 374 GO:0005737
AF-A0A2V6S5R9-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.97 1 351 GO:0005737
AF-A0A1M2Z6Y4-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9619 1 376 GO:0005737
AF-A0A2V6S5R9-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9619 1 351 GO:0005737
AF-A0A399ZAZ0-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9618 33 218 GO:0005737

Map