F431664

General Info

Members Datasets Scaffolds Average Seq Length
390 121 780 93

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100032729|Ga0070708_1000327292
Length 104
Sequence VAAGEGGSRLGVTNVALEAAQKDYEVLRPRFPTFCGCDTCRGDVLVYALNRLSPHYVSTRAGEILTGLTMGTDQETAKVTVILMEGFRRVALAPRCGAKPVTLP

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
74 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
77 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
78 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
85 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.77
Rhizosphere 98.97
Stem 0
Stem Tuber 0
Unclassified 20.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100032729 3300005445 Bacteria 4512
2 Ga0070680_100011266 3300005336 Bacteria 6915
3 Ga0070680_100015869 3300005336 Bacteria 5913
4 Ga0070680_100418400 3300005336 Unclassified 1143
5 Ga0070680_100750916 3300005336 Unclassified 840
6 Ga0070691_10190460 3300005341 Bacteria 1073
7 Ga0070691_10945801 3300005341 Unclassified 534
8 Ga0070687_100461741 3300005343 Unclassified 847
9 Ga0070703_10000872 3300005406 Bacteria 9725
10 Ga0070703_10243455 3300005406 Unclassified 726
11 Ga0070709_10007199 3300005434 Bacteria 6096
12 Ga0070709_10011419 3300005434 Bacteria 4950
13 Ga0070714_100652748 3300005435 Bacteria 1013
14 Ga0070713_100629474 3300005436 Unclassified 1021
15 Ga0070710_11373149 3300005437 Unclassified 527
16 Ga0070701_10047140 3300005438 Bacteria 2218
17 Ga0070711_100000212 3300005439 Bacteria 30680
18 Ga0070711_101107795 3300005439 Bacteria 682
19 Ga0070705_100098164 3300005440 Bacteria 1843
20 Ga0070705_100120988 3300005440 Bacteria 1690
21 Ga0070705_100136786 3300005440 Bacteria 1606
22 Ga0070705_100215870 3300005440 Bacteria 1325
23 Ga0070700_100318157 3300005441 Bacteria 1142
24 Ga0070700_100386080 3300005441 Bacteria 1049
25 Ga0070694_100003358 3300005444 Bacteria 9585
26 Ga0070694_100003672 3300005444 Bacteria 9152
27 Ga0070694_100013220 3300005444 Bacteria 5152
28 Ga0070694_100016781 3300005444 Bacteria 4614
29 Ga0070694_100019981 3300005444 Bacteria 4266
30 Ga0070694_100022441 3300005444 Bacteria 4043
31 Ga0070694_100144255 3300005444 Bacteria 1732
32 Ga0070694_100264538 3300005444 Unclassified 1306
33 Ga0070694_101034963 3300005444 Bacteria 683
34 Ga0070708_100010208 3300005445 Bacteria 7602
35 Ga0070708_100199369 3300005445 Bacteria 1873
36 Ga0070708_100295024 3300005445 Bacteria 1526
37 Ga0070708_101143425 3300005445 Unclassified 729
38 Ga0070681_11402769 3300005458 Unclassified 622
39 Ga0068867_100208791 3300005459 Bacteria 1567
40 Ga0070706_100052519 3300005467 Bacteria 3762
41 Ga0070706_100057395 3300005467 Bacteria 3593
42 Ga0070706_100095225 3300005467 Bacteria 2763
43 Ga0070706_100125395 3300005467 Bacteria 2394
44 Ga0070706_100245445 3300005467 Bacteria 1672
45 Ga0070706_100555584 3300005467 Bacteria 1068
46 Ga0070706_101331164 3300005467 Unclassified 658
47 Ga0070706_101605963 3300005467 Unclassified 593
48 Ga0070706_101656082 3300005467 Bacteria 583
49 Ga0070707_100020014 3300005468 Bacteria 6310
50 Ga0070707_100054859 3300005468 Bacteria 3821
51 Ga0070707_100150263 3300005468 Bacteria 2268
52 Ga0070707_100347630 3300005468 Bacteria 1440
53 Ga0070707_100399974 3300005468 Bacteria 1333
54 Ga0070707_100546599 3300005468 Unclassified 1120
55 Ga0070707_100698014 3300005468 Unclassified 978
56 Ga0070707_100761902 3300005468 Bacteria 931
57 Ga0070707_101860269 3300005468 Unclassified 569
58 Ga0070707_102248276 3300005468 Unclassified 513
59 Ga0070698_100040506 3300005471 Bacteria 4787
60 Ga0070698_100049244 3300005471 Bacteria 4302
61 Ga0070698_100054552 3300005471 Bacteria 4057
62 Ga0070699_100000702 3300005518 Bacteria 31001
63 Ga0070699_100008485 3300005518 Bacteria 8902
64 Ga0070699_100026761 3300005518 Bacteria 4975
65 Ga0070699_100032047 3300005518 Bacteria 4539
66 Ga0070699_100038138 3300005518 Bacteria 4161
67 Ga0070699_100053150 3300005518 Bacteria 3506
68 Ga0070699_100116738 3300005518 Bacteria 2346
69 Ga0070699_100154485 3300005518 Bacteria 2030
70 Ga0070699_100280360 3300005518 Bacteria 1493
71 Ga0070699_100707964 3300005518 Bacteria 920
72 Ga0070699_101205110 3300005518 Unclassified 694
73 Ga0070697_100006385 3300005536 Bacteria 9128
74 Ga0070697_100039068 3300005536 Bacteria 3836
75 Ga0070697_100066458 3300005536 Bacteria 2948
76 Ga0070697_100170618 3300005536 Bacteria 1841
77 Ga0070697_100264619 3300005536 Bacteria 1473
78 Ga0070697_100417691 3300005536 Bacteria 1165
79 Ga0070697_100534066 3300005536 Bacteria 1028
80 Ga0070697_100534077 3300005536 Bacteria 1028
81 Ga0070697_100737726 3300005536 Bacteria 870
82 Ga0070697_100814225 3300005536 Bacteria 827
83 Ga0070697_100846922 3300005536 Bacteria 810
84 Ga0070697_101210633 3300005536 Bacteria 673
85 Ga0070697_101475380 3300005536 Unclassified 608
86 Ga0070695_100002580 3300005545 Bacteria 10459
87 Ga0070695_100034327 3300005545 Bacteria 3179
88 Ga0070695_100065368 3300005545 Bacteria 2368
89 Ga0070695_100090798 3300005545 Bacteria 2039
90 Ga0070695_100423180 3300005545 Bacteria 1014
91 Ga0070695_101057221 3300005545 Bacteria 662
92 Ga0070695_101637344 3300005545 Unclassified 538
93 Ga0070695_101858039 3300005545 Unclassified 506
94 Ga0070696_100013106 3300005546 Bacteria 5561
95 Ga0070696_100020971 3300005546 Bacteria 4429
96 Ga0070696_100287312 3300005546 Bacteria 1255
97 Ga0070696_100620715 3300005546 Bacteria 873
98 Ga0070693_101261762 3300005547 Bacteria 570
99 Ga0070704_100004619 3300005549 Bacteria 7966
100 Ga0070704_100007953 3300005549 Bacteria 6329
101 Ga0070704_100012656 3300005549 Bacteria 5219
102 Ga0070704_100019915 3300005549 Bacteria 4318
103 Ga0070704_100029883 3300005549 Bacteria 3644
104 Ga0070704_100172267 3300005549 Bacteria 1723
105 Ga0070704_100298900 3300005549 Bacteria 1340
106 Ga0070704_100474394 3300005549 Bacteria 1081
107 Ga0070704_101015678 3300005549 Unclassified 751
108 Ga0070704_101365130 3300005549 Unclassified 649
109 Ga0070702_100073375 3300005615 Bacteria 2027
110 Ga0068861_101615190 3300005719 Unclassified 639
111 Ga0068860_100629678 3300005843 Unclassified 1080
112 Ga0068860_101420985 3300005843 Bacteria 715
113 Ga0070715_10153381 3300006163 Bacteria 1131
114 Ga0070716_100338802 3300006173 Bacteria 1060
115 Ga0075428_100370873 3300006844 Unclassified 1535
116 Ga0075428_100412617 3300006844 Bacteria 1447
117 Ga0075428_101237905 3300006844 Unclassified 786
118 Ga0075428_102739158 3300006844 Unclassified 502
119 Ga0075430_100036900 3300006846 Bacteria 4142
120 Ga0075431_100035955 3300006847 Bacteria 5101
121 Ga0075431_100202553 3300006847 Bacteria 2030
122 Ga0075431_100246558 3300006847 Bacteria 1816
123 Ga0075431_100625105 3300006847 Bacteria 1059
124 Ga0075431_101236608 3300006847 Unclassified 709
125 Ga0075433_10011546 3300006852 Bacteria 7114
126 Ga0075433_10013817 3300006852 Bacteria 6581
127 Ga0075433_10169530 3300006852 Bacteria 1943
128 Ga0075433_10213762 3300006852 Bacteria 1713
129 Ga0075433_10322575 3300006852 Bacteria 1366
130 Ga0075433_10861199 3300006852 Unclassified 791
131 Ga0075433_11281504 3300006852 Unclassified 635
132 Ga0075433_11775539 3300006852 Unclassified 530
133 Ga0075434_100004541 3300006871 Bacteria 12533
134 Ga0075434_100009337 3300006871 Bacteria 9142
135 Ga0075434_100051231 3300006871 Bacteria 4102
136 Ga0075434_100064419 3300006871 Bacteria 3649
137 Ga0075434_100103644 3300006871 Bacteria 2853
138 Ga0075434_100133059 3300006871 Unclassified 2506
139 Ga0075434_100142682 3300006871 Bacteria 2415
140 Ga0075434_100153064 3300006871 Bacteria 2326
141 Ga0075434_100178796 3300006871 Bacteria 2141
142 Ga0075434_100237610 3300006871 Bacteria 1842
143 Ga0075434_100493933 3300006871 Bacteria 1245
144 Ga0075434_101206889 3300006871 Unclassified 768
145 Ga0075434_102146196 3300006871 Unclassified 563
146 Ga0075429_100004470 3300006880 Bacteria 12031
147 Ga0075429_100502222 3300006880 Unclassified 1063
148 Ga0075436_100021130 3300006914 Bacteria 4466
149 Ga0075436_100023073 3300006914 Bacteria 4273
150 Ga0075436_100039500 3300006914 Bacteria 3257
151 Ga0075436_100044900 3300006914 Bacteria 3048
152 Ga0075436_100080607 3300006914 Bacteria 2255
153 Ga0075436_100093494 3300006914 Bacteria 2091
154 Ga0075436_100259811 3300006914 Bacteria 1238
155 Ga0075436_100514824 3300006914 Unclassified 876
156 Ga0075436_100699805 3300006914 Bacteria 751
157 Ga0075436_101263945 3300006914 Unclassified 558
158 Ga0075435_100014636 3300007076 Bacteria 5874
159 Ga0075435_100026495 3300007076 Bacteria 4524
160 Ga0075435_100060963 3300007076 Unclassified 3059
161 Ga0075435_100273307 3300007076 Unclassified 1442
162 Ga0075435_100417543 3300007076 Bacteria 1155
163 Ga0075435_100455450 3300007076 Bacteria 1103
164 Ga0075435_101358673 3300007076 Bacteria 622
165 Ga0075435_101803774 3300007076 Bacteria 537
166 Ga0099794_10000059 3300007265 Bacteria 42270
167 Ga0099794_10011762 3300007265 Bacteria 3757
168 Ga0099794_10030519 3300007265 Bacteria 2518
169 Ga0099794_10080445 3300007265 Bacteria 1607
170 Ga0099794_10145842 3300007265 Bacteria 1200
171 Ga0099795_10087113 3300007788 Bacteria 1205
172 Ga0105250_10575680 3300009092 Unclassified 519
173 Ga0111539_10284190 3300009094 Bacteria 1925
174 Ga0111539_13067523 3300009094 Unclassified 539
175 Ga0114129_10116651 3300009147 Bacteria 3679
176 Ga0114129_10188290 3300009147 Bacteria 2804
177 Ga0114129_10287143 3300009147 Bacteria 2197
178 Ga0114129_11098452 3300009147 Unclassified 996
179 Ga0114129_11500611 3300009147 Unclassified 828
180 Ga0114129_11726336 3300009147 Unclassified 763
181 Ga0114129_11802404 3300009147 Unclassified 744
182 Ga0114129_12393020 3300009147 Bacteria 633
183 Ga0207653_10000067 3300025885 Bacteria 79276
184 Ga0207653_10001214 3300025885 Bacteria 8423
185 Ga0207653_10012949 3300025885 Bacteria 2608
186 Ga0207653_10087987 3300025885 Bacteria 1084
187 Ga0207653_10226096 3300025885 Unclassified 712
188 Ga0207685_10787532 3300025905 Bacteria 523
189 Ga0207699_10010925 3300025906 Bacteria 4573
190 Ga0207699_10052340 3300025906 Bacteria 2416
191 Ga0207684_10006378 3300025910 Bacteria 10753
192 Ga0207684_10048406 3300025910 Bacteria 3605
193 Ga0207684_10063318 3300025910 Bacteria 3140
194 Ga0207684_10266224 3300025910 Bacteria 1479
195 Ga0207684_10439012 3300025910 Bacteria 1121
196 Ga0207684_10612744 3300025910 Unclassified 929
197 Ga0207684_11090129 3300025910 Unclassified 665
198 Ga0207684_11159971 3300025910 Unclassified 641
199 Ga0207684_11648518 3300025910 Unclassified 518
200 Ga0207707_10030313 3300025912 Bacteria 4732
201 Ga0207707_11627399 3300025912 Unclassified 508
202 Ga0207663_10000153 3300025916 Bacteria 31913
203 Ga0207663_10033674 3300025916 Bacteria 3055
204 Ga0207660_10013082 3300025917 Bacteria 5433
205 Ga0207660_10024325 3300025917 Bacteria 4100
206 Ga0207660_10036520 3300025917 Bacteria 3416
207 Ga0207660_10837149 3300025917 Unclassified 751
208 Ga0207662_10268746 3300025918 Bacteria 1125
209 Ga0207652_10004666 3300025921 Bacteria 11112
210 Ga0207646_10003133 3300025922 Bacteria 18961
211 Ga0207646_10003920 3300025922 Bacteria 16523
212 Ga0207646_10043990 3300025922 Bacteria 4009
213 Ga0207646_10045695 3300025922 Bacteria 3931
214 Ga0207646_10069259 3300025922 Bacteria 3151
215 Ga0207646_10116992 3300025922 Bacteria 2394
216 Ga0207646_10160912 3300025922 Unclassified 2026
217 Ga0207646_10487283 3300025922 Bacteria 1111
218 Ga0207646_10625817 3300025922 Bacteria 965
219 Ga0207646_10846611 3300025922 Bacteria 813
220 Ga0207646_10913889 3300025922 Bacteria 778
221 Ga0207646_11420902 3300025922 Unclassified 603
222 Ga0207646_11511511 3300025922 Bacteria 581
223 Ga0207664_10541275 3300025929 Bacteria 1044
224 Ga0207704_11634577 3300025938 Unclassified 553
225 Ga0207665_10428033 3300025939 Bacteria 1012
226 Ga0207708_10013839 3300026075 Bacteria 6029
227 Ga0207648_10125311 3300026089 Bacteria 2259
228 Ga0209588_1004174 3300027671 Bacteria 4055
229 Ga0209588_1011431 3300027671 Bacteria 2682
230 Ga0209588_1026090 3300027671 Bacteria 1853
231 Ga0268264_10455211 3300028381 Bacteria 1241
232 Ga0316182_1389529 3300030745 Bacteria 1486
233 Ga0307405_10071412 3300031731 Bacteria 2233
234 Ga0307413_10017464 3300031824 Bacteria 3737
235 Ga0307413_10198592 3300031824 Bacteria 1446
236 Ga0307410_10011227 3300031852 Bacteria 5112
237 Ga0307410_10059950 3300031852 Bacteria 2599
238 Ga0307406_10745928 3300031901 Bacteria 821
239 Ga0307407_10250337 3300031903 Bacteria 1213
240 Ga0307407_10476171 3300031903 Bacteria 911
241 Ga0307412_10091989 3300031911 Bacteria 2124
242 Ga0307409_101766550 3300031995 Bacteria 647
243 Ga0307416_101767308 3300032002 Bacteria 722
244 Ga0307411_10065738 3300032005 Bacteria 2433
245 Ga0373927_0498969 3300035695 Bacteria 804
246 Ga0373937_1408760 3300036401 Unclassified 645
247 Ga0451800_0854032 3300041459 Bacteria 845
248 Ga0451804_0060687 3300041463 Bacteria 933
249 Ga0451807_1551778 3300041486 Bacteria 2297
250 Ga0451849_1115830 3300041505 Bacteria 1355
251 Ga0439462_0071819 3300042015 Bacteria 940
252 Ga0450898_008839 3300042134 Bacteria 1600
253 Ga0450898_027257 3300042134 Bacteria 1033
254 Ga0451577_0164505 3300042876 Bacteria 1999
255 Ga0451577_1460773 3300042876 Bacteria 605
256 Ga0453683_0033027 3300044673 Bacteria 3264
257 Ga0453683_0060670 3300044673 Unclassified 2365
258 Ga0453683_0117796 3300044673 Bacteria 1671
259 Ga0453683_0831493 3300044673 Bacteria 609
260 Ga0451576_0003753 3300045051 Bacteria 20506
261 Ga0451576_0004763 3300045051 Bacteria 17412
262 Ga0451576_0009533 3300045051 Bacteria 11249
263 Ga0451576_0021647 3300045051 Bacteria 6985
264 Ga0451576_0055872 3300045051 Bacteria 4129
265 Ga0451576_0299194 3300045051 Bacteria 1682
266 Ga0451576_0312708 3300045051 Bacteria 1643
267 Ga0451576_0645870 3300045051 Bacteria 1112
268 Ga0451576_0741767 3300045051 Bacteria 1031
269 Ga0451576_0836058 3300045051 Unclassified 966
270 Ga0451576_1925823 3300045051 Unclassified 610
271 Ga0451576_2749857 3300045051 Bacteria 500
272 Ga0495639_0374369 3300046475 Unclassified 717
273 Ga0495630_1420404 3300046517 Unclassified 522
274 Ga0495663_0030541 3300046525 Bacteria 1597
275 Ga0495642_0045691 3300046528 Bacteria 1790
276 Ga0495586_0343306 3300046535 Bacteria 857
277 Ga0495609_0077827 3300046538 Bacteria 1452
278 Ga0495657_0182092 3300046675 Bacteria 1289
279 Ga0495658_0546393 3300046683 Unclassified 742
280 Ga0495677_0035497 3300047445 Bacteria 1819
281 Ga0495677_0323296 3300047445 Unclassified 608
282 Ga0501034_0000797 3300049571 Bacteria 46917
283 Ga0501034_0009873 3300049571 Bacteria 9979
284 Ga0501034_1603739 3300049571 Bacteria 524
285 Ga0501039_0983066 3300049575 Bacteria 656
286 Ga0501041_0317155 3300049577 Bacteria 983
287 Ga0501047_0759049 3300049581 Unclassified 786
288 Ga0501047_0919378 3300049581 Unclassified 688
289 Ga0501048_0698413 3300049582 Bacteria 728
290 Ga0501067_0000557 3300049583 Bacteria 20188
291 Ga0501067_0010625 3300049583 Bacteria 5094
292 Ga0501068_0000566 3300049584 Bacteria 18837
293 Ga0501068_0002674 3300049584 Bacteria 9440
294 Ga0501069_0000189 3300049585 Bacteria 27235
295 Ga0501069_0009533 3300049585 Bacteria 5124
296 Ga0501069_0091867 3300049585 Bacteria 1717
297 Ga0501069_1002753 3300049585 Bacteria 510
298 Ga0501070_0000897 3300049586 Bacteria 27107
299 Ga0501070_0004027 3300049586 Bacteria 12618
300 Ga0501070_0119084 3300049586 Bacteria 2182
301 Ga0501070_0213174 3300049586 Bacteria 1585
302 Ga0501071_0000072 3300049587 Bacteria 35900
303 Ga0501071_0001951 3300049587 Bacteria 12296
304 Ga0501071_0538283 3300049587 Bacteria 897
305 Ga0501071_1251301 3300049587 Bacteria 573
306 Ga0501072_0000727 3300049588 Bacteria 23987
307 Ga0501072_0581512 3300049588 Bacteria 883
308 Ga0501072_1128828 3300049588 Bacteria 610
309 Ga0501073_0004561 3300049589 Bacteria 10415
310 Ga0501073_0018989 3300049589 Bacteria 4966
311 Ga0501073_0374404 3300049589 Unclassified 984
312 Ga0501073_0948255 3300049589 Bacteria 592
313 Ga0501074_0000155 3300049590 Bacteria 35855
314 Ga0501074_0001153 3300049590 Bacteria 17283
315 Ga0501076_0124288 3300049592 Bacteria 2090
316 Ga0501079_0328410 3300049741 Bacteria 1198
317 Ga0501079_0374341 3300049741 Bacteria 1116
318 Ga0501079_0765817 3300049741 Bacteria 760
319 Ga0501080_0000657 3300049742 Bacteria 27465
320 Ga0501080_0009158 3300049742 Bacteria 9015
321 Ga0501080_0012551 3300049742 Bacteria 7768
322 Ga0501080_0263489 3300049742 Bacteria 1570
323 Ga0501081_0426720 3300049743 Unclassified 983
324 Ga0501081_0942496 3300049743 Bacteria 651
325 Ga0501083_0004023 3300049744 Bacteria 10332
326 Ga0501083_0014477 3300049744 Bacteria 5515
327 Ga0501083_0889324 3300049744 Unclassified 580
328 Ga0501035_0581860 3300049822 Bacteria 914
329 nmdc:mga05p37_210976_c1 3300050507 Bacteria 2348
330 nmdc:mga05p37_350356_c1 3300050507 Bacteria 1739
331 nmdc:mga05p37_458061_c1 3300050507 Bacteria 1474
332 nmdc:mga05p37_905246_c1 3300050507 Bacteria 951
333 nmdc:mga09592_457711_c1 3300050508 Unclassified 1100
334 nmdc:mga0qj67_128324_c1 3300050509 Bacteria 2052
335 nmdc:mga06r32_193427_c1 3300050510 Bacteria 2021
336 nmdc:mga06r32_250186_c1 3300050510 Unclassified 1760
337 nmdc:mga06r32_499103_c1 3300050510 Bacteria 1194
338 nmdc:mga06r32_707999_c1 3300050510 Bacteria 972
339 nmdc:mga08y16_287094_c1 3300050511 Bacteria 1696
340 nmdc:mga0n895_1010051_c1 3300050512 Unclassified 813
341 nmdc:mga0n895_127604_c1 3300050512 Bacteria 2568
342 nmdc:mga0n895_1996881_c1 3300050512 Unclassified 538
343 nmdc:mga0n895_20338_c1 3300050512 Bacteria 5588
344 nmdc:mga0n895_24775_c1 3300050512 Bacteria 5659
345 nmdc:mga0n895_45509_c1 3300050512 Bacteria 4283
346 nmdc:mga0n895_6776_c1 3300050512 Bacteria 9774
347 nmdc:mga0n895_7327_c1 3300050512 Bacteria 9460
348 nmdc:mga0n895_737437_c1 3300050512 Unclassified 979
349 nmdc:mga0n895_76916_c1 3300050512 Bacteria 3319
350 nmdc:mga0n895_769176_c1 3300050512 Bacteria 955
351 nmdc:mga0n895_85867_c1 3300050512 Bacteria 3142
352 nmdc:mga0n895_9368_c1 3300050512 Bacteria 8564
353 nmdc:mga0rr50_168713_c1 3300050513 Bacteria 1782
354 nmdc:mga0rr50_1770164_c1 3300050513 Bacteria 520
355 nmdc:mga0rr50_218339_c1 3300050513 Bacteria 1574
356 nmdc:mga0rr50_313662_c1 3300050513 Bacteria 1314
357 nmdc:mga0rr50_356579_c1 3300050513 Bacteria 1231
358 nmdc:mga0rr50_377272_c1 3300050513 Bacteria 1195
359 nmdc:mga0rr50_513131_c1 3300050513 Bacteria 1020
360 nmdc:mga0rr50_55941_c1 3300050513 Bacteria 2946
361 nmdc:mga0rr50_689788_c1 3300050513 Bacteria 872
362 nmdc:mga08x19_1036429_c1 3300050514 Unclassified 583
363 nmdc:mga08x19_114553_c1 3300050514 Bacteria 1801
364 nmdc:mga08x19_1181268_c1 3300050514 Unclassified 543
365 nmdc:mga08x19_1243099_c1 3300050514 Unclassified 528
366 nmdc:mga08x19_126543_c1 3300050514 Bacteria 1716
367 nmdc:mga08x19_13168_c1 3300050514 Bacteria 4995
368 nmdc:mga08x19_148750_c1 3300050514 Bacteria 1585
369 nmdc:mga08x19_22522_c1 3300050514 Bacteria 3902
370 nmdc:mga08x19_244467_c1 3300050514 Bacteria 1238
371 nmdc:mga08x19_258169_c1 3300050514 Bacteria 1204
372 nmdc:mga08x19_265747_c1 3300050514 Bacteria 1187
373 nmdc:mga08x19_310779_c1 3300050514 Bacteria 1096
374 nmdc:mga08x19_88450_c1 3300050514 Bacteria 2042
375 nmdc:mga08x19_89890_c1 3300050514 Unclassified 2026
376 nmdc:mga0a205_1050178_c1 3300050515 Unclassified 662
377 nmdc:mga0a205_1264759_c1 3300050515 Unclassified 586
378 nmdc:mga0a205_134519_c1 3300050515 Unclassified 2373
379 nmdc:mga0a205_209727_c1 3300050515 Bacteria 1837
380 nmdc:mga0a205_289458_c1 3300050515 Bacteria 1513
381 nmdc:mga0a205_488742_c1 3300050515 Bacteria 1089
382 nmdc:mga0a205_5068_c1 3300050515 Bacteria 11847
383 nmdc:mga0a205_59793_c1 3300050515 Bacteria 3681
384 Ga0501084_0000543 3300054114 Bacteria 28737
385 Ga0501084_0000816 3300054114 Bacteria 23914
386 Ga0501084_0105069 3300054114 Unclassified 2372
387 Ga0501084_0861844 3300054114 Bacteria 762
388 Ga0501082_0003693 3300060353 Bacteria 13366
389 Ga0501082_0016776 3300060353 Bacteria 6306
390 Ga0530510_0107385 3300061734 Bacteria 2043
391 Ga0070708_100032729
392 Ga0070680_100011266
393 Ga0070680_100015869
394 Ga0070680_100418400
395 Ga0070680_100750916
396 Ga0070691_10190460
397 Ga0070691_10945801
398 Ga0070687_100461741
399 Ga0070703_10000872
400 Ga0070703_10243455
401 Ga0070709_10007199
402 Ga0070709_10011419
403 Ga0070714_100652748
404 Ga0070713_100629474
405 Ga0070710_11373149
406 Ga0070701_10047140
407 Ga0070711_100000212
408 Ga0070711_101107795
409 Ga0070705_100098164
410 Ga0070705_100120988
411 Ga0070705_100136786
412 Ga0070705_100215870
413 Ga0070700_100318157
414 Ga0070700_100386080
415 Ga0070694_100003358
416 Ga0070694_100003672
417 Ga0070694_100013220
418 Ga0070694_100016781
419 Ga0070694_100019981
420 Ga0070694_100022441
421 Ga0070694_100144255
422 Ga0070694_100264538
423 Ga0070694_101034963
424 Ga0070708_100010208
425 Ga0070708_100199369
426 Ga0070708_100295024
427 Ga0070708_101143425
428 Ga0070681_11402769
429 Ga0068867_100208791
430 Ga0070706_100052519
431 Ga0070706_100057395
432 Ga0070706_100095225
433 Ga0070706_100125395
434 Ga0070706_100245445
435 Ga0070706_100555584
436 Ga0070706_101331164
437 Ga0070706_101605963
438 Ga0070706_101656082
439 Ga0070707_100020014
440 Ga0070707_100054859
441 Ga0070707_100150263
442 Ga0070707_100347630
443 Ga0070707_100399974
444 Ga0070707_100546599
445 Ga0070707_100698014
446 Ga0070707_100761902
447 Ga0070707_101860269
448 Ga0070707_102248276
449 Ga0070698_100040506
450 Ga0070698_100049244
451 Ga0070698_100054552
452 Ga0070699_100000702
453 Ga0070699_100008485
454 Ga0070699_100026761
455 Ga0070699_100032047
456 Ga0070699_100038138
457 Ga0070699_100053150
458 Ga0070699_100116738
459 Ga0070699_100154485
460 Ga0070699_100280360
461 Ga0070699_100707964
462 Ga0070699_101205110
463 Ga0070697_100006385
464 Ga0070697_100039068
465 Ga0070697_100066458
466 Ga0070697_100170618
467 Ga0070697_100264619
468 Ga0070697_100417691
469 Ga0070697_100534066
470 Ga0070697_100534077
471 Ga0070697_100737726
472 Ga0070697_100814225
473 Ga0070697_100846922
474 Ga0070697_101210633
475 Ga0070697_101475380
476 Ga0070695_100002580
477 Ga0070695_100034327
478 Ga0070695_100065368
479 Ga0070695_100090798
480 Ga0070695_100423180
481 Ga0070695_101057221
482 Ga0070695_101637344
483 Ga0070695_101858039
484 Ga0070696_100013106
485 Ga0070696_100020971
486 Ga0070696_100287312
487 Ga0070696_100620715
488 Ga0070693_101261762
489 Ga0070704_100004619
490 Ga0070704_100007953
491 Ga0070704_100012656
492 Ga0070704_100019915
493 Ga0070704_100029883
494 Ga0070704_100172267
495 Ga0070704_100298900
496 Ga0070704_100474394
497 Ga0070704_101015678
498 Ga0070704_101365130
499 Ga0070702_100073375
500 Ga0068861_101615190
501 Ga0068860_100629678
502 Ga0068860_101420985
503 Ga0070715_10153381
504 Ga0070716_100338802
505 Ga0075428_100370873
506 Ga0075428_100412617
507 Ga0075428_101237905
508 Ga0075428_102739158
509 Ga0075430_100036900
510 Ga0075431_100035955
511 Ga0075431_100202553
512 Ga0075431_100246558
513 Ga0075431_100625105
514 Ga0075431_101236608
515 Ga0075433_10011546
516 Ga0075433_10013817
517 Ga0075433_10169530
518 Ga0075433_10213762
519 Ga0075433_10322575
520 Ga0075433_10861199
521 Ga0075433_11281504
522 Ga0075433_11775539
523 Ga0075434_100004541
524 Ga0075434_100009337
525 Ga0075434_100051231
526 Ga0075434_100064419
527 Ga0075434_100103644
528 Ga0075434_100133059
529 Ga0075434_100142682
530 Ga0075434_100153064
531 Ga0075434_100178796
532 Ga0075434_100237610
533 Ga0075434_100493933
534 Ga0075434_101206889
535 Ga0075434_102146196
536 Ga0075429_100004470
537 Ga0075429_100502222
538 Ga0075436_100021130
539 Ga0075436_100023073
540 Ga0075436_100039500
541 Ga0075436_100044900
542 Ga0075436_100080607
543 Ga0075436_100093494
544 Ga0075436_100259811
545 Ga0075436_100514824
546 Ga0075436_100699805
547 Ga0075436_101263945
548 Ga0075435_100014636
549 Ga0075435_100026495
550 Ga0075435_100060963
551 Ga0075435_100273307
552 Ga0075435_100417543
553 Ga0075435_100455450
554 Ga0075435_101358673
555 Ga0075435_101803774
556 Ga0099794_10000059
557 Ga0099794_10011762
558 Ga0099794_10030519
559 Ga0099794_10080445
560 Ga0099794_10145842
561 Ga0099795_10087113
562 Ga0105250_10575680
563 Ga0111539_10284190
564 Ga0111539_13067523
565 Ga0114129_10116651
566 Ga0114129_10188290
567 Ga0114129_10287143
568 Ga0114129_11098452
569 Ga0114129_11500611
570 Ga0114129_11726336
571 Ga0114129_11802404
572 Ga0114129_12393020
573 Ga0207653_10000067
574 Ga0207653_10001214
575 Ga0207653_10012949
576 Ga0207653_10087987
577 Ga0207653_10226096
578 Ga0207685_10787532
579 Ga0207699_10010925
580 Ga0207699_10052340
581 Ga0207684_10006378
582 Ga0207684_10048406
583 Ga0207684_10063318
584 Ga0207684_10266224
585 Ga0207684_10439012
586 Ga0207684_10612744
587 Ga0207684_11090129
588 Ga0207684_11159971
589 Ga0207684_11648518
590 Ga0207707_10030313
591 Ga0207707_11627399
592 Ga0207663_10000153
593 Ga0207663_10033674
594 Ga0207660_10013082
595 Ga0207660_10024325
596 Ga0207660_10036520
597 Ga0207660_10837149
598 Ga0207662_10268746
599 Ga0207652_10004666
600 Ga0207646_10003133
601 Ga0207646_10003920
602 Ga0207646_10043990
603 Ga0207646_10045695
604 Ga0207646_10069259
605 Ga0207646_10116992
606 Ga0207646_10160912
607 Ga0207646_10487283
608 Ga0207646_10625817
609 Ga0207646_10846611
610 Ga0207646_10913889
611 Ga0207646_11420902
612 Ga0207646_11511511
613 Ga0207664_10541275
614 Ga0207704_11634577
615 Ga0207665_10428033
616 Ga0207708_10013839
617 Ga0207648_10125311
618 Ga0209588_1004174
619 Ga0209588_1011431
620 Ga0209588_1026090
621 Ga0268264_10455211
622 Ga0316182_1389529
623 Ga0307405_10071412
624 Ga0307413_10017464
625 Ga0307413_10198592
626 Ga0307410_10011227
627 Ga0307410_10059950
628 Ga0307406_10745928
629 Ga0307407_10250337
630 Ga0307407_10476171
631 Ga0307412_10091989
632 Ga0307409_101766550
633 Ga0307416_101767308
634 Ga0307411_10065738
635 Ga0373927_0498969
636 Ga0373937_1408760
637 Ga0451800_0854032
638 Ga0451804_0060687
639 Ga0451807_1551778
640 Ga0451849_1115830
641 Ga0439462_0071819
642 Ga0450898_008839
643 Ga0450898_027257
644 Ga0451577_0164505
645 Ga0451577_1460773
646 Ga0453683_0033027
647 Ga0453683_0060670
648 Ga0453683_0117796
649 Ga0453683_0831493
650 Ga0451576_0003753
651 Ga0451576_0004763
652 Ga0451576_0009533
653 Ga0451576_0021647
654 Ga0451576_0055872
655 Ga0451576_0299194
656 Ga0451576_0312708
657 Ga0451576_0645870
658 Ga0451576_0741767
659 Ga0451576_0836058
660 Ga0451576_1925823
661 Ga0451576_2749857
662 Ga0495639_0374369
663 Ga0495630_1420404
664 Ga0495663_0030541
665 Ga0495642_0045691
666 Ga0495586_0343306
667 Ga0495609_0077827
668 Ga0495657_0182092
669 Ga0495658_0546393
670 Ga0495677_0035497
671 Ga0495677_0323296
672 Ga0501034_0000797
673 Ga0501034_0009873
674 Ga0501034_1603739
675 Ga0501039_0983066
676 Ga0501041_0317155
677 Ga0501047_0759049
678 Ga0501047_0919378
679 Ga0501048_0698413
680 Ga0501067_0000557
681 Ga0501067_0010625
682 Ga0501068_0000566
683 Ga0501068_0002674
684 Ga0501069_0000189
685 Ga0501069_0009533
686 Ga0501069_0091867
687 Ga0501069_1002753
688 Ga0501070_0000897
689 Ga0501070_0004027
690 Ga0501070_0119084
691 Ga0501070_0213174
692 Ga0501071_0000072
693 Ga0501071_0001951
694 Ga0501071_0538283
695 Ga0501071_1251301
696 Ga0501072_0000727
697 Ga0501072_0581512
698 Ga0501072_1128828
699 Ga0501073_0004561
700 Ga0501073_0018989
701 Ga0501073_0374404
702 Ga0501073_0948255
703 Ga0501074_0000155
704 Ga0501074_0001153
705 Ga0501076_0124288
706 Ga0501079_0328410
707 Ga0501079_0374341
708 Ga0501079_0765817
709 Ga0501080_0000657
710 Ga0501080_0009158
711 Ga0501080_0012551
712 Ga0501080_0263489
713 Ga0501081_0426720
714 Ga0501081_0942496
715 Ga0501083_0004023
716 Ga0501083_0014477
717 Ga0501083_0889324
718 Ga0501035_0581860
719 nmdc:mga05p37_210976_c1
720 nmdc:mga05p37_350356_c1
721 nmdc:mga05p37_458061_c1
722 nmdc:mga05p37_905246_c1
723 nmdc:mga09592_457711_c1
724 nmdc:mga0qj67_128324_c1
725 nmdc:mga06r32_193427_c1
726 nmdc:mga06r32_250186_c1
727 nmdc:mga06r32_499103_c1
728 nmdc:mga06r32_707999_c1
729 nmdc:mga08y16_287094_c1
730 nmdc:mga0n895_1010051_c1
731 nmdc:mga0n895_127604_c1
732 nmdc:mga0n895_1996881_c1
733 nmdc:mga0n895_20338_c1
734 nmdc:mga0n895_24775_c1
735 nmdc:mga0n895_45509_c1
736 nmdc:mga0n895_6776_c1
737 nmdc:mga0n895_7327_c1
738 nmdc:mga0n895_737437_c1
739 nmdc:mga0n895_76916_c1
740 nmdc:mga0n895_769176_c1
741 nmdc:mga0n895_85867_c1
742 nmdc:mga0n895_9368_c1
743 nmdc:mga0rr50_168713_c1
744 nmdc:mga0rr50_1770164_c1
745 nmdc:mga0rr50_218339_c1
746 nmdc:mga0rr50_313662_c1
747 nmdc:mga0rr50_356579_c1
748 nmdc:mga0rr50_377272_c1
749 nmdc:mga0rr50_513131_c1
750 nmdc:mga0rr50_55941_c1
751 nmdc:mga0rr50_689788_c1
752 nmdc:mga08x19_1036429_c1
753 nmdc:mga08x19_114553_c1
754 nmdc:mga08x19_1181268_c1
755 nmdc:mga08x19_1243099_c1
756 nmdc:mga08x19_126543_c1
757 nmdc:mga08x19_13168_c1
758 nmdc:mga08x19_148750_c1
759 nmdc:mga08x19_22522_c1
760 nmdc:mga08x19_244467_c1
761 nmdc:mga08x19_258169_c1
762 nmdc:mga08x19_265747_c1
763 nmdc:mga08x19_310779_c1
764 nmdc:mga08x19_88450_c1
765 nmdc:mga08x19_89890_c1
766 nmdc:mga0a205_1050178_c1
767 nmdc:mga0a205_1264759_c1
768 nmdc:mga0a205_134519_c1
769 nmdc:mga0a205_209727_c1
770 nmdc:mga0a205_289458_c1
771 nmdc:mga0a205_488742_c1
772 nmdc:mga0a205_5068_c1
773 nmdc:mga0a205_59793_c1
774 Ga0501084_0000543
775 Ga0501084_0000816
776 Ga0501084_0105069
777 Ga0501084_0861844
778 Ga0501082_0003693
779 Ga0501082_0016776
780 Ga0530510_0107385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10719

ComFB

Late competence development protein ComFB

12

94

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wai-assembly2.cif.gz_C structural characterization of the late competence protein comfb from bacillus subtilis. 0.669 1 91
4wai-assembly2.cif.gz_C structural characterization of the late competence protein comfb from bacillus subtilis. 0.6624 1 91
4wai-assembly1.cif.gz_B structural characterization of the late competence protein comfb from bacillus subtilis. 0.6532 1 89
4wai-assembly1.cif.gz_B structural characterization of the late competence protein comfb from bacillus subtilis. 0.6465 1 89
8hja-assembly1.cif.gz_A the crystal structure of syn_cdgr-(c-di-gmp) from synechocystis sp. pcc 6803 0.5792 4 91
ID Description Score Start End Superfamily
af_C4J362_84_187_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.6437 5 89 1.10.472.10
3au9B03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.6361 5 79 1.10.1740.10
af_Q0DQA9_103_206_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.6231 5 91 1.10.472.10
af_Q4DWL9_111_226_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.6077 7 91 1.10.472.10
af_A0A1D6PHV1_244_335_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.6008 8 81 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A7V6UX25-F1-model_v4 Late competence development ComFB family protein 0.903 7 85
AF-R6D9T8-F1-model_v4 Late competence development protein ComFB 0.8739 7 86
AF-A0A7V6UX25-F1-model_v4 Late competence development ComFB family protein 0.8709 7 85
AF-A0A1Y3PJ11-F1-model_v4 Competence protein ComFB 0.8548 11 85
AF-R6D9T8-F1-model_v4 Late competence development protein ComFB 0.8439 7 86

Map