F431635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 390 | 260 | 390 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100798696|Ga0070670_1007986962 |
| Length | 135 |
| Sequence | VGHTWLVTDELNVLGGALQTCGTDPLTGFYRDGCCTSGPQQAVHLICVVATAEFLEHQRSVGNDLSTPHPEWQFPGLHPGDRWCVVTARWLQAHDDGVAAPVVLAATSERALELIPLDVLREHSVDVPDDPGMLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 154 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 155 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 157 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 160 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 162 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 163 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 164 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 168 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 170 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 171 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 172 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 173 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 174 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 175 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 178 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 179 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 244 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 245 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 252 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 255 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 256 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 257 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 260 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.23 |
| Metatranscriptomes | 0.77 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.1 |
| Nodule | 0 |
| Rhizoplane | 6.15 |
| Rhizosphere | 87.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1002302 | 3300000546 | Bacteria | 2349 |
| 2 | JGI24750J21931_1011578 | 3300002070 | Bacteria | 1161 |
| 3 | JGI24745J21846_1002591 | 3300002073 | Bacteria | 1853 |
| 4 | JGI24748J21848_1008594 | 3300002074 | Bacteria | 1201 |
| 5 | JGI24749J21850_1004806 | 3300002076 | Bacteria | 1893 |
| 6 | JGI24744J21845_10001651 | 3300002077 | Bacteria | 4465 |
| 7 | JGI24034J26672_10002268 | 3300002239 | Bacteria | 2630 |
| 8 | JGI24742J22300_10000635 | 3300002244 | Bacteria | 5277 |
| 9 | Ga0070676_10186063 | 3300005328 | Bacteria | 1353 |
| 10 | Ga0070683_101920781 | 3300005329 | Bacteria | 569 |
| 11 | Ga0070690_100025092 | 3300005330 | Bacteria | 3670 |
| 12 | Ga0070670_100798696 | 3300005331 | Bacteria | 852 |
| 13 | Ga0070666_10005391 | 3300005335 | Bacteria | 7840 |
| 14 | Ga0070682_100195189 | 3300005337 | Bacteria | 1424 |
| 15 | Ga0068868_100001185 | 3300005338 | Bacteria | 17864 |
| 16 | Ga0070689_100041787 | 3300005340 | Bacteria | 3520 |
| 17 | Ga0070691_10005929 | 3300005341 | Bacteria | 5574 |
| 18 | Ga0070687_100023382 | 3300005343 | Bacteria | 2937 |
| 19 | Ga0070692_10125222 | 3300005345 | Bacteria | 1438 |
| 20 | Ga0070668_100002593 | 3300005347 | Bacteria | 13283 |
| 21 | Ga0070668_100009122 | 3300005347 | Bacteria | 7363 |
| 22 | Ga0070669_100015542 | 3300005353 | Bacteria | 5426 |
| 23 | Ga0070671_100930847 | 3300005355 | Bacteria | 760 |
| 24 | Ga0070674_100001050 | 3300005356 | Bacteria | 14454 |
| 25 | Ga0070674_100413023 | 3300005356 | Bacteria | 1105 |
| 26 | Ga0070667_100003670 | 3300005367 | Bacteria | 13070 |
| 27 | Ga0070667_100204701 | 3300005367 | Bacteria | 1752 |
| 28 | Ga0070703_10058176 | 3300005406 | Bacteria | 1257 |
| 29 | Ga0070709_10117549 | 3300005434 | Bacteria | 1797 |
| 30 | Ga0070709_10752339 | 3300005434 | Unclassified | 762 |
| 31 | Ga0070713_100212586 | 3300005436 | Bacteria | 1751 |
| 32 | Ga0070710_10001208 | 3300005437 | Bacteria | 12231 |
| 33 | Ga0070701_10029540 | 3300005438 | Bacteria | 2705 |
| 34 | Ga0070711_100002788 | 3300005439 | Bacteria | 10019 |
| 35 | Ga0070711_101322096 | 3300005439 | Unclassified | 626 |
| 36 | Ga0070700_100014368 | 3300005441 | Bacteria | 4469 |
| 37 | Ga0070694_100014088 | 3300005444 | Bacteria | 5004 |
| 38 | Ga0070708_100218715 | 3300005445 | Bacteria | 1786 |
| 39 | Ga0070708_100406970 | 3300005445 | Bacteria | 1283 |
| 40 | Ga0070663_100011524 | 3300005455 | Bacteria | 5556 |
| 41 | Ga0070663_101226830 | 3300005455 | Bacteria | 660 |
| 42 | Ga0070678_100003252 | 3300005456 | Bacteria | 9026 |
| 43 | Ga0070662_100031780 | 3300005457 | Bacteria | 3708 |
| 44 | Ga0068867_100001068 | 3300005459 | Bacteria | 18704 |
| 45 | Ga0070685_10110934 | 3300005466 | Bacteria | 1689 |
| 46 | Ga0070706_100240706 | 3300005467 | Bacteria | 1690 |
| 47 | Ga0070707_100008936 | 3300005468 | Bacteria | 9295 |
| 48 | Ga0070707_100046532 | 3300005468 | Bacteria | 4152 |
| 49 | Ga0070707_100110892 | 3300005468 | Bacteria | 2661 |
| 50 | Ga0070707_100205287 | 3300005468 | Bacteria | 1920 |
| 51 | Ga0070698_100022018 | 3300005471 | Bacteria | 6674 |
| 52 | Ga0070697_100449868 | 3300005536 | Bacteria | 1122 |
| 53 | Ga0068853_100013240 | 3300005539 | Bacteria | 6732 |
| 54 | Ga0070672_100066376 | 3300005543 | Bacteria | 2857 |
| 55 | Ga0070686_100006961 | 3300005544 | Bacteria | 6303 |
| 56 | Ga0070696_100003466 | 3300005546 | Bacteria | 10481 |
| 57 | Ga0070665_100034020 | 3300005548 | Bacteria | 5125 |
| 58 | Ga0070665_100867079 | 3300005548 | Bacteria | 916 |
| 59 | Ga0070704_100000313 | 3300005549 | Bacteria | 21721 |
| 60 | Ga0068855_100036881 | 3300005563 | Bacteria | 5816 |
| 61 | Ga0068855_100196849 | 3300005563 | Bacteria | 2270 |
| 62 | Ga0068854_100003099 | 3300005578 | Bacteria | 10349 |
| 63 | Ga0068856_100159699 | 3300005614 | Bacteria | 2264 |
| 64 | Ga0070702_100141886 | 3300005615 | Bacteria | 1531 |
| 65 | Ga0068859_100022306 | 3300005617 | Bacteria | 6348 |
| 66 | Ga0068866_10000158 | 3300005718 | Bacteria | 31180 |
| 67 | Ga0068861_100001564 | 3300005719 | Bacteria | 14560 |
| 68 | Ga0068863_100151731 | 3300005841 | Bacteria | 2217 |
| 69 | Ga0068858_100077626 | 3300005842 | Bacteria | 3085 |
| 70 | Ga0068858_100188445 | 3300005842 | Bacteria | 1949 |
| 71 | Ga0068858_101027024 | 3300005842 | Bacteria | 808 |
| 72 | Ga0068860_100002092 | 3300005843 | Bacteria | 21025 |
| 73 | Ga0068860_100510447 | 3300005843 | Bacteria | 1201 |
| 74 | Ga0081455_10083897 | 3300005937 | Bacteria | 2602 |
| 75 | Ga0081538_10061445 | 3300005981 | Bacteria | 2150 |
| 76 | Ga0075363_100026116 | 3300006048 | Bacteria | 2986 |
| 77 | Ga0075363_100118010 | 3300006048 | Bacteria | 1479 |
| 78 | Ga0070715_10344473 | 3300006163 | Bacteria | 812 |
| 79 | Ga0070716_100000832 | 3300006173 | Bacteria | 13314 |
| 80 | Ga0070716_100236136 | 3300006173 | Bacteria | 1237 |
| 81 | Ga0070716_101200905 | 3300006173 | Bacteria | 609 |
| 82 | Ga0070712_100001192 | 3300006175 | Bacteria | 15718 |
| 83 | Ga0075367_10031652 | 3300006178 | Bacteria | 3039 |
| 84 | Ga0075369_10110512 | 3300006186 | Bacteria | 1238 |
| 85 | Ga0075369_10302328 | 3300006186 | Bacteria | 747 |
| 86 | Ga0068871_100350936 | 3300006358 | Bacteria | 1305 |
| 87 | Ga0075428_100004890 | 3300006844 | Bacteria | 14877 |
| 88 | Ga0075430_100007000 | 3300006846 | Bacteria | 9507 |
| 89 | Ga0075430_100214191 | 3300006846 | Bacteria | 1598 |
| 90 | Ga0075431_100000193 | 3300006847 | Bacteria | 44515 |
| 91 | Ga0075431_100017112 | 3300006847 | Bacteria | 7368 |
| 92 | Ga0075429_100412985 | 3300006880 | Bacteria | 1182 |
| 93 | Ga0068865_100002102 | 3300006881 | Bacteria | 11759 |
| 94 | Ga0097620_100022306 | 3300006931 | Bacteria | 6348 |
| 95 | Ga0105250_10186537 | 3300009092 | Bacteria | 871 |
| 96 | Ga0105240_10754908 | 3300009093 | Bacteria | 1057 |
| 97 | Ga0111539_10889865 | 3300009094 | Bacteria | 1036 |
| 98 | Ga0105245_10004552 | 3300009098 | Bacteria | 12237 |
| 99 | Ga0105247_10000899 | 3300009101 | Bacteria | 22371 |
| 100 | Ga0105247_11098930 | 3300009101 | Bacteria | 627 |
| 101 | Ga0114129_10023791 | 3300009147 | Bacteria | 8684 |
| 102 | Ga0105241_10090631 | 3300009174 | Bacteria | 2412 |
| 103 | Ga0105241_11691981 | 3300009174 | Bacteria | 614 |
| 104 | Ga0105242_10000066 | 3300009176 | Bacteria | 73865 |
| 105 | Ga0105248_10019044 | 3300009177 | Bacteria | 7589 |
| 106 | Ga0105248_10023924 | 3300009177 | Bacteria | 6790 |
| 107 | Ga0105237_10002826 | 3300009545 | Bacteria | 21122 |
| 108 | Ga0105238_10206665 | 3300009551 | Bacteria | 1940 |
| 109 | Ga0105249_10002866 | 3300009553 | Bacteria | 14893 |
| 110 | Ga0105030_114586 | 3300009987 | Bacteria | 692 |
| 111 | Ga0105239_10107999 | 3300010375 | Bacteria | 3083 |
| 112 | Ga0157371_11184888 | 3300013102 | Bacteria | 588 |
| 113 | Ga0157374_10479093 | 3300013296 | Bacteria | 1248 |
| 114 | Ga0157378_10004830 | 3300013297 | Bacteria | 11813 |
| 115 | Ga0157378_10332362 | 3300013297 | Bacteria | 1479 |
| 116 | Ga0163162_10005544 | 3300013306 | Bacteria | 12201 |
| 117 | Ga0157372_10001039 | 3300013307 | Bacteria | 30364 |
| 118 | Ga0157372_11480674 | 3300013307 | Bacteria | 782 |
| 119 | Ga0157375_10000268 | 3300013308 | Bacteria | 47381 |
| 120 | Ga0157375_10150124 | 3300013308 | Bacteria | 2465 |
| 121 | Ga0163163_12489505 | 3300014325 | Bacteria | 576 |
| 122 | Ga0157380_10000036 | 3300014326 | Bacteria | 81892 |
| 123 | Ga0157377_10152000 | 3300014745 | Bacteria | 1432 |
| 124 | Ga0157376_10461607 | 3300014969 | Bacteria | 1241 |
| 125 | Ga0157376_10771508 | 3300014969 | Bacteria | 972 |
| 126 | Ga0206354_10518041 | 3300020081 | Bacteria | 1360 |
| 127 | Ga0206353_10123647 | 3300020082 | Bacteria | 1889 |
| 128 | Ga0206353_10631349 | 3300020082 | Bacteria | 629 |
| 129 | Ga0213874_10011696 | 3300021377 | Bacteria | 2231 |
| 130 | Ga0213876_10370893 | 3300021384 | Bacteria | 761 |
| 131 | Ga0207696_1162217 | 3300025711 | Bacteria | 594 |
| 132 | Ga0207653_10108177 | 3300025885 | Bacteria | 990 |
| 133 | Ga0207692_10004107 | 3300025898 | Bacteria | 5743 |
| 134 | Ga0207642_10003021 | 3300025899 | Bacteria | 5275 |
| 135 | Ga0207710_10002938 | 3300025900 | Bacteria | 7736 |
| 136 | Ga0207688_10000314 | 3300025901 | Bacteria | 22302 |
| 137 | Ga0207685_10274171 | 3300025905 | Bacteria | 825 |
| 138 | Ga0207699_10104742 | 3300025906 | Bacteria | 1802 |
| 139 | Ga0207645_10006251 | 3300025907 | Bacteria | 8558 |
| 140 | Ga0207705_10579918 | 3300025909 | Bacteria | 872 |
| 141 | Ga0207684_10209232 | 3300025910 | Bacteria | 1683 |
| 142 | Ga0207654_10212339 | 3300025911 | Bacteria | 1279 |
| 143 | Ga0207695_10600139 | 3300025913 | Bacteria | 982 |
| 144 | Ga0207671_10007517 | 3300025914 | Bacteria | 9447 |
| 145 | Ga0207671_10161142 | 3300025914 | Bacteria | 1737 |
| 146 | Ga0207693_10000224 | 3300025915 | Bacteria | 51559 |
| 147 | Ga0207693_10079887 | 3300025915 | Bacteria | 2560 |
| 148 | Ga0207663_10012477 | 3300025916 | Bacteria | 4595 |
| 149 | Ga0207662_10027613 | 3300025918 | Bacteria | 3276 |
| 150 | Ga0207646_10012929 | 3300025922 | Bacteria | 8000 |
| 151 | Ga0207646_10118762 | 3300025922 | Bacteria | 2375 |
| 152 | Ga0207646_10166538 | 3300025922 | Bacteria | 1990 |
| 153 | Ga0207646_10183374 | 3300025922 | Bacteria | 1890 |
| 154 | Ga0207646_10361158 | 3300025922 | Bacteria | 1312 |
| 155 | Ga0207681_10005775 | 3300025923 | Bacteria | 7590 |
| 156 | Ga0207687_10003262 | 3300025927 | Bacteria | 10988 |
| 157 | Ga0207700_10349751 | 3300025928 | Bacteria | 1287 |
| 158 | Ga0207644_10692088 | 3300025931 | Bacteria | 850 |
| 159 | Ga0207690_11087959 | 3300025932 | Bacteria | 666 |
| 160 | Ga0207706_10000288 | 3300025933 | Bacteria | 54869 |
| 161 | Ga0207686_10002590 | 3300025934 | Bacteria | 9813 |
| 162 | Ga0207709_10010164 | 3300025935 | Bacteria | 5184 |
| 163 | Ga0207670_10820005 | 3300025936 | Bacteria | 776 |
| 164 | Ga0207669_10000644 | 3300025937 | Bacteria | 15101 |
| 165 | Ga0207669_10313297 | 3300025937 | Bacteria | 1198 |
| 166 | Ga0207704_10000083 | 3300025938 | Bacteria | 56018 |
| 167 | Ga0207665_10000513 | 3300025939 | Bacteria | 26201 |
| 168 | Ga0207665_10078488 | 3300025939 | Bacteria | 2268 |
| 169 | Ga0207691_10100383 | 3300025940 | Bacteria | 2583 |
| 170 | Ga0207711_10046018 | 3300025941 | Bacteria | 3728 |
| 171 | Ga0207711_10374419 | 3300025941 | Bacteria | 1321 |
| 172 | Ga0207689_10217562 | 3300025942 | Bacteria | 1578 |
| 173 | Ga0207712_10003359 | 3300025961 | Bacteria | 10124 |
| 174 | Ga0207668_10001110 | 3300025972 | Bacteria | 16019 |
| 175 | Ga0207668_10004363 | 3300025972 | Bacteria | 8303 |
| 176 | Ga0207640_10001883 | 3300025981 | Bacteria | 11252 |
| 177 | Ga0207658_10025584 | 3300025986 | Bacteria | 4133 |
| 178 | Ga0207658_10276191 | 3300025986 | Bacteria | 1438 |
| 179 | Ga0207677_10003217 | 3300026023 | Bacteria | 8617 |
| 180 | Ga0207703_10019047 | 3300026035 | Bacteria | 5361 |
| 181 | Ga0207639_10013122 | 3300026041 | Bacteria | 5789 |
| 182 | Ga0207678_10037920 | 3300026067 | Bacteria | 4190 |
| 183 | Ga0207708_10001720 | 3300026075 | Bacteria | 16190 |
| 184 | Ga0207702_10087711 | 3300026078 | Bacteria | 2717 |
| 185 | Ga0207702_11692685 | 3300026078 | Unclassified | 625 |
| 186 | Ga0207648_10001622 | 3300026089 | Bacteria | 24662 |
| 187 | Ga0207648_10441348 | 3300026089 | Bacteria | 1184 |
| 188 | Ga0207675_100000324 | 3300026118 | Bacteria | 45435 |
| 189 | Ga0207683_10000077 | 3300026121 | Bacteria | 77710 |
| 190 | Ga0207683_10770219 | 3300026121 | Bacteria | 893 |
| 191 | Ga0207698_10037930 | 3300026142 | Bacteria | 3555 |
| 192 | Ga0209588_1080181 | 3300027671 | Bacteria | 1054 |
| 193 | Ga0268266_10059922 | 3300028379 | Bacteria | 3280 |
| 194 | Ga0268265_10008356 | 3300028380 | Bacteria | 6990 |
| 195 | Ga0268264_10021807 | 3300028381 | Bacteria | 5228 |
| 196 | Ga0268264_10481154 | 3300028381 | Bacteria | 1208 |
| 197 | Ga0316576_10539302 | 3300031727 | Bacteria | 856 |
| 198 | Ga0316578_10028754 | 3300031728 | Bacteria | 3150 |
| 199 | Ga0373940_0314496 | 3300035088 | Bacteria | 542 |
| 200 | Ga0373939_0024573 | 3300035114 | Bacteria | 1680 |
| 201 | Ga0373954_0054833 | 3300035118 | Bacteria | 1875 |
| 202 | Ga0373942_0168519 | 3300035207 | Bacteria | 712 |
| 203 | Ga0373962_0320060 | 3300035242 | Bacteria | 554 |
| 204 | Ga0316574_0101357 | 3300035398 | Bacteria | 1843 |
| 205 | Ga0373927_0234123 | 3300035695 | Bacteria | 1207 |
| 206 | Ga0316584_0067342 | 3300036712 | Bacteria | 2684 |
| 207 | Ga0436364_1103776 | 3300037853 | Bacteria | 4780 |
| 208 | Ga0400485_18803 | 3300038735 | Bacteria | 1598 |
| 209 | Ga0436365_0431317 | 3300039437 | Bacteria | 706 |
| 210 | Ga0436365_0662372 | 3300039437 | Bacteria | 9045 |
| 211 | Ga0436365_1490252 | 3300039437 | Bacteria | 3416 |
| 212 | Ga0436363_1265155 | 3300039450 | Bacteria | 80087 |
| 213 | Ga0436362_1146574 | 3300039453 | Bacteria | 3314 |
| 214 | Ga0451791_1889493 | 3300041451 | Bacteria | 734 |
| 215 | Ga0451800_0083973 | 3300041459 | Bacteria | 510 |
| 216 | Ga0439443_047414 | 3300042003 | Bacteria | 745 |
| 217 | Ga0439448_0278800 | 3300042005 | Bacteria | 592 |
| 218 | Ga0466966_0689414 | 3300044684 | Bacteria | 616 |
| 219 | Ga0466961_0113864 | 3300044693 | Bacteria | 1700 |
| 220 | Ga0466961_0114542 | 3300044693 | Bacteria | 1695 |
| 221 | Ga0466963_1078422 | 3300044694 | Bacteria | 565 |
| 222 | Ga0466964_0068011 | 3300044706 | Bacteria | 1499 |
| 223 | Ga0466970_0367861 | 3300044765 | Bacteria | 817 |
| 224 | Ga0466960_0650338 | 3300044901 | Bacteria | 629 |
| 225 | Ga0466959_0101223 | 3300045049 | Bacteria | 2062 |
| 226 | Ga0466959_0503552 | 3300045049 | Bacteria | 818 |
| 227 | Ga0466958_0300847 | 3300045836 | Bacteria | 1030 |
| 228 | Ga0466958_0396363 | 3300045836 | Bacteria | 891 |
| 229 | Ga0466967_0005898 | 3300045976 | Bacteria | 8584 |
| 230 | Ga0466967_0043547 | 3300045976 | Bacteria | 3887 |
| 231 | Ga0466967_0097263 | 3300045976 | Bacteria | 2687 |
| 232 | Ga0466967_0902029 | 3300045976 | Bacteria | 879 |
| 233 | Ga0466967_1311336 | 3300045976 | Bacteria | 721 |
| 234 | Ga0495583_0091316 | 3300046506 | Bacteria | 1310 |
| 235 | Ga0495606_0040587 | 3300046507 | Bacteria | 3127 |
| 236 | Ga0495648_0006622 | 3300046524 | Bacteria | 9394 |
| 237 | Ga0495654_0023897 | 3300046530 | Bacteria | 3162 |
| 238 | Ga0495611_0070786 | 3300046648 | Bacteria | 1594 |
| 239 | Ga0495625_0308276 | 3300046660 | Bacteria | 1011 |
| 240 | Ga0495635_0069721 | 3300046663 | Bacteria | 2410 |
| 241 | Ga0495646_0518046 | 3300046680 | Bacteria | 611 |
| 242 | Ga0495647_0060465 | 3300046681 | Bacteria | 1494 |
| 243 | Ga0495658_0153602 | 3300046683 | Bacteria | 1415 |
| 244 | Ga0495649_0265055 | 3300046694 | Bacteria | 880 |
| 245 | Ga0495581_0544124 | 3300047315 | Bacteria | 674 |
| 246 | Ga0495674_0331276 | 3300047319 | Bacteria | 1239 |
| 247 | Ga0495672_0003170 | 3300047320 | Bacteria | 14300 |
| 248 | Ga0495673_0005474 | 3300047469 | Bacteria | 7667 |
| 249 | Ga0495602_0647714 | 3300048088 | Bacteria | 722 |
| 250 | Ga0495614_0090889 | 3300048089 | Bacteria | 1328 |
| 251 | Ga0495626_0017832 | 3300048091 | Bacteria | 3580 |
| 252 | Ga0496100_0001517 | 3300048903 | Bacteria | 11373 |
| 253 | Ga0496100_0004555 | 3300048903 | Bacteria | 7365 |
| 254 | Ga0496101_0000176 | 3300048904 | Bacteria | 51135 |
| 255 | Ga0496101_0002224 | 3300048904 | Bacteria | 11852 |
| 256 | Ga0496102_0000915 | 3300048905 | Bacteria | 27833 |
| 257 | Ga0496102_0027557 | 3300048905 | Bacteria | 5074 |
| 258 | Ga0496103_0003103 | 3300048906 | Bacteria | 10213 |
| 259 | Ga0496103_0397594 | 3300048906 | Bacteria | 885 |
| 260 | Ga0496104_0003864 | 3300048907 | Bacteria | 12961 |
| 261 | Ga0496105_0032092 | 3300048908 | Bacteria | 4308 |
| 262 | Ga0496106_0000359 | 3300048909 | Bacteria | 32347 |
| 263 | Ga0496106_0009115 | 3300048909 | Bacteria | 7332 |
| 264 | Ga0496107_0045217 | 3300048910 | Bacteria | 3166 |
| 265 | Ga0496109_0000697 | 3300048912 | Bacteria | 27916 |
| 266 | Ga0496109_0646126 | 3300048912 | Bacteria | 995 |
| 267 | Ga0496109_0762154 | 3300048912 | Bacteria | 906 |
| 268 | Ga0496109_1398670 | 3300048912 | Unclassified | 635 |
| 269 | Ga0496112_1027097 | 3300048915 | Bacteria | 744 |
| 270 | Ga0496114_0001108 | 3300048917 | Bacteria | 20364 |
| 271 | Ga0496114_0004574 | 3300048917 | Bacteria | 10745 |
| 272 | Ga0496115_0000890 | 3300048918 | Bacteria | 21666 |
| 273 | Ga0496115_0001243 | 3300048918 | Bacteria | 18283 |
| 274 | Ga0501031_0010009 | 3300049568 | Bacteria | 6176 |
| 275 | Ga0501031_0194238 | 3300049568 | Bacteria | 1325 |
| 276 | Ga0501031_1021150 | 3300049568 | Bacteria | 528 |
| 277 | Ga0501032_0039256 | 3300049569 | Bacteria | 3221 |
| 278 | Ga0501033_0036152 | 3300049570 | Bacteria | 3702 |
| 279 | Ga0501033_0052993 | 3300049570 | Bacteria | 3006 |
| 280 | Ga0501034_0101654 | 3300049571 | Bacteria | 2868 |
| 281 | Ga0501036_0009272 | 3300049572 | Bacteria | 8089 |
| 282 | Ga0501036_0196942 | 3300049572 | Bacteria | 1695 |
| 283 | Ga0501036_0338287 | 3300049572 | Bacteria | 1257 |
| 284 | Ga0501037_0017017 | 3300049573 | Bacteria | 5349 |
| 285 | Ga0501037_0069038 | 3300049573 | Bacteria | 2573 |
| 286 | Ga0501037_0455904 | 3300049573 | Bacteria | 872 |
| 287 | Ga0501037_0952486 | 3300049573 | Bacteria | 561 |
| 288 | Ga0501038_0005615 | 3300049574 | Bacteria | 11641 |
| 289 | Ga0501038_0037524 | 3300049574 | Bacteria | 4248 |
| 290 | Ga0501038_1283357 | 3300049574 | Bacteria | 529 |
| 291 | Ga0501039_0007399 | 3300049575 | Bacteria | 8373 |
| 292 | Ga0501039_0034951 | 3300049575 | Bacteria | 3879 |
| 293 | Ga0501040_0000558 | 3300049576 | Bacteria | 22531 |
| 294 | Ga0501040_0207183 | 3300049576 | Bacteria | 1393 |
| 295 | Ga0501040_0230961 | 3300049576 | Bacteria | 1317 |
| 296 | Ga0501040_0497059 | 3300049576 | Bacteria | 879 |
| 297 | Ga0501040_0726100 | 3300049576 | Bacteria | 718 |
| 298 | Ga0501041_0004106 | 3300049577 | Bacteria | 8417 |
| 299 | Ga0501041_0004732 | 3300049577 | Bacteria | 7902 |
| 300 | Ga0501042_0000539 | 3300049578 | Bacteria | 19836 |
| 301 | Ga0501042_0064185 | 3300049578 | Bacteria | 2624 |
| 302 | Ga0501042_0416224 | 3300049578 | Bacteria | 974 |
| 303 | Ga0501043_0002036 | 3300049579 | Bacteria | 17249 |
| 304 | Ga0501043_0018164 | 3300049579 | Bacteria | 5514 |
| 305 | Ga0501046_0014971 | 3300049580 | Bacteria | 6522 |
| 306 | Ga0501046_0364971 | 3300049580 | Bacteria | 1047 |
| 307 | Ga0501047_0035946 | 3300049581 | Bacteria | 4786 |
| 308 | Ga0501047_0614961 | 3300049581 | Bacteria | 907 |
| 309 | Ga0501048_0001536 | 3300049582 | Bacteria | 17521 |
| 310 | Ga0501048_0129156 | 3300049582 | Bacteria | 1787 |
| 311 | Ga0501068_0013181 | 3300049584 | Bacteria | 4700 |
| 312 | Ga0501068_0161843 | 3300049584 | Bacteria | 1411 |
| 313 | Ga0501069_0008434 | 3300049585 | Bacteria | 5418 |
| 314 | Ga0501069_0580950 | 3300049585 | Bacteria | 672 |
| 315 | Ga0501069_0624222 | 3300049585 | Bacteria | 648 |
| 316 | Ga0501070_0024678 | 3300049586 | Bacteria | 5042 |
| 317 | Ga0501070_0322611 | 3300049586 | Bacteria | 1256 |
| 318 | Ga0501070_0523382 | 3300049586 | Bacteria | 951 |
| 319 | Ga0501070_0710071 | 3300049586 | Bacteria | 795 |
| 320 | Ga0501071_0006354 | 3300049587 | Bacteria | 7663 |
| 321 | Ga0501071_0036918 | 3300049587 | Bacteria | 3486 |
| 322 | Ga0501071_0085550 | 3300049587 | Bacteria | 2312 |
| 323 | Ga0501071_0882476 | 3300049587 | Bacteria | 690 |
| 324 | Ga0501072_0000588 | 3300049588 | Bacteria | 26186 |
| 325 | Ga0501072_0056297 | 3300049588 | Bacteria | 3099 |
| 326 | Ga0501073_0071175 | 3300049589 | Bacteria | 2424 |
| 327 | Ga0501074_0300410 | 3300049590 | Bacteria | 1140 |
| 328 | Ga0501074_0460315 | 3300049590 | Bacteria | 901 |
| 329 | Ga0501074_1073979 | 3300049590 | Bacteria | 565 |
| 330 | Ga0501075_0000468 | 3300049591 | Bacteria | 24012 |
| 331 | Ga0501075_0002879 | 3300049591 | Bacteria | 11549 |
| 332 | Ga0501075_0069758 | 3300049591 | Bacteria | 2656 |
| 333 | Ga0501075_0272676 | 3300049591 | Bacteria | 1289 |
| 334 | Ga0501076_0004870 | 3300049592 | Bacteria | 9595 |
| 335 | Ga0501076_0027250 | 3300049592 | Bacteria | 4432 |
| 336 | Ga0501076_0075732 | 3300049592 | Bacteria | 2698 |
| 337 | Ga0501076_0710166 | 3300049592 | Bacteria | 830 |
| 338 | Ga0501076_0784928 | 3300049592 | Bacteria | 786 |
| 339 | Ga0501077_0017032 | 3300049593 | Bacteria | 4583 |
| 340 | Ga0501077_0052841 | 3300049593 | Bacteria | 2579 |
| 341 | Ga0501079_0003213 | 3300049741 | Bacteria | 11962 |
| 342 | Ga0501079_0003281 | 3300049741 | Bacteria | 11853 |
| 343 | Ga0501079_0165122 | 3300049741 | Bacteria | 1726 |
| 344 | Ga0501079_0166657 | 3300049741 | Bacteria | 1718 |
| 345 | Ga0501080_0027728 | 3300049742 | Bacteria | 5266 |
| 346 | Ga0501081_0015155 | 3300049743 | Bacteria | 5084 |
| 347 | Ga0501081_0015451 | 3300049743 | Bacteria | 5037 |
| 348 | Ga0501081_0160223 | 3300049743 | Bacteria | 1621 |
| 349 | Ga0501081_1112199 | 3300049743 | Bacteria | 598 |
| 350 | Ga0501083_0005130 | 3300049744 | Bacteria | 9270 |
| 351 | Ga0501083_0033891 | 3300049744 | Bacteria | 3494 |
| 352 | Ga0501083_0455234 | 3300049744 | Bacteria | 833 |
| 353 | Ga0501035_0008541 | 3300049822 | Bacteria | 9535 |
| 354 | Ga0501035_0079375 | 3300049822 | Bacteria | 2899 |
| 355 | Ga0501035_0751034 | 3300049822 | Bacteria | 783 |
| 356 | Ga0501035_1079263 | 3300049822 | Bacteria | 628 |
| 357 | Ga0501044_0018598 | 3300049823 | Bacteria | 7444 |
| 358 | Ga0501044_0113850 | 3300049823 | Bacteria | 2711 |
| 359 | Ga0501044_0217711 | 3300049823 | Bacteria | 1861 |
| 360 | Ga0501045_0001327 | 3300049824 | Bacteria | 16429 |
| 361 | Ga0501045_0390729 | 3300049824 | Bacteria | 1035 |
| 362 | Ga0501045_0827265 | 3300049824 | Bacteria | 681 |
| 363 | nmdc:mga03n38_177585_c1 | 3300050490 | Bacteria | 1089 |
| 364 | nmdc:mga03n38_25771_c1 | 3300050490 | Bacteria | 2420 |
| 365 | nmdc:mga0yw44_224371_c1 | 3300050492 | Bacteria | 1246 |
| 366 | nmdc:mga06z11_7755_c1 | 3300050494 | Bacteria | 4435 |
| 367 | nmdc:mga05p37_27209_c1 | 3300050507 | Bacteria | 6961 |
| 368 | nmdc:mga09592_443111_c1 | 3300050508 | Bacteria | 1121 |
| 369 | nmdc:mga0qj67_26830_c1 | 3300050509 | Bacteria | 4460 |
| 370 | nmdc:mga0qj67_294591_c1 | 3300050509 | Unclassified | 1315 |
| 371 | nmdc:mga06r32_12263_c1 | 3300050510 | Bacteria | 7729 |
| 372 | nmdc:mga06r32_7798_c1 | 3300050510 | Bacteria | 9622 |
| 373 | nmdc:mga08y16_1695790_c1 | 3300050511 | Bacteria | 587 |
| 374 | nmdc:mga0sz30_137063_c1 | 3300050516 | Bacteria | 1080 |
| 375 | nmdc:mga0sz30_387880_c1 | 3300050516 | Bacteria | 625 |
| 376 | Ga0500610_0010213 | 3300053079 | Bacteria | 4213 |
| 377 | Ga0500644_0104027 | 3300053088 | Bacteria | 1083 |
| 378 | Ga0500556_0005125 | 3300053104 | Bacteria | 3707 |
| 379 | Ga0500577_0174647 | 3300053142 | Bacteria | 920 |
| 380 | Ga0500588_0305105 | 3300053146 | Bacteria | 603 |
| 381 | Ga0501084_0001042 | 3300054114 | Bacteria | 21554 |
| 382 | Ga0501084_0341517 | 3300054114 | Bacteria | 1265 |
| 383 | Ga0501082_0002382 | 3300060353 | Bacteria | 16473 |
| 384 | Ga0501082_0047208 | 3300060353 | Bacteria | 3711 |
| 385 | Ga0501082_1327346 | 3300060353 | Bacteria | 628 |
| 386 | Ga0501082_1523051 | 3300060353 | Bacteria | 584 |
| 387 | Ga0466962_0036079 | 3300061719 | Bacteria | 2366 |
| 388 | Ga0530510_0000781 | 3300061734 | Bacteria | 20666 |
| 389 | Ga0530510_0050805 | 3300061734 | Bacteria | 2995 |
| 390 | Ga0530510_0600328 | 3300061734 | Bacteria | 837 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_101920781 | Ga0070683_1019207811 | 127 |
| 2 | 3300005331 | Ga0070670_100798696 | Ga0070670_1007986962 | 127 |
| 3 | 3300005356 | Ga0070674_100413023 | Ga0070674_1004130232 | 127 |
| 4 | 3300025937 | Ga0207669_10313297 | Ga0207669_103132972 | 127 |
| 5 | 3300026121 | Ga0207683_10770219 | Ga0207683_107702192 | 127 |
| 6 | 3300031727 | Ga0316576_10539302 | Ga0316576_105393022 | 127 |
| 7 | 3300031728 | Ga0316578_10028754 | Ga0316578_100287542 | 127 |
| 8 | 3300037853 | Ga0436364_1103776 | Ga0436364_1103776_1623_2021 | 127 |
| 9 | 3300039437 | Ga0436365_1490252 | Ga0436365_1490252_2239_2637 | 127 |
| 10 | 3300044684 | Ga0466966_0689414 | Ga0466966_0689414_106_504 | 127 |
| 11 | 3300044693 | Ga0466961_0114542 | Ga0466961_0114542_764_1162 | 127 |
| 12 | 3300044706 | Ga0466964_0068011 | Ga0466964_0068011_625_1023 | 127 |
| 13 | 3300044765 | Ga0466970_0367861 | Ga0466970_0367861_256_654 | 127 |
| 14 | 3300045049 | Ga0466959_0101223 | Ga0466959_0101223_766_1164 | 127 |
| 15 | 3300045049 | Ga0466959_0503552 | Ga0466959_0503552_315_713 | 127 |
| 16 | 3300045836 | Ga0466958_0300847 | Ga0466958_0300847_249_647 | 127 |
| 17 | 3300045976 | Ga0466967_0043547 | Ga0466967_0043547_2132_2530 | 127 |
| 18 | 3300045976 | Ga0466967_0097263 | Ga0466967_0097263_2055_2453 | 127 |
| 19 | 3300045976 | Ga0466967_0902029 | Ga0466967_0902029_224_613 | 127 |
| 20 | 3300045976 | Ga0466967_1311336 | Ga0466967_1311336_242_640 | 127 |
| 21 | 3300046680 | Ga0495646_0518046 | Ga0495646_0518046_189_587 | 127 |
| 22 | 3300048088 | Ga0495602_0647714 | Ga0495602_0647714_250_648 | 127 |
| 23 | 3300061719 | Ga0466962_0036079 | Ga0466962_0036079_1390_1788 | 127 |
| 24 | 3300000546 | LJNas_1002302 | LJNas_10023023 | 128 |
| 25 | 3300002070 | JGI24750J21931_1011578 | JGI24750J21931_10115781 | 128 |
| 26 | 3300002073 | JGI24745J21846_1002591 | JGI24745J21846_10025912 | 128 |
| 27 | 3300002074 | JGI24748J21848_1008594 | JGI24748J21848_10085943 | 128 |
| 28 | 3300002076 | JGI24749J21850_1004806 | JGI24749J21850_10048063 | 128 |
| 29 | 3300002077 | JGI24744J21845_10001651 | JGI24744J21845_100016515 | 128 |
| 30 | 3300002239 | JGI24034J26672_10002268 | JGI24034J26672_100022682 | 128 |
| 31 | 3300002244 | JGI24742J22300_10000635 | JGI24742J22300_100006354 | 128 |
| 32 | 3300005328 | Ga0070676_10186063 | Ga0070676_101860632 | 128 |
| 33 | 3300005330 | Ga0070690_100025092 | Ga0070690_1000250922 | 128 |
| 34 | 3300005335 | Ga0070666_10005391 | Ga0070666_100053916 | 128 |
| 35 | 3300005337 | Ga0070682_100195189 | Ga0070682_1001951892 | 128 |
| 36 | 3300005338 | Ga0068868_100001185 | Ga0068868_1000011857 | 128 |
| 37 | 3300005340 | Ga0070689_100041787 | Ga0070689_1000417874 | 128 |
| 38 | 3300005341 | Ga0070691_10005929 | Ga0070691_100059292 | 128 |
| 39 | 3300005343 | Ga0070687_100023382 | Ga0070687_1000233822 | 128 |
| 40 | 3300005345 | Ga0070692_10125222 | Ga0070692_101252222 | 128 |
| 41 | 3300005347 | Ga0070668_100002593 | Ga0070668_1000025934 | 128 |
| 42 | 3300005347 | Ga0070668_100009122 | Ga0070668_1000091224 | 128 |
| 43 | 3300005353 | Ga0070669_100015542 | Ga0070669_1000155425 | 128 |
| 44 | 3300005355 | Ga0070671_100930847 | Ga0070671_1009308471 | 128 |
| 45 | 3300005356 | Ga0070674_100001050 | Ga0070674_10000105013 | 128 |
| 46 | 3300005367 | Ga0070667_100003670 | Ga0070667_1000036708 | 128 |
| 47 | 3300005367 | Ga0070667_100204701 | Ga0070667_1002047012 | 128 |
| 48 | 3300005406 | Ga0070703_10058176 | Ga0070703_100581762 | 128 |
| 49 | 3300005434 | Ga0070709_10117549 | Ga0070709_101175492 | 128 |
| 50 | 3300005434 | Ga0070709_10752339 | Ga0070709_107523391 | 128 |
| 51 | 3300005436 | Ga0070713_100212586 | Ga0070713_1002125862 | 128 |
| 52 | 3300005437 | Ga0070710_10001208 | Ga0070710_100012089 | 128 |
| 53 | 3300005438 | Ga0070701_10029540 | Ga0070701_100295402 | 128 |
| 54 | 3300005439 | Ga0070711_100002788 | Ga0070711_1000027885 | 128 |
| 55 | 3300005439 | Ga0070711_101322096 | Ga0070711_1013220961 | 128 |
| 56 | 3300005441 | Ga0070700_100014368 | Ga0070700_1000143684 | 128 |
| 57 | 3300005444 | Ga0070694_100014088 | Ga0070694_1000140884 | 128 |
| 58 | 3300005445 | Ga0070708_100218715 | Ga0070708_1002187152 | 128 |
| 59 | 3300005445 | Ga0070708_100406970 | Ga0070708_1004069702 | 128 |
| 60 | 3300005455 | Ga0070663_100011524 | Ga0070663_1000115244 | 128 |
| 61 | 3300005455 | Ga0070663_101226830 | Ga0070663_1012268301 | 128 |
| 62 | 3300005456 | Ga0070678_100003252 | Ga0070678_1000032527 | 128 |
| 63 | 3300005457 | Ga0070662_100031780 | Ga0070662_1000317804 | 128 |
| 64 | 3300005459 | Ga0068867_100001068 | Ga0068867_1000010686 | 128 |
| 65 | 3300005466 | Ga0070685_10110934 | Ga0070685_101109341 | 128 |
| 66 | 3300005467 | Ga0070706_100240706 | Ga0070706_1002407062 | 128 |
| 67 | 3300005468 | Ga0070707_100008936 | Ga0070707_1000089362 | 128 |
| 68 | 3300005468 | Ga0070707_100046532 | Ga0070707_1000465324 | 128 |
| 69 | 3300005468 | Ga0070707_100110892 | Ga0070707_1001108925 | 128 |
| 70 | 3300005468 | Ga0070707_100205287 | Ga0070707_1002052872 | 128 |
| 71 | 3300005471 | Ga0070698_100022018 | Ga0070698_1000220185 | 128 |
| 72 | 3300005536 | Ga0070697_100449868 | Ga0070697_1004498682 | 128 |
| 73 | 3300005539 | Ga0068853_100013240 | Ga0068853_1000132405 | 128 |
| 74 | 3300005543 | Ga0070672_100066376 | Ga0070672_1000663764 | 128 |
| 75 | 3300005544 | Ga0070686_100006961 | Ga0070686_1000069612 | 128 |
| 76 | 3300005546 | Ga0070696_100003466 | Ga0070696_1000034664 | 128 |
| 77 | 3300005548 | Ga0070665_100034020 | Ga0070665_1000340203 | 128 |
| 78 | 3300005548 | Ga0070665_100867079 | Ga0070665_1008670792 | 128 |
| 79 | 3300005549 | Ga0070704_100000313 | Ga0070704_10000031320 | 128 |
| 80 | 3300005563 | Ga0068855_100036881 | Ga0068855_1000368813 | 128 |
| 81 | 3300005563 | Ga0068855_100196849 | Ga0068855_1001968493 | 128 |
| 82 | 3300005578 | Ga0068854_100003099 | Ga0068854_1000030994 | 128 |
| 83 | 3300005614 | Ga0068856_100159699 | Ga0068856_1001596993 | 128 |
| 84 | 3300005615 | Ga0070702_100141886 | Ga0070702_1001418861 | 128 |
| 85 | 3300005617 | Ga0068859_100022306 | Ga0068859_1000223064 | 128 |
| 86 | 3300005718 | Ga0068866_10000158 | Ga0068866_1000015821 | 128 |
| 87 | 3300005719 | Ga0068861_100001564 | Ga0068861_10000156410 | 128 |
| 88 | 3300005841 | Ga0068863_100151731 | Ga0068863_1001517312 | 128 |
| 89 | 3300005842 | Ga0068858_100077626 | Ga0068858_1000776264 | 128 |
| 90 | 3300005842 | Ga0068858_100188445 | Ga0068858_1001884452 | 128 |
| 91 | 3300005842 | Ga0068858_101027024 | Ga0068858_1010270242 | 128 |
| 92 | 3300005843 | Ga0068860_100002092 | Ga0068860_1000020926 | 128 |
| 93 | 3300005843 | Ga0068860_100510447 | Ga0068860_1005104472 | 128 |
| 94 | 3300005937 | Ga0081455_10083897 | Ga0081455_100838974 | 128 |
| 95 | 3300005981 | Ga0081538_10061445 | Ga0081538_100614452 | 128 |
| 96 | 3300006048 | Ga0075363_100026116 | Ga0075363_1000261162 | 128 |
| 97 | 3300006048 | Ga0075363_100118010 | Ga0075363_1001180102 | 128 |
| 98 | 3300006163 | Ga0070715_10344473 | Ga0070715_103444732 | 128 |
| 99 | 3300006173 | Ga0070716_100000832 | Ga0070716_10000083212 | 128 |
| 100 | 3300006173 | Ga0070716_100236136 | Ga0070716_1002361362 | 128 |
| 101 | 3300006173 | Ga0070716_101200905 | Ga0070716_1012009051 | 128 |
| 102 | 3300006175 | Ga0070712_100001192 | Ga0070712_10000119212 | 128 |
| 103 | 3300006178 | Ga0075367_10031652 | Ga0075367_100316523 | 128 |
| 104 | 3300006186 | Ga0075369_10110512 | Ga0075369_101105122 | 128 |
| 105 | 3300006186 | Ga0075369_10302328 | Ga0075369_103023282 | 128 |
| 106 | 3300006358 | Ga0068871_100350936 | Ga0068871_1003509362 | 128 |
| 107 | 3300006844 | Ga0075428_100004890 | Ga0075428_10000489012 | 128 |
| 108 | 3300006846 | Ga0075430_100007000 | Ga0075430_1000070009 | 128 |
| 109 | 3300006846 | Ga0075430_100214191 | Ga0075430_1002141912 | 128 |
| 110 | 3300006847 | Ga0075431_100000193 | Ga0075431_1000001935 | 128 |
| 111 | 3300006847 | Ga0075431_100017112 | Ga0075431_1000171125 | 128 |
| 112 | 3300006880 | Ga0075429_100412985 | Ga0075429_1004129852 | 128 |
| 113 | 3300006881 | Ga0068865_100002102 | Ga0068865_1000021027 | 128 |
| 114 | 3300006931 | Ga0097620_100022306 | Ga0097620_1000223064 | 128 |
| 115 | 3300009092 | Ga0105250_10186537 | Ga0105250_101865371 | 128 |
| 116 | 3300009093 | Ga0105240_10754908 | Ga0105240_107549082 | 128 |
| 117 | 3300009094 | Ga0111539_10889865 | Ga0111539_108898651 | 128 |
| 118 | 3300009098 | Ga0105245_10004552 | Ga0105245_100045524 | 128 |
| 119 | 3300009101 | Ga0105247_10000899 | Ga0105247_1000089910 | 128 |
| 120 | 3300009101 | Ga0105247_11098930 | Ga0105247_110989302 | 128 |
| 121 | 3300009147 | Ga0114129_10023791 | Ga0114129_100237918 | 128 |
| 122 | 3300009174 | Ga0105241_10090631 | Ga0105241_100906314 | 128 |
| 123 | 3300009174 | Ga0105241_11691981 | Ga0105241_116919811 | 128 |
| 124 | 3300009176 | Ga0105242_10000066 | Ga0105242_1000006621 | 128 |
| 125 | 3300009177 | Ga0105248_10019044 | Ga0105248_100190446 | 128 |
| 126 | 3300009177 | Ga0105248_10023924 | Ga0105248_100239246 | 128 |
| 127 | 3300009545 | Ga0105237_10002826 | Ga0105237_100028263 | 128 |
| 128 | 3300009551 | Ga0105238_10206665 | Ga0105238_102066652 | 128 |
| 129 | 3300009553 | Ga0105249_10002866 | Ga0105249_1000286619 | 128 |
| 130 | 3300009987 | Ga0105030_114586 | Ga0105030_1145861 | 128 |
| 131 | 3300010375 | Ga0105239_10107999 | Ga0105239_101079994 | 128 |
| 132 | 3300013102 | Ga0157371_11184888 | Ga0157371_111848881 | 128 |
| 133 | 3300013296 | Ga0157374_10479093 | Ga0157374_104790932 | 128 |
| 134 | 3300013297 | Ga0157378_10004830 | Ga0157378_1000483010 | 128 |
| 135 | 3300013297 | Ga0157378_10332362 | Ga0157378_103323622 | 128 |
| 136 | 3300013306 | Ga0163162_10005544 | Ga0163162_100055444 | 128 |
| 137 | 3300013307 | Ga0157372_10001039 | Ga0157372_100010397 | 128 |
| 138 | 3300013307 | Ga0157372_11480674 | Ga0157372_114806741 | 128 |
| 139 | 3300013308 | Ga0157375_10000268 | Ga0157375_1000026824 | 128 |
| 140 | 3300013308 | Ga0157375_10150124 | Ga0157375_101501243 | 128 |
| 141 | 3300014325 | Ga0163163_12489505 | Ga0163163_124895052 | 128 |
| 142 | 3300014326 | Ga0157380_10000036 | Ga0157380_1000003645 | 128 |
| 143 | 3300014745 | Ga0157377_10152000 | Ga0157377_101520002 | 128 |
| 144 | 3300014969 | Ga0157376_10461607 | Ga0157376_104616071 | 128 |
| 145 | 3300014969 | Ga0157376_10771508 | Ga0157376_107715081 | 128 |
| 146 | 3300020081 | Ga0206354_10518041 | Ga0206354_105180411 | 128 |
| 147 | 3300020082 | Ga0206353_10123647 | Ga0206353_101236472 | 128 |
| 148 | 3300020082 | Ga0206353_10631349 | Ga0206353_106313491 | 128 |
| 149 | 3300021377 | Ga0213874_10011696 | Ga0213874_100116962 | 128 |
| 150 | 3300021384 | Ga0213876_10370893 | Ga0213876_103708931 | 128 |
| 151 | 3300025711 | Ga0207696_1162217 | Ga0207696_11622172 | 128 |
| 152 | 3300025885 | Ga0207653_10108177 | Ga0207653_101081772 | 128 |
| 153 | 3300025898 | Ga0207692_10004107 | Ga0207692_100041073 | 128 |
| 154 | 3300025899 | Ga0207642_10003021 | Ga0207642_100030215 | 128 |
| 155 | 3300025900 | Ga0207710_10002938 | Ga0207710_100029383 | 128 |
| 156 | 3300025901 | Ga0207688_10000314 | Ga0207688_100003146 | 128 |
| 157 | 3300025905 | Ga0207685_10274171 | Ga0207685_102741712 | 128 |
| 158 | 3300025906 | Ga0207699_10104742 | Ga0207699_101047423 | 128 |
| 159 | 3300025907 | Ga0207645_10006251 | Ga0207645_100062516 | 128 |
| 160 | 3300025909 | Ga0207705_10579918 | Ga0207705_105799182 | 128 |
| 161 | 3300025910 | Ga0207684_10209232 | Ga0207684_102092323 | 128 |
| 162 | 3300025911 | Ga0207654_10212339 | Ga0207654_102123392 | 128 |
| 163 | 3300025913 | Ga0207695_10600139 | Ga0207695_106001391 | 128 |
| 164 | 3300025914 | Ga0207671_10007517 | Ga0207671_1000751710 | 128 |
| 165 | 3300025914 | Ga0207671_10161142 | Ga0207671_101611423 | 128 |
| 166 | 3300025915 | Ga0207693_10000224 | Ga0207693_1000022426 | 128 |
| 167 | 3300025915 | Ga0207693_10079887 | Ga0207693_100798872 | 128 |
| 168 | 3300025916 | Ga0207663_10012477 | Ga0207663_100124772 | 128 |
| 169 | 3300025918 | Ga0207662_10027613 | Ga0207662_100276132 | 128 |
| 170 | 3300025922 | Ga0207646_10012929 | Ga0207646_100129297 | 128 |
| 171 | 3300025922 | Ga0207646_10118762 | Ga0207646_101187623 | 128 |
| 172 | 3300025922 | Ga0207646_10166538 | Ga0207646_101665382 | 128 |
| 173 | 3300025922 | Ga0207646_10183374 | Ga0207646_101833742 | 128 |
| 174 | 3300025922 | Ga0207646_10361158 | Ga0207646_103611582 | 128 |
| 175 | 3300025923 | Ga0207681_10005775 | Ga0207681_100057755 | 128 |
| 176 | 3300025927 | Ga0207687_10003262 | Ga0207687_100032626 | 128 |
| 177 | 3300025928 | Ga0207700_10349751 | Ga0207700_103497511 | 128 |
| 178 | 3300025931 | Ga0207644_10692088 | Ga0207644_106920882 | 128 |
| 179 | 3300025932 | Ga0207690_11087959 | Ga0207690_110879591 | 128 |
| 180 | 3300025933 | Ga0207706_10000288 | Ga0207706_1000028819 | 128 |
| 181 | 3300025934 | Ga0207686_10002590 | Ga0207686_100025905 | 128 |
| 182 | 3300025935 | Ga0207709_10010164 | Ga0207709_100101645 | 128 |
| 183 | 3300025936 | Ga0207670_10820005 | Ga0207670_108200052 | 128 |
| 184 | 3300025937 | Ga0207669_10000644 | Ga0207669_100006448 | 128 |
| 185 | 3300025938 | Ga0207704_10000083 | Ga0207704_1000008342 | 128 |
| 186 | 3300025939 | Ga0207665_10000513 | Ga0207665_1000051310 | 128 |
| 187 | 3300025939 | Ga0207665_10078488 | Ga0207665_100784883 | 128 |
| 188 | 3300025940 | Ga0207691_10100383 | Ga0207691_101003833 | 128 |
| 189 | 3300025941 | Ga0207711_10046018 | Ga0207711_100460182 | 128 |
| 190 | 3300025941 | Ga0207711_10374419 | Ga0207711_103744192 | 128 |
| 191 | 3300025942 | Ga0207689_10217562 | Ga0207689_102175622 | 128 |
| 192 | 3300025961 | Ga0207712_10003359 | Ga0207712_100033596 | 128 |
| 193 | 3300025972 | Ga0207668_10001110 | Ga0207668_100011106 | 128 |
| 194 | 3300025972 | Ga0207668_10004363 | Ga0207668_100043635 | 128 |
| 195 | 3300025981 | Ga0207640_10001883 | Ga0207640_100018835 | 128 |
| 196 | 3300025986 | Ga0207658_10025584 | Ga0207658_100255843 | 128 |
| 197 | 3300025986 | Ga0207658_10276191 | Ga0207658_102761912 | 128 |
| 198 | 3300026023 | Ga0207677_10003217 | Ga0207677_100032175 | 128 |
| 199 | 3300026035 | Ga0207703_10019047 | Ga0207703_100190475 | 128 |
| 200 | 3300026041 | Ga0207639_10013122 | Ga0207639_100131225 | 128 |
| 201 | 3300026067 | Ga0207678_10037920 | Ga0207678_100379202 | 128 |
| 202 | 3300026075 | Ga0207708_10001720 | Ga0207708_100017204 | 128 |
| 203 | 3300026078 | Ga0207702_10087711 | Ga0207702_100877113 | 128 |
| 204 | 3300026078 | Ga0207702_11692685 | Ga0207702_116926851 | 128 |
| 205 | 3300026089 | Ga0207648_10001622 | Ga0207648_1000162223 | 128 |
| 206 | 3300026089 | Ga0207648_10441348 | Ga0207648_104413482 | 128 |
| 207 | 3300026118 | Ga0207675_100000324 | Ga0207675_10000032431 | 128 |
| 208 | 3300026121 | Ga0207683_10000077 | Ga0207683_1000007754 | 128 |
| 209 | 3300026142 | Ga0207698_10037930 | Ga0207698_100379304 | 128 |
| 210 | 3300027671 | Ga0209588_1080181 | Ga0209588_10801811 | 128 |
| 211 | 3300028379 | Ga0268266_10059922 | Ga0268266_100599224 | 128 |
| 212 | 3300028380 | Ga0268265_10008356 | Ga0268265_100083565 | 128 |
| 213 | 3300028381 | Ga0268264_10021807 | Ga0268264_100218075 | 128 |
| 214 | 3300028381 | Ga0268264_10481154 | Ga0268264_104811542 | 128 |
| 215 | 3300035088 | Ga0373940_0314496 | Ga0373940_0314496_129_515 | 128 |
| 216 | 3300035114 | Ga0373939_0024573 | Ga0373939_0024573_289_675 | 128 |
| 217 | 3300035118 | Ga0373954_0054833 | Ga0373954_0054833_1008_1400 | 128 |
| 218 | 3300035207 | Ga0373942_0168519 | Ga0373942_0168519_102_488 | 128 |
| 219 | 3300035242 | Ga0373962_0320060 | Ga0373962_0320060_91_477 | 128 |
| 220 | 3300035398 | Ga0316574_0101357 | Ga0316574_0101357_1268_1663 | 128 |
| 221 | 3300035695 | Ga0373927_0234123 | Ga0373927_0234123_711_1103 | 128 |
| 222 | 3300036712 | Ga0316584_0067342 | Ga0316584_0067342_1863_2258 | 128 |
| 223 | 3300038735 | Ga0400485_18803 | Ga0400485_18803_587_1069 | 128 |
| 224 | 3300039437 | Ga0436365_0431317 | Ga0436365_0431317_60_449 | 128 |
| 225 | 3300039437 | Ga0436365_0662372 | Ga0436365_0662372_3786_4178 | 128 |
| 226 | 3300039450 | Ga0436363_1265155 | Ga0436363_1265155_65571_65963 | 128 |
| 227 | 3300039453 | Ga0436362_1146574 | Ga0436362_1146574_1201_1593 | 128 |
| 228 | 3300041451 | Ga0451791_1889493 | Ga0451791_1889493_222_608 | 128 |
| 229 | 3300041459 | Ga0451800_0083973 | Ga0451800_0083973_109_498 | 128 |
| 230 | 3300042003 | Ga0439443_047414 | Ga0439443_047414_47_439 | 128 |
| 231 | 3300042005 | Ga0439448_0278800 | Ga0439448_0278800_67_453 | 128 |
| 232 | 3300044693 | Ga0466961_0113864 | Ga0466961_0113864_793_1200 | 128 |
| 233 | 3300044694 | Ga0466963_1078422 | Ga0466963_1078422_132_521 | 128 |
| 234 | 3300044901 | Ga0466960_0650338 | Ga0466960_0650338_69_461 | 128 |
| 235 | 3300045836 | Ga0466958_0396363 | Ga0466958_0396363_424_816 | 128 |
| 236 | 3300045976 | Ga0466967_0005898 | Ga0466967_0005898_5815_6204 | 128 |
| 237 | 3300046506 | Ga0495583_0091316 | Ga0495583_0091316_400_786 | 128 |
| 238 | 3300046507 | Ga0495606_0040587 | Ga0495606_0040587_324_710 | 128 |
| 239 | 3300046524 | Ga0495648_0006622 | Ga0495648_0006622_6684_7070 | 128 |
| 240 | 3300046530 | Ga0495654_0023897 | Ga0495654_0023897_1683_2069 | 128 |
| 241 | 3300046648 | Ga0495611_0070786 | Ga0495611_0070786_396_782 | 128 |
| 242 | 3300046660 | Ga0495625_0308276 | Ga0495625_0308276_559_945 | 128 |
| 243 | 3300046663 | Ga0495635_0069721 | Ga0495635_0069721_1257_1643 | 128 |
| 244 | 3300046681 | Ga0495647_0060465 | Ga0495647_0060465_716_1108 | 128 |
| 245 | 3300046683 | Ga0495658_0153602 | Ga0495658_0153602_619_1011 | 128 |
| 246 | 3300046694 | Ga0495649_0265055 | Ga0495649_0265055_304_690 | 128 |
| 247 | 3300047315 | Ga0495581_0544124 | Ga0495581_0544124_54_446 | 128 |
| 248 | 3300047319 | Ga0495674_0331276 | Ga0495674_0331276_760_1152 | 128 |
| 249 | 3300047320 | Ga0495672_0003170 | Ga0495672_0003170_11371_11757 | 128 |
| 250 | 3300047469 | Ga0495673_0005474 | Ga0495673_0005474_511_897 | 128 |
| 251 | 3300048089 | Ga0495614_0090889 | Ga0495614_0090889_860_1252 | 128 |
| 252 | 3300048091 | Ga0495626_0017832 | Ga0495626_0017832_2696_3082 | 128 |
| 253 | 3300048903 | Ga0496100_0001517 | Ga0496100_0001517_9506_9892 | 128 |
| 254 | 3300048903 | Ga0496100_0004555 | Ga0496100_0004555_3783_4175 | 128 |
| 255 | 3300048904 | Ga0496101_0000176 | Ga0496101_0000176_40813_41205 | 128 |
| 256 | 3300048904 | Ga0496101_0002224 | Ga0496101_0002224_4367_4753 | 128 |
| 257 | 3300048905 | Ga0496102_0000915 | Ga0496102_0000915_22718_23104 | 128 |
| 258 | 3300048905 | Ga0496102_0027557 | Ga0496102_0027557_4531_4923 | 128 |
| 259 | 3300048906 | Ga0496103_0003103 | Ga0496103_0003103_6576_6962 | 128 |
| 260 | 3300048906 | Ga0496103_0397594 | Ga0496103_0397594_160_552 | 128 |
| 261 | 3300048907 | Ga0496104_0003864 | Ga0496104_0003864_3642_4034 | 128 |
| 262 | 3300048908 | Ga0496105_0032092 | Ga0496105_0032092_2357_2749 | 128 |
| 263 | 3300048909 | Ga0496106_0000359 | Ga0496106_0000359_23114_23500 | 128 |
| 264 | 3300048909 | Ga0496106_0009115 | Ga0496106_0009115_2264_2656 | 128 |
| 265 | 3300048910 | Ga0496107_0045217 | Ga0496107_0045217_1616_2002 | 128 |
| 266 | 3300048912 | Ga0496109_0000697 | Ga0496109_0000697_22116_22508 | 128 |
| 267 | 3300048912 | Ga0496109_0646126 | Ga0496109_0646126_313_699 | 128 |
| 268 | 3300048912 | Ga0496109_0762154 | Ga0496109_0762154_63_449 | 128 |
| 269 | 3300048912 | Ga0496109_1398670 | Ga0496109_1398670_115_585 | 128 |
| 270 | 3300048915 | Ga0496112_1027097 | Ga0496112_1027097_284_670 | 128 |
| 271 | 3300048917 | Ga0496114_0001108 | Ga0496114_0001108_1407_1793 | 128 |
| 272 | 3300048917 | Ga0496114_0004574 | Ga0496114_0004574_6572_6964 | 128 |
| 273 | 3300048918 | Ga0496115_0000890 | Ga0496115_0000890_6624_7010 | 128 |
| 274 | 3300048918 | Ga0496115_0001243 | Ga0496115_0001243_6134_6526 | 128 |
| 275 | 3300049568 | Ga0501031_0010009 | Ga0501031_0010009_3907_4305 | 128 |
| 276 | 3300049568 | Ga0501031_0194238 | Ga0501031_0194238_788_1180 | 128 |
| 277 | 3300049568 | Ga0501031_1021150 | Ga0501031_1021150_32_442 | 128 |
| 278 | 3300049569 | Ga0501032_0039256 | Ga0501032_0039256_819_1217 | 128 |
| 279 | 3300049570 | Ga0501033_0036152 | Ga0501033_0036152_1887_2285 | 128 |
| 280 | 3300049570 | Ga0501033_0052993 | Ga0501033_0052993_1994_2404 | 128 |
| 281 | 3300049571 | Ga0501034_0101654 | Ga0501034_0101654_2376_2786 | 128 |
| 282 | 3300049572 | Ga0501036_0009272 | Ga0501036_0009272_4349_4747 | 128 |
| 283 | 3300049572 | Ga0501036_0196942 | Ga0501036_0196942_590_982 | 128 |
| 284 | 3300049572 | Ga0501036_0338287 | Ga0501036_0338287_54_446 | 128 |
| 285 | 3300049573 | Ga0501037_0017017 | Ga0501037_0017017_2906_3304 | 128 |
| 286 | 3300049573 | Ga0501037_0069038 | Ga0501037_0069038_1193_1603 | 128 |
| 287 | 3300049573 | Ga0501037_0455904 | Ga0501037_0455904_442_834 | 128 |
| 288 | 3300049573 | Ga0501037_0952486 | Ga0501037_0952486_29_424 | 128 |
| 289 | 3300049574 | Ga0501038_0005615 | Ga0501038_0005615_7699_8097 | 128 |
| 290 | 3300049574 | Ga0501038_0037524 | Ga0501038_0037524_188_598 | 128 |
| 291 | 3300049574 | Ga0501038_1283357 | Ga0501038_1283357_105_497 | 128 |
| 292 | 3300049575 | Ga0501039_0007399 | Ga0501039_0007399_7181_7579 | 128 |
| 293 | 3300049575 | Ga0501039_0034951 | Ga0501039_0034951_2187_2579 | 128 |
| 294 | 3300049576 | Ga0501040_0000558 | Ga0501040_0000558_21872_22270 | 128 |
| 295 | 3300049576 | Ga0501040_0207183 | Ga0501040_0207183_382_774 | 128 |
| 296 | 3300049576 | Ga0501040_0230961 | Ga0501040_0230961_579_971 | 128 |
| 297 | 3300049576 | Ga0501040_0497059 | Ga0501040_0497059_386_778 | 128 |
| 298 | 3300049576 | Ga0501040_0726100 | Ga0501040_0726100_195_587 | 128 |
| 299 | 3300049577 | Ga0501041_0004106 | Ga0501041_0004106_3918_4310 | 128 |
| 300 | 3300049577 | Ga0501041_0004732 | Ga0501041_0004732_3655_4053 | 128 |
| 301 | 3300049578 | Ga0501042_0000539 | Ga0501042_0000539_15350_15748 | 128 |
| 302 | 3300049578 | Ga0501042_0064185 | Ga0501042_0064185_2189_2581 | 128 |
| 303 | 3300049578 | Ga0501042_0416224 | Ga0501042_0416224_116_508 | 128 |
| 304 | 3300049579 | Ga0501043_0002036 | Ga0501043_0002036_15642_16040 | 128 |
| 305 | 3300049579 | Ga0501043_0018164 | Ga0501043_0018164_3332_3742 | 128 |
| 306 | 3300049580 | Ga0501046_0014971 | Ga0501046_0014971_691_1089 | 128 |
| 307 | 3300049580 | Ga0501046_0364971 | Ga0501046_0364971_97_489 | 128 |
| 308 | 3300049581 | Ga0501047_0035946 | Ga0501047_0035946_2375_2785 | 128 |
| 309 | 3300049581 | Ga0501047_0614961 | Ga0501047_0614961_368_766 | 128 |
| 310 | 3300049582 | Ga0501048_0001536 | Ga0501048_0001536_15837_16235 | 128 |
| 311 | 3300049582 | Ga0501048_0129156 | Ga0501048_0129156_86_478 | 128 |
| 312 | 3300049584 | Ga0501068_0013181 | Ga0501068_0013181_3099_3497 | 128 |
| 313 | 3300049584 | Ga0501068_0161843 | Ga0501068_0161843_723_1115 | 128 |
| 314 | 3300049585 | Ga0501069_0008434 | Ga0501069_0008434_854_1252 | 128 |
| 315 | 3300049585 | Ga0501069_0580950 | Ga0501069_0580950_32_424 | 128 |
| 316 | 3300049585 | Ga0501069_0624222 | Ga0501069_0624222_103_495 | 128 |
| 317 | 3300049586 | Ga0501070_0024678 | Ga0501070_0024678_3222_3632 | 128 |
| 318 | 3300049586 | Ga0501070_0322611 | Ga0501070_0322611_751_1161 | 128 |
| 319 | 3300049586 | Ga0501070_0523382 | Ga0501070_0523382_60_470 | 128 |
| 320 | 3300049586 | Ga0501070_0710071 | Ga0501070_0710071_276_668 | 128 |
| 321 | 3300049587 | Ga0501071_0006354 | Ga0501071_0006354_3693_4091 | 128 |
| 322 | 3300049587 | Ga0501071_0036918 | Ga0501071_0036918_100_492 | 128 |
| 323 | 3300049587 | Ga0501071_0085550 | Ga0501071_0085550_1902_2294 | 128 |
| 324 | 3300049587 | Ga0501071_0882476 | Ga0501071_0882476_261_653 | 128 |
| 325 | 3300049588 | Ga0501072_0000588 | Ga0501072_0000588_3676_4074 | 128 |
| 326 | 3300049588 | Ga0501072_0056297 | Ga0501072_0056297_1154_1546 | 128 |
| 327 | 3300049589 | Ga0501073_0071175 | Ga0501073_0071175_523_921 | 128 |
| 328 | 3300049590 | Ga0501074_0300410 | Ga0501074_0300410_183_575 | 128 |
| 329 | 3300049590 | Ga0501074_0460315 | Ga0501074_0460315_263_661 | 128 |
| 330 | 3300049590 | Ga0501074_1073979 | Ga0501074_1073979_62_454 | 128 |
| 331 | 3300049591 | Ga0501075_0000468 | Ga0501075_0000468_14494_14892 | 128 |
| 332 | 3300049591 | Ga0501075_0002879 | Ga0501075_0002879_1698_2090 | 128 |
| 333 | 3300049591 | Ga0501075_0069758 | Ga0501075_0069758_618_1010 | 128 |
| 334 | 3300049591 | Ga0501075_0272676 | Ga0501075_0272676_475_867 | 128 |
| 335 | 3300049592 | Ga0501076_0004870 | Ga0501076_0004870_1835_2233 | 128 |
| 336 | 3300049592 | Ga0501076_0027250 | Ga0501076_0027250_2106_2498 | 128 |
| 337 | 3300049592 | Ga0501076_0075732 | Ga0501076_0075732_995_1387 | 128 |
| 338 | 3300049592 | Ga0501076_0710166 | Ga0501076_0710166_283_675 | 128 |
| 339 | 3300049592 | Ga0501076_0784928 | Ga0501076_0784928_133_525 | 128 |
| 340 | 3300049593 | Ga0501077_0017032 | Ga0501077_0017032_550_942 | 128 |
| 341 | 3300049593 | Ga0501077_0052841 | Ga0501077_0052841_863_1261 | 128 |
| 342 | 3300049741 | Ga0501079_0003213 | Ga0501079_0003213_7598_7996 | 128 |
| 343 | 3300049741 | Ga0501079_0003281 | Ga0501079_0003281_9502_9894 | 128 |
| 344 | 3300049741 | Ga0501079_0165122 | Ga0501079_0165122_946_1338 | 128 |
| 345 | 3300049741 | Ga0501079_0166657 | Ga0501079_0166657_618_1010 | 128 |
| 346 | 3300049742 | Ga0501080_0027728 | Ga0501080_0027728_2920_3318 | 128 |
| 347 | 3300049743 | Ga0501081_0015155 | Ga0501081_0015155_1639_2037 | 128 |
| 348 | 3300049743 | Ga0501081_0015451 | Ga0501081_0015451_2711_3103 | 128 |
| 349 | 3300049743 | Ga0501081_0160223 | Ga0501081_0160223_455_847 | 128 |
| 350 | 3300049743 | Ga0501081_1112199 | Ga0501081_1112199_171_581 | 128 |
| 351 | 3300049744 | Ga0501083_0005130 | Ga0501083_0005130_1627_2022 | 128 |
| 352 | 3300049744 | Ga0501083_0033891 | Ga0501083_0033891_262_660 | 128 |
| 353 | 3300049744 | Ga0501083_0455234 | Ga0501083_0455234_167_559 | 128 |
| 354 | 3300049822 | Ga0501035_0008541 | Ga0501035_0008541_304_714 | 128 |
| 355 | 3300049822 | Ga0501035_0079375 | Ga0501035_0079375_735_1133 | 128 |
| 356 | 3300049822 | Ga0501035_0751034 | Ga0501035_0751034_28_420 | 128 |
| 357 | 3300049822 | Ga0501035_1079263 | Ga0501035_1079263_140_550 | 128 |
| 358 | 3300049823 | Ga0501044_0018598 | Ga0501044_0018598_2160_2570 | 128 |
| 359 | 3300049823 | Ga0501044_0113850 | Ga0501044_0113850_1698_2096 | 128 |
| 360 | 3300049823 | Ga0501044_0217711 | Ga0501044_0217711_256_666 | 128 |
| 361 | 3300049824 | Ga0501045_0001327 | Ga0501045_0001327_1127_1525 | 128 |
| 362 | 3300049824 | Ga0501045_0390729 | Ga0501045_0390729_602_994 | 128 |
| 363 | 3300049824 | Ga0501045_0827265 | Ga0501045_0827265_175_567 | 128 |
| 364 | 3300050490 | nmdc:mga03n38_177585_c1 | nmdc:mga03n38_177585_c1_424_816 | 128 |
| 365 | 3300050490 | nmdc:mga03n38_25771_c1 | nmdc:mga03n38_25771_c1_1368_1760 | 128 |
| 366 | 3300050492 | nmdc:mga0yw44_224371_c1 | nmdc:mga0yw44_224371_c1_437_829 | 128 |
| 367 | 3300050494 | nmdc:mga06z11_7755_c1 | nmdc:mga06z11_7755_c1_1368_1760 | 128 |
| 368 | 3300050507 | nmdc:mga05p37_27209_c1 | nmdc:mga05p37_27209_c1_4085_4471 | 128 |
| 369 | 3300050508 | nmdc:mga09592_443111_c1 | nmdc:mga09592_443111_c1_67_459 | 128 |
| 370 | 3300050509 | nmdc:mga0qj67_26830_c1 | nmdc:mga0qj67_26830_c1_943_1329 | 128 |
| 371 | 3300050509 | nmdc:mga0qj67_294591_c1 | nmdc:mga0qj67_294591_c1_295_687 | 128 |
| 372 | 3300050510 | nmdc:mga06r32_12263_c1 | nmdc:mga06r32_12263_c1_3345_3731 | 128 |
| 373 | 3300050510 | nmdc:mga06r32_7798_c1 | nmdc:mga06r32_7798_c1_8221_8613 | 128 |
| 374 | 3300050511 | nmdc:mga08y16_1695790_c1 | nmdc:mga08y16_1695790_c1_50_436 | 128 |
| 375 | 3300050516 | nmdc:mga0sz30_137063_c1 | nmdc:mga0sz30_137063_c1_170_556 | 128 |
| 376 | 3300050516 | nmdc:mga0sz30_387880_c1 | nmdc:mga0sz30_387880_c1_111_497 | 128 |
| 377 | 3300053079 | Ga0500610_0010213 | Ga0500610_0010213_2216_2602 | 128 |
| 378 | 3300053088 | Ga0500644_0104027 | Ga0500644_0104027_497_883 | 128 |
| 379 | 3300053104 | Ga0500556_0005125 | Ga0500556_0005125_2312_2761 | 128 |
| 380 | 3300053142 | Ga0500577_0174647 | Ga0500577_0174647_402_851 | 128 |
| 381 | 3300053146 | Ga0500588_0305105 | Ga0500588_0305105_158_574 | 128 |
| 382 | 3300054114 | Ga0501084_0001042 | Ga0501084_0001042_17190_17588 | 128 |
| 383 | 3300054114 | Ga0501084_0341517 | Ga0501084_0341517_748_1140 | 128 |
| 384 | 3300060353 | Ga0501082_0002382 | Ga0501082_0002382_725_1123 | 128 |
| 385 | 3300060353 | Ga0501082_0047208 | Ga0501082_0047208_730_1122 | 128 |
| 386 | 3300060353 | Ga0501082_1327346 | Ga0501082_1327346_148_540 | 128 |
| 387 | 3300060353 | Ga0501082_1523051 | Ga0501082_1523051_28_423 | 128 |
| 388 | 3300061734 | Ga0530510_0000781 | Ga0530510_0000781_14619_15017 | 128 |
| 389 | 3300061734 | Ga0530510_0050805 | Ga0530510_0050805_152_544 | 128 |
| 390 | 3300061734 | Ga0530510_0600328 | Ga0530510_0600328_100_492 | 128 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ush-assembly1.cif.gz_A | crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 | 0.8926 | 4 | 120 |
| 3ush-assembly1.cif.gz_A | crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 | 0.8784 | 4 | 120 |
| 4ioh-assembly1.cif.gz_A-2 | crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 | 0.7763 | 1 | 120 |
| 4ioh-assembly1.cif.gz_A-2 | crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 | 0.7703 | 1 | 120 |
| 3j6b-assembly1.cif.gz_G | structure of the yeast mitochondrial large ribosomal subunit | 0.5965 | 31 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ushA00 | Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 | 0.8799 | 4 | 120 | 3.30.56.110 |
| 3ushA00 | Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 | 0.8655 | 4 | 120 | 3.30.56.110 |
| 4iohA00 | Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 | 0.7961 | 5 | 120 | 3.30.56.110 |
| 4iohA00 | Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 | 0.7772 | 5 | 120 | 3.30.56.110 |
| 2lq3A01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.6538 | 47 | 120 | 1.10.1660.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S1YR09-F1-model_v4 | deleted | 1.006 | 70 | 120 |
|
| AF-A0A383B302-F1-model_v4 | DUF2237 domain-containing protein | 1.004 | 44 | 112 |
|
| AF-A0A353DFF3-F1-model_v4 | DUF2237 domain-containing protein | 1.002 | 48 | 119 |
|
| AF-A0A7C3R3I1-F1-model_v4 | DUF2237 family protein | 1.001 | 54 | 119 |
|
| AF-Q0FK62-F1-model_v4 | DUF2237 domain-containing protein | 1 | 47 | 119 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar