F431635

General Info

Members Datasets Scaffolds Average Seq Length
390 260 390 130

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100798696|Ga0070670_1007986962
Length 135
Sequence VGHTWLVTDELNVLGGALQTCGTDPLTGFYRDGCCTSGPQQAVHLICVVATAEFLEHQRSVGNDLSTPHPEWQFPGLHPGDRWCVVTARWLQAHDDGVAAPVVLAATSERALELIPLDVLREHSVDVPDDPGMLT

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
252 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
256 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.1
Nodule 0
Rhizoplane 6.15
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002302 3300000546 Bacteria 2349
2 JGI24750J21931_1011578 3300002070 Bacteria 1161
3 JGI24745J21846_1002591 3300002073 Bacteria 1853
4 JGI24748J21848_1008594 3300002074 Bacteria 1201
5 JGI24749J21850_1004806 3300002076 Bacteria 1893
6 JGI24744J21845_10001651 3300002077 Bacteria 4465
7 JGI24034J26672_10002268 3300002239 Bacteria 2630
8 JGI24742J22300_10000635 3300002244 Bacteria 5277
9 Ga0070676_10186063 3300005328 Bacteria 1353
10 Ga0070683_101920781 3300005329 Bacteria 569
11 Ga0070690_100025092 3300005330 Bacteria 3670
12 Ga0070670_100798696 3300005331 Bacteria 852
13 Ga0070666_10005391 3300005335 Bacteria 7840
14 Ga0070682_100195189 3300005337 Bacteria 1424
15 Ga0068868_100001185 3300005338 Bacteria 17864
16 Ga0070689_100041787 3300005340 Bacteria 3520
17 Ga0070691_10005929 3300005341 Bacteria 5574
18 Ga0070687_100023382 3300005343 Bacteria 2937
19 Ga0070692_10125222 3300005345 Bacteria 1438
20 Ga0070668_100002593 3300005347 Bacteria 13283
21 Ga0070668_100009122 3300005347 Bacteria 7363
22 Ga0070669_100015542 3300005353 Bacteria 5426
23 Ga0070671_100930847 3300005355 Bacteria 760
24 Ga0070674_100001050 3300005356 Bacteria 14454
25 Ga0070674_100413023 3300005356 Bacteria 1105
26 Ga0070667_100003670 3300005367 Bacteria 13070
27 Ga0070667_100204701 3300005367 Bacteria 1752
28 Ga0070703_10058176 3300005406 Bacteria 1257
29 Ga0070709_10117549 3300005434 Bacteria 1797
30 Ga0070709_10752339 3300005434 Unclassified 762
31 Ga0070713_100212586 3300005436 Bacteria 1751
32 Ga0070710_10001208 3300005437 Bacteria 12231
33 Ga0070701_10029540 3300005438 Bacteria 2705
34 Ga0070711_100002788 3300005439 Bacteria 10019
35 Ga0070711_101322096 3300005439 Unclassified 626
36 Ga0070700_100014368 3300005441 Bacteria 4469
37 Ga0070694_100014088 3300005444 Bacteria 5004
38 Ga0070708_100218715 3300005445 Bacteria 1786
39 Ga0070708_100406970 3300005445 Bacteria 1283
40 Ga0070663_100011524 3300005455 Bacteria 5556
41 Ga0070663_101226830 3300005455 Bacteria 660
42 Ga0070678_100003252 3300005456 Bacteria 9026
43 Ga0070662_100031780 3300005457 Bacteria 3708
44 Ga0068867_100001068 3300005459 Bacteria 18704
45 Ga0070685_10110934 3300005466 Bacteria 1689
46 Ga0070706_100240706 3300005467 Bacteria 1690
47 Ga0070707_100008936 3300005468 Bacteria 9295
48 Ga0070707_100046532 3300005468 Bacteria 4152
49 Ga0070707_100110892 3300005468 Bacteria 2661
50 Ga0070707_100205287 3300005468 Bacteria 1920
51 Ga0070698_100022018 3300005471 Bacteria 6674
52 Ga0070697_100449868 3300005536 Bacteria 1122
53 Ga0068853_100013240 3300005539 Bacteria 6732
54 Ga0070672_100066376 3300005543 Bacteria 2857
55 Ga0070686_100006961 3300005544 Bacteria 6303
56 Ga0070696_100003466 3300005546 Bacteria 10481
57 Ga0070665_100034020 3300005548 Bacteria 5125
58 Ga0070665_100867079 3300005548 Bacteria 916
59 Ga0070704_100000313 3300005549 Bacteria 21721
60 Ga0068855_100036881 3300005563 Bacteria 5816
61 Ga0068855_100196849 3300005563 Bacteria 2270
62 Ga0068854_100003099 3300005578 Bacteria 10349
63 Ga0068856_100159699 3300005614 Bacteria 2264
64 Ga0070702_100141886 3300005615 Bacteria 1531
65 Ga0068859_100022306 3300005617 Bacteria 6348
66 Ga0068866_10000158 3300005718 Bacteria 31180
67 Ga0068861_100001564 3300005719 Bacteria 14560
68 Ga0068863_100151731 3300005841 Bacteria 2217
69 Ga0068858_100077626 3300005842 Bacteria 3085
70 Ga0068858_100188445 3300005842 Bacteria 1949
71 Ga0068858_101027024 3300005842 Bacteria 808
72 Ga0068860_100002092 3300005843 Bacteria 21025
73 Ga0068860_100510447 3300005843 Bacteria 1201
74 Ga0081455_10083897 3300005937 Bacteria 2602
75 Ga0081538_10061445 3300005981 Bacteria 2150
76 Ga0075363_100026116 3300006048 Bacteria 2986
77 Ga0075363_100118010 3300006048 Bacteria 1479
78 Ga0070715_10344473 3300006163 Bacteria 812
79 Ga0070716_100000832 3300006173 Bacteria 13314
80 Ga0070716_100236136 3300006173 Bacteria 1237
81 Ga0070716_101200905 3300006173 Bacteria 609
82 Ga0070712_100001192 3300006175 Bacteria 15718
83 Ga0075367_10031652 3300006178 Bacteria 3039
84 Ga0075369_10110512 3300006186 Bacteria 1238
85 Ga0075369_10302328 3300006186 Bacteria 747
86 Ga0068871_100350936 3300006358 Bacteria 1305
87 Ga0075428_100004890 3300006844 Bacteria 14877
88 Ga0075430_100007000 3300006846 Bacteria 9507
89 Ga0075430_100214191 3300006846 Bacteria 1598
90 Ga0075431_100000193 3300006847 Bacteria 44515
91 Ga0075431_100017112 3300006847 Bacteria 7368
92 Ga0075429_100412985 3300006880 Bacteria 1182
93 Ga0068865_100002102 3300006881 Bacteria 11759
94 Ga0097620_100022306 3300006931 Bacteria 6348
95 Ga0105250_10186537 3300009092 Bacteria 871
96 Ga0105240_10754908 3300009093 Bacteria 1057
97 Ga0111539_10889865 3300009094 Bacteria 1036
98 Ga0105245_10004552 3300009098 Bacteria 12237
99 Ga0105247_10000899 3300009101 Bacteria 22371
100 Ga0105247_11098930 3300009101 Bacteria 627
101 Ga0114129_10023791 3300009147 Bacteria 8684
102 Ga0105241_10090631 3300009174 Bacteria 2412
103 Ga0105241_11691981 3300009174 Bacteria 614
104 Ga0105242_10000066 3300009176 Bacteria 73865
105 Ga0105248_10019044 3300009177 Bacteria 7589
106 Ga0105248_10023924 3300009177 Bacteria 6790
107 Ga0105237_10002826 3300009545 Bacteria 21122
108 Ga0105238_10206665 3300009551 Bacteria 1940
109 Ga0105249_10002866 3300009553 Bacteria 14893
110 Ga0105030_114586 3300009987 Bacteria 692
111 Ga0105239_10107999 3300010375 Bacteria 3083
112 Ga0157371_11184888 3300013102 Bacteria 588
113 Ga0157374_10479093 3300013296 Bacteria 1248
114 Ga0157378_10004830 3300013297 Bacteria 11813
115 Ga0157378_10332362 3300013297 Bacteria 1479
116 Ga0163162_10005544 3300013306 Bacteria 12201
117 Ga0157372_10001039 3300013307 Bacteria 30364
118 Ga0157372_11480674 3300013307 Bacteria 782
119 Ga0157375_10000268 3300013308 Bacteria 47381
120 Ga0157375_10150124 3300013308 Bacteria 2465
121 Ga0163163_12489505 3300014325 Bacteria 576
122 Ga0157380_10000036 3300014326 Bacteria 81892
123 Ga0157377_10152000 3300014745 Bacteria 1432
124 Ga0157376_10461607 3300014969 Bacteria 1241
125 Ga0157376_10771508 3300014969 Bacteria 972
126 Ga0206354_10518041 3300020081 Bacteria 1360
127 Ga0206353_10123647 3300020082 Bacteria 1889
128 Ga0206353_10631349 3300020082 Bacteria 629
129 Ga0213874_10011696 3300021377 Bacteria 2231
130 Ga0213876_10370893 3300021384 Bacteria 761
131 Ga0207696_1162217 3300025711 Bacteria 594
132 Ga0207653_10108177 3300025885 Bacteria 990
133 Ga0207692_10004107 3300025898 Bacteria 5743
134 Ga0207642_10003021 3300025899 Bacteria 5275
135 Ga0207710_10002938 3300025900 Bacteria 7736
136 Ga0207688_10000314 3300025901 Bacteria 22302
137 Ga0207685_10274171 3300025905 Bacteria 825
138 Ga0207699_10104742 3300025906 Bacteria 1802
139 Ga0207645_10006251 3300025907 Bacteria 8558
140 Ga0207705_10579918 3300025909 Bacteria 872
141 Ga0207684_10209232 3300025910 Bacteria 1683
142 Ga0207654_10212339 3300025911 Bacteria 1279
143 Ga0207695_10600139 3300025913 Bacteria 982
144 Ga0207671_10007517 3300025914 Bacteria 9447
145 Ga0207671_10161142 3300025914 Bacteria 1737
146 Ga0207693_10000224 3300025915 Bacteria 51559
147 Ga0207693_10079887 3300025915 Bacteria 2560
148 Ga0207663_10012477 3300025916 Bacteria 4595
149 Ga0207662_10027613 3300025918 Bacteria 3276
150 Ga0207646_10012929 3300025922 Bacteria 8000
151 Ga0207646_10118762 3300025922 Bacteria 2375
152 Ga0207646_10166538 3300025922 Bacteria 1990
153 Ga0207646_10183374 3300025922 Bacteria 1890
154 Ga0207646_10361158 3300025922 Bacteria 1312
155 Ga0207681_10005775 3300025923 Bacteria 7590
156 Ga0207687_10003262 3300025927 Bacteria 10988
157 Ga0207700_10349751 3300025928 Bacteria 1287
158 Ga0207644_10692088 3300025931 Bacteria 850
159 Ga0207690_11087959 3300025932 Bacteria 666
160 Ga0207706_10000288 3300025933 Bacteria 54869
161 Ga0207686_10002590 3300025934 Bacteria 9813
162 Ga0207709_10010164 3300025935 Bacteria 5184
163 Ga0207670_10820005 3300025936 Bacteria 776
164 Ga0207669_10000644 3300025937 Bacteria 15101
165 Ga0207669_10313297 3300025937 Bacteria 1198
166 Ga0207704_10000083 3300025938 Bacteria 56018
167 Ga0207665_10000513 3300025939 Bacteria 26201
168 Ga0207665_10078488 3300025939 Bacteria 2268
169 Ga0207691_10100383 3300025940 Bacteria 2583
170 Ga0207711_10046018 3300025941 Bacteria 3728
171 Ga0207711_10374419 3300025941 Bacteria 1321
172 Ga0207689_10217562 3300025942 Bacteria 1578
173 Ga0207712_10003359 3300025961 Bacteria 10124
174 Ga0207668_10001110 3300025972 Bacteria 16019
175 Ga0207668_10004363 3300025972 Bacteria 8303
176 Ga0207640_10001883 3300025981 Bacteria 11252
177 Ga0207658_10025584 3300025986 Bacteria 4133
178 Ga0207658_10276191 3300025986 Bacteria 1438
179 Ga0207677_10003217 3300026023 Bacteria 8617
180 Ga0207703_10019047 3300026035 Bacteria 5361
181 Ga0207639_10013122 3300026041 Bacteria 5789
182 Ga0207678_10037920 3300026067 Bacteria 4190
183 Ga0207708_10001720 3300026075 Bacteria 16190
184 Ga0207702_10087711 3300026078 Bacteria 2717
185 Ga0207702_11692685 3300026078 Unclassified 625
186 Ga0207648_10001622 3300026089 Bacteria 24662
187 Ga0207648_10441348 3300026089 Bacteria 1184
188 Ga0207675_100000324 3300026118 Bacteria 45435
189 Ga0207683_10000077 3300026121 Bacteria 77710
190 Ga0207683_10770219 3300026121 Bacteria 893
191 Ga0207698_10037930 3300026142 Bacteria 3555
192 Ga0209588_1080181 3300027671 Bacteria 1054
193 Ga0268266_10059922 3300028379 Bacteria 3280
194 Ga0268265_10008356 3300028380 Bacteria 6990
195 Ga0268264_10021807 3300028381 Bacteria 5228
196 Ga0268264_10481154 3300028381 Bacteria 1208
197 Ga0316576_10539302 3300031727 Bacteria 856
198 Ga0316578_10028754 3300031728 Bacteria 3150
199 Ga0373940_0314496 3300035088 Bacteria 542
200 Ga0373939_0024573 3300035114 Bacteria 1680
201 Ga0373954_0054833 3300035118 Bacteria 1875
202 Ga0373942_0168519 3300035207 Bacteria 712
203 Ga0373962_0320060 3300035242 Bacteria 554
204 Ga0316574_0101357 3300035398 Bacteria 1843
205 Ga0373927_0234123 3300035695 Bacteria 1207
206 Ga0316584_0067342 3300036712 Bacteria 2684
207 Ga0436364_1103776 3300037853 Bacteria 4780
208 Ga0400485_18803 3300038735 Bacteria 1598
209 Ga0436365_0431317 3300039437 Bacteria 706
210 Ga0436365_0662372 3300039437 Bacteria 9045
211 Ga0436365_1490252 3300039437 Bacteria 3416
212 Ga0436363_1265155 3300039450 Bacteria 80087
213 Ga0436362_1146574 3300039453 Bacteria 3314
214 Ga0451791_1889493 3300041451 Bacteria 734
215 Ga0451800_0083973 3300041459 Bacteria 510
216 Ga0439443_047414 3300042003 Bacteria 745
217 Ga0439448_0278800 3300042005 Bacteria 592
218 Ga0466966_0689414 3300044684 Bacteria 616
219 Ga0466961_0113864 3300044693 Bacteria 1700
220 Ga0466961_0114542 3300044693 Bacteria 1695
221 Ga0466963_1078422 3300044694 Bacteria 565
222 Ga0466964_0068011 3300044706 Bacteria 1499
223 Ga0466970_0367861 3300044765 Bacteria 817
224 Ga0466960_0650338 3300044901 Bacteria 629
225 Ga0466959_0101223 3300045049 Bacteria 2062
226 Ga0466959_0503552 3300045049 Bacteria 818
227 Ga0466958_0300847 3300045836 Bacteria 1030
228 Ga0466958_0396363 3300045836 Bacteria 891
229 Ga0466967_0005898 3300045976 Bacteria 8584
230 Ga0466967_0043547 3300045976 Bacteria 3887
231 Ga0466967_0097263 3300045976 Bacteria 2687
232 Ga0466967_0902029 3300045976 Bacteria 879
233 Ga0466967_1311336 3300045976 Bacteria 721
234 Ga0495583_0091316 3300046506 Bacteria 1310
235 Ga0495606_0040587 3300046507 Bacteria 3127
236 Ga0495648_0006622 3300046524 Bacteria 9394
237 Ga0495654_0023897 3300046530 Bacteria 3162
238 Ga0495611_0070786 3300046648 Bacteria 1594
239 Ga0495625_0308276 3300046660 Bacteria 1011
240 Ga0495635_0069721 3300046663 Bacteria 2410
241 Ga0495646_0518046 3300046680 Bacteria 611
242 Ga0495647_0060465 3300046681 Bacteria 1494
243 Ga0495658_0153602 3300046683 Bacteria 1415
244 Ga0495649_0265055 3300046694 Bacteria 880
245 Ga0495581_0544124 3300047315 Bacteria 674
246 Ga0495674_0331276 3300047319 Bacteria 1239
247 Ga0495672_0003170 3300047320 Bacteria 14300
248 Ga0495673_0005474 3300047469 Bacteria 7667
249 Ga0495602_0647714 3300048088 Bacteria 722
250 Ga0495614_0090889 3300048089 Bacteria 1328
251 Ga0495626_0017832 3300048091 Bacteria 3580
252 Ga0496100_0001517 3300048903 Bacteria 11373
253 Ga0496100_0004555 3300048903 Bacteria 7365
254 Ga0496101_0000176 3300048904 Bacteria 51135
255 Ga0496101_0002224 3300048904 Bacteria 11852
256 Ga0496102_0000915 3300048905 Bacteria 27833
257 Ga0496102_0027557 3300048905 Bacteria 5074
258 Ga0496103_0003103 3300048906 Bacteria 10213
259 Ga0496103_0397594 3300048906 Bacteria 885
260 Ga0496104_0003864 3300048907 Bacteria 12961
261 Ga0496105_0032092 3300048908 Bacteria 4308
262 Ga0496106_0000359 3300048909 Bacteria 32347
263 Ga0496106_0009115 3300048909 Bacteria 7332
264 Ga0496107_0045217 3300048910 Bacteria 3166
265 Ga0496109_0000697 3300048912 Bacteria 27916
266 Ga0496109_0646126 3300048912 Bacteria 995
267 Ga0496109_0762154 3300048912 Bacteria 906
268 Ga0496109_1398670 3300048912 Unclassified 635
269 Ga0496112_1027097 3300048915 Bacteria 744
270 Ga0496114_0001108 3300048917 Bacteria 20364
271 Ga0496114_0004574 3300048917 Bacteria 10745
272 Ga0496115_0000890 3300048918 Bacteria 21666
273 Ga0496115_0001243 3300048918 Bacteria 18283
274 Ga0501031_0010009 3300049568 Bacteria 6176
275 Ga0501031_0194238 3300049568 Bacteria 1325
276 Ga0501031_1021150 3300049568 Bacteria 528
277 Ga0501032_0039256 3300049569 Bacteria 3221
278 Ga0501033_0036152 3300049570 Bacteria 3702
279 Ga0501033_0052993 3300049570 Bacteria 3006
280 Ga0501034_0101654 3300049571 Bacteria 2868
281 Ga0501036_0009272 3300049572 Bacteria 8089
282 Ga0501036_0196942 3300049572 Bacteria 1695
283 Ga0501036_0338287 3300049572 Bacteria 1257
284 Ga0501037_0017017 3300049573 Bacteria 5349
285 Ga0501037_0069038 3300049573 Bacteria 2573
286 Ga0501037_0455904 3300049573 Bacteria 872
287 Ga0501037_0952486 3300049573 Bacteria 561
288 Ga0501038_0005615 3300049574 Bacteria 11641
289 Ga0501038_0037524 3300049574 Bacteria 4248
290 Ga0501038_1283357 3300049574 Bacteria 529
291 Ga0501039_0007399 3300049575 Bacteria 8373
292 Ga0501039_0034951 3300049575 Bacteria 3879
293 Ga0501040_0000558 3300049576 Bacteria 22531
294 Ga0501040_0207183 3300049576 Bacteria 1393
295 Ga0501040_0230961 3300049576 Bacteria 1317
296 Ga0501040_0497059 3300049576 Bacteria 879
297 Ga0501040_0726100 3300049576 Bacteria 718
298 Ga0501041_0004106 3300049577 Bacteria 8417
299 Ga0501041_0004732 3300049577 Bacteria 7902
300 Ga0501042_0000539 3300049578 Bacteria 19836
301 Ga0501042_0064185 3300049578 Bacteria 2624
302 Ga0501042_0416224 3300049578 Bacteria 974
303 Ga0501043_0002036 3300049579 Bacteria 17249
304 Ga0501043_0018164 3300049579 Bacteria 5514
305 Ga0501046_0014971 3300049580 Bacteria 6522
306 Ga0501046_0364971 3300049580 Bacteria 1047
307 Ga0501047_0035946 3300049581 Bacteria 4786
308 Ga0501047_0614961 3300049581 Bacteria 907
309 Ga0501048_0001536 3300049582 Bacteria 17521
310 Ga0501048_0129156 3300049582 Bacteria 1787
311 Ga0501068_0013181 3300049584 Bacteria 4700
312 Ga0501068_0161843 3300049584 Bacteria 1411
313 Ga0501069_0008434 3300049585 Bacteria 5418
314 Ga0501069_0580950 3300049585 Bacteria 672
315 Ga0501069_0624222 3300049585 Bacteria 648
316 Ga0501070_0024678 3300049586 Bacteria 5042
317 Ga0501070_0322611 3300049586 Bacteria 1256
318 Ga0501070_0523382 3300049586 Bacteria 951
319 Ga0501070_0710071 3300049586 Bacteria 795
320 Ga0501071_0006354 3300049587 Bacteria 7663
321 Ga0501071_0036918 3300049587 Bacteria 3486
322 Ga0501071_0085550 3300049587 Bacteria 2312
323 Ga0501071_0882476 3300049587 Bacteria 690
324 Ga0501072_0000588 3300049588 Bacteria 26186
325 Ga0501072_0056297 3300049588 Bacteria 3099
326 Ga0501073_0071175 3300049589 Bacteria 2424
327 Ga0501074_0300410 3300049590 Bacteria 1140
328 Ga0501074_0460315 3300049590 Bacteria 901
329 Ga0501074_1073979 3300049590 Bacteria 565
330 Ga0501075_0000468 3300049591 Bacteria 24012
331 Ga0501075_0002879 3300049591 Bacteria 11549
332 Ga0501075_0069758 3300049591 Bacteria 2656
333 Ga0501075_0272676 3300049591 Bacteria 1289
334 Ga0501076_0004870 3300049592 Bacteria 9595
335 Ga0501076_0027250 3300049592 Bacteria 4432
336 Ga0501076_0075732 3300049592 Bacteria 2698
337 Ga0501076_0710166 3300049592 Bacteria 830
338 Ga0501076_0784928 3300049592 Bacteria 786
339 Ga0501077_0017032 3300049593 Bacteria 4583
340 Ga0501077_0052841 3300049593 Bacteria 2579
341 Ga0501079_0003213 3300049741 Bacteria 11962
342 Ga0501079_0003281 3300049741 Bacteria 11853
343 Ga0501079_0165122 3300049741 Bacteria 1726
344 Ga0501079_0166657 3300049741 Bacteria 1718
345 Ga0501080_0027728 3300049742 Bacteria 5266
346 Ga0501081_0015155 3300049743 Bacteria 5084
347 Ga0501081_0015451 3300049743 Bacteria 5037
348 Ga0501081_0160223 3300049743 Bacteria 1621
349 Ga0501081_1112199 3300049743 Bacteria 598
350 Ga0501083_0005130 3300049744 Bacteria 9270
351 Ga0501083_0033891 3300049744 Bacteria 3494
352 Ga0501083_0455234 3300049744 Bacteria 833
353 Ga0501035_0008541 3300049822 Bacteria 9535
354 Ga0501035_0079375 3300049822 Bacteria 2899
355 Ga0501035_0751034 3300049822 Bacteria 783
356 Ga0501035_1079263 3300049822 Bacteria 628
357 Ga0501044_0018598 3300049823 Bacteria 7444
358 Ga0501044_0113850 3300049823 Bacteria 2711
359 Ga0501044_0217711 3300049823 Bacteria 1861
360 Ga0501045_0001327 3300049824 Bacteria 16429
361 Ga0501045_0390729 3300049824 Bacteria 1035
362 Ga0501045_0827265 3300049824 Bacteria 681
363 nmdc:mga03n38_177585_c1 3300050490 Bacteria 1089
364 nmdc:mga03n38_25771_c1 3300050490 Bacteria 2420
365 nmdc:mga0yw44_224371_c1 3300050492 Bacteria 1246
366 nmdc:mga06z11_7755_c1 3300050494 Bacteria 4435
367 nmdc:mga05p37_27209_c1 3300050507 Bacteria 6961
368 nmdc:mga09592_443111_c1 3300050508 Bacteria 1121
369 nmdc:mga0qj67_26830_c1 3300050509 Bacteria 4460
370 nmdc:mga0qj67_294591_c1 3300050509 Unclassified 1315
371 nmdc:mga06r32_12263_c1 3300050510 Bacteria 7729
372 nmdc:mga06r32_7798_c1 3300050510 Bacteria 9622
373 nmdc:mga08y16_1695790_c1 3300050511 Bacteria 587
374 nmdc:mga0sz30_137063_c1 3300050516 Bacteria 1080
375 nmdc:mga0sz30_387880_c1 3300050516 Bacteria 625
376 Ga0500610_0010213 3300053079 Bacteria 4213
377 Ga0500644_0104027 3300053088 Bacteria 1083
378 Ga0500556_0005125 3300053104 Bacteria 3707
379 Ga0500577_0174647 3300053142 Bacteria 920
380 Ga0500588_0305105 3300053146 Bacteria 603
381 Ga0501084_0001042 3300054114 Bacteria 21554
382 Ga0501084_0341517 3300054114 Bacteria 1265
383 Ga0501082_0002382 3300060353 Bacteria 16473
384 Ga0501082_0047208 3300060353 Bacteria 3711
385 Ga0501082_1327346 3300060353 Bacteria 628
386 Ga0501082_1523051 3300060353 Bacteria 584
387 Ga0466962_0036079 3300061719 Bacteria 2366
388 Ga0530510_0000781 3300061734 Bacteria 20666
389 Ga0530510_0050805 3300061734 Bacteria 2995
390 Ga0530510_0600328 3300061734 Bacteria 837

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_101920781 Ga0070683_1019207811 127
2 3300005331 Ga0070670_100798696 Ga0070670_1007986962 127
3 3300005356 Ga0070674_100413023 Ga0070674_1004130232 127
4 3300025937 Ga0207669_10313297 Ga0207669_103132972 127
5 3300026121 Ga0207683_10770219 Ga0207683_107702192 127
6 3300031727 Ga0316576_10539302 Ga0316576_105393022 127
7 3300031728 Ga0316578_10028754 Ga0316578_100287542 127
8 3300037853 Ga0436364_1103776 Ga0436364_1103776_1623_2021 127
9 3300039437 Ga0436365_1490252 Ga0436365_1490252_2239_2637 127
10 3300044684 Ga0466966_0689414 Ga0466966_0689414_106_504 127
11 3300044693 Ga0466961_0114542 Ga0466961_0114542_764_1162 127
12 3300044706 Ga0466964_0068011 Ga0466964_0068011_625_1023 127
13 3300044765 Ga0466970_0367861 Ga0466970_0367861_256_654 127
14 3300045049 Ga0466959_0101223 Ga0466959_0101223_766_1164 127
15 3300045049 Ga0466959_0503552 Ga0466959_0503552_315_713 127
16 3300045836 Ga0466958_0300847 Ga0466958_0300847_249_647 127
17 3300045976 Ga0466967_0043547 Ga0466967_0043547_2132_2530 127
18 3300045976 Ga0466967_0097263 Ga0466967_0097263_2055_2453 127
19 3300045976 Ga0466967_0902029 Ga0466967_0902029_224_613 127
20 3300045976 Ga0466967_1311336 Ga0466967_1311336_242_640 127
21 3300046680 Ga0495646_0518046 Ga0495646_0518046_189_587 127
22 3300048088 Ga0495602_0647714 Ga0495602_0647714_250_648 127
23 3300061719 Ga0466962_0036079 Ga0466962_0036079_1390_1788 127
24 3300000546 LJNas_1002302 LJNas_10023023 128
25 3300002070 JGI24750J21931_1011578 JGI24750J21931_10115781 128
26 3300002073 JGI24745J21846_1002591 JGI24745J21846_10025912 128
27 3300002074 JGI24748J21848_1008594 JGI24748J21848_10085943 128
28 3300002076 JGI24749J21850_1004806 JGI24749J21850_10048063 128
29 3300002077 JGI24744J21845_10001651 JGI24744J21845_100016515 128
30 3300002239 JGI24034J26672_10002268 JGI24034J26672_100022682 128
31 3300002244 JGI24742J22300_10000635 JGI24742J22300_100006354 128
32 3300005328 Ga0070676_10186063 Ga0070676_101860632 128
33 3300005330 Ga0070690_100025092 Ga0070690_1000250922 128
34 3300005335 Ga0070666_10005391 Ga0070666_100053916 128
35 3300005337 Ga0070682_100195189 Ga0070682_1001951892 128
36 3300005338 Ga0068868_100001185 Ga0068868_1000011857 128
37 3300005340 Ga0070689_100041787 Ga0070689_1000417874 128
38 3300005341 Ga0070691_10005929 Ga0070691_100059292 128
39 3300005343 Ga0070687_100023382 Ga0070687_1000233822 128
40 3300005345 Ga0070692_10125222 Ga0070692_101252222 128
41 3300005347 Ga0070668_100002593 Ga0070668_1000025934 128
42 3300005347 Ga0070668_100009122 Ga0070668_1000091224 128
43 3300005353 Ga0070669_100015542 Ga0070669_1000155425 128
44 3300005355 Ga0070671_100930847 Ga0070671_1009308471 128
45 3300005356 Ga0070674_100001050 Ga0070674_10000105013 128
46 3300005367 Ga0070667_100003670 Ga0070667_1000036708 128
47 3300005367 Ga0070667_100204701 Ga0070667_1002047012 128
48 3300005406 Ga0070703_10058176 Ga0070703_100581762 128
49 3300005434 Ga0070709_10117549 Ga0070709_101175492 128
50 3300005434 Ga0070709_10752339 Ga0070709_107523391 128
51 3300005436 Ga0070713_100212586 Ga0070713_1002125862 128
52 3300005437 Ga0070710_10001208 Ga0070710_100012089 128
53 3300005438 Ga0070701_10029540 Ga0070701_100295402 128
54 3300005439 Ga0070711_100002788 Ga0070711_1000027885 128
55 3300005439 Ga0070711_101322096 Ga0070711_1013220961 128
56 3300005441 Ga0070700_100014368 Ga0070700_1000143684 128
57 3300005444 Ga0070694_100014088 Ga0070694_1000140884 128
58 3300005445 Ga0070708_100218715 Ga0070708_1002187152 128
59 3300005445 Ga0070708_100406970 Ga0070708_1004069702 128
60 3300005455 Ga0070663_100011524 Ga0070663_1000115244 128
61 3300005455 Ga0070663_101226830 Ga0070663_1012268301 128
62 3300005456 Ga0070678_100003252 Ga0070678_1000032527 128
63 3300005457 Ga0070662_100031780 Ga0070662_1000317804 128
64 3300005459 Ga0068867_100001068 Ga0068867_1000010686 128
65 3300005466 Ga0070685_10110934 Ga0070685_101109341 128
66 3300005467 Ga0070706_100240706 Ga0070706_1002407062 128
67 3300005468 Ga0070707_100008936 Ga0070707_1000089362 128
68 3300005468 Ga0070707_100046532 Ga0070707_1000465324 128
69 3300005468 Ga0070707_100110892 Ga0070707_1001108925 128
70 3300005468 Ga0070707_100205287 Ga0070707_1002052872 128
71 3300005471 Ga0070698_100022018 Ga0070698_1000220185 128
72 3300005536 Ga0070697_100449868 Ga0070697_1004498682 128
73 3300005539 Ga0068853_100013240 Ga0068853_1000132405 128
74 3300005543 Ga0070672_100066376 Ga0070672_1000663764 128
75 3300005544 Ga0070686_100006961 Ga0070686_1000069612 128
76 3300005546 Ga0070696_100003466 Ga0070696_1000034664 128
77 3300005548 Ga0070665_100034020 Ga0070665_1000340203 128
78 3300005548 Ga0070665_100867079 Ga0070665_1008670792 128
79 3300005549 Ga0070704_100000313 Ga0070704_10000031320 128
80 3300005563 Ga0068855_100036881 Ga0068855_1000368813 128
81 3300005563 Ga0068855_100196849 Ga0068855_1001968493 128
82 3300005578 Ga0068854_100003099 Ga0068854_1000030994 128
83 3300005614 Ga0068856_100159699 Ga0068856_1001596993 128
84 3300005615 Ga0070702_100141886 Ga0070702_1001418861 128
85 3300005617 Ga0068859_100022306 Ga0068859_1000223064 128
86 3300005718 Ga0068866_10000158 Ga0068866_1000015821 128
87 3300005719 Ga0068861_100001564 Ga0068861_10000156410 128
88 3300005841 Ga0068863_100151731 Ga0068863_1001517312 128
89 3300005842 Ga0068858_100077626 Ga0068858_1000776264 128
90 3300005842 Ga0068858_100188445 Ga0068858_1001884452 128
91 3300005842 Ga0068858_101027024 Ga0068858_1010270242 128
92 3300005843 Ga0068860_100002092 Ga0068860_1000020926 128
93 3300005843 Ga0068860_100510447 Ga0068860_1005104472 128
94 3300005937 Ga0081455_10083897 Ga0081455_100838974 128
95 3300005981 Ga0081538_10061445 Ga0081538_100614452 128
96 3300006048 Ga0075363_100026116 Ga0075363_1000261162 128
97 3300006048 Ga0075363_100118010 Ga0075363_1001180102 128
98 3300006163 Ga0070715_10344473 Ga0070715_103444732 128
99 3300006173 Ga0070716_100000832 Ga0070716_10000083212 128
100 3300006173 Ga0070716_100236136 Ga0070716_1002361362 128
101 3300006173 Ga0070716_101200905 Ga0070716_1012009051 128
102 3300006175 Ga0070712_100001192 Ga0070712_10000119212 128
103 3300006178 Ga0075367_10031652 Ga0075367_100316523 128
104 3300006186 Ga0075369_10110512 Ga0075369_101105122 128
105 3300006186 Ga0075369_10302328 Ga0075369_103023282 128
106 3300006358 Ga0068871_100350936 Ga0068871_1003509362 128
107 3300006844 Ga0075428_100004890 Ga0075428_10000489012 128
108 3300006846 Ga0075430_100007000 Ga0075430_1000070009 128
109 3300006846 Ga0075430_100214191 Ga0075430_1002141912 128
110 3300006847 Ga0075431_100000193 Ga0075431_1000001935 128
111 3300006847 Ga0075431_100017112 Ga0075431_1000171125 128
112 3300006880 Ga0075429_100412985 Ga0075429_1004129852 128
113 3300006881 Ga0068865_100002102 Ga0068865_1000021027 128
114 3300006931 Ga0097620_100022306 Ga0097620_1000223064 128
115 3300009092 Ga0105250_10186537 Ga0105250_101865371 128
116 3300009093 Ga0105240_10754908 Ga0105240_107549082 128
117 3300009094 Ga0111539_10889865 Ga0111539_108898651 128
118 3300009098 Ga0105245_10004552 Ga0105245_100045524 128
119 3300009101 Ga0105247_10000899 Ga0105247_1000089910 128
120 3300009101 Ga0105247_11098930 Ga0105247_110989302 128
121 3300009147 Ga0114129_10023791 Ga0114129_100237918 128
122 3300009174 Ga0105241_10090631 Ga0105241_100906314 128
123 3300009174 Ga0105241_11691981 Ga0105241_116919811 128
124 3300009176 Ga0105242_10000066 Ga0105242_1000006621 128
125 3300009177 Ga0105248_10019044 Ga0105248_100190446 128
126 3300009177 Ga0105248_10023924 Ga0105248_100239246 128
127 3300009545 Ga0105237_10002826 Ga0105237_100028263 128
128 3300009551 Ga0105238_10206665 Ga0105238_102066652 128
129 3300009553 Ga0105249_10002866 Ga0105249_1000286619 128
130 3300009987 Ga0105030_114586 Ga0105030_1145861 128
131 3300010375 Ga0105239_10107999 Ga0105239_101079994 128
132 3300013102 Ga0157371_11184888 Ga0157371_111848881 128
133 3300013296 Ga0157374_10479093 Ga0157374_104790932 128
134 3300013297 Ga0157378_10004830 Ga0157378_1000483010 128
135 3300013297 Ga0157378_10332362 Ga0157378_103323622 128
136 3300013306 Ga0163162_10005544 Ga0163162_100055444 128
137 3300013307 Ga0157372_10001039 Ga0157372_100010397 128
138 3300013307 Ga0157372_11480674 Ga0157372_114806741 128
139 3300013308 Ga0157375_10000268 Ga0157375_1000026824 128
140 3300013308 Ga0157375_10150124 Ga0157375_101501243 128
141 3300014325 Ga0163163_12489505 Ga0163163_124895052 128
142 3300014326 Ga0157380_10000036 Ga0157380_1000003645 128
143 3300014745 Ga0157377_10152000 Ga0157377_101520002 128
144 3300014969 Ga0157376_10461607 Ga0157376_104616071 128
145 3300014969 Ga0157376_10771508 Ga0157376_107715081 128
146 3300020081 Ga0206354_10518041 Ga0206354_105180411 128
147 3300020082 Ga0206353_10123647 Ga0206353_101236472 128
148 3300020082 Ga0206353_10631349 Ga0206353_106313491 128
149 3300021377 Ga0213874_10011696 Ga0213874_100116962 128
150 3300021384 Ga0213876_10370893 Ga0213876_103708931 128
151 3300025711 Ga0207696_1162217 Ga0207696_11622172 128
152 3300025885 Ga0207653_10108177 Ga0207653_101081772 128
153 3300025898 Ga0207692_10004107 Ga0207692_100041073 128
154 3300025899 Ga0207642_10003021 Ga0207642_100030215 128
155 3300025900 Ga0207710_10002938 Ga0207710_100029383 128
156 3300025901 Ga0207688_10000314 Ga0207688_100003146 128
157 3300025905 Ga0207685_10274171 Ga0207685_102741712 128
158 3300025906 Ga0207699_10104742 Ga0207699_101047423 128
159 3300025907 Ga0207645_10006251 Ga0207645_100062516 128
160 3300025909 Ga0207705_10579918 Ga0207705_105799182 128
161 3300025910 Ga0207684_10209232 Ga0207684_102092323 128
162 3300025911 Ga0207654_10212339 Ga0207654_102123392 128
163 3300025913 Ga0207695_10600139 Ga0207695_106001391 128
164 3300025914 Ga0207671_10007517 Ga0207671_1000751710 128
165 3300025914 Ga0207671_10161142 Ga0207671_101611423 128
166 3300025915 Ga0207693_10000224 Ga0207693_1000022426 128
167 3300025915 Ga0207693_10079887 Ga0207693_100798872 128
168 3300025916 Ga0207663_10012477 Ga0207663_100124772 128
169 3300025918 Ga0207662_10027613 Ga0207662_100276132 128
170 3300025922 Ga0207646_10012929 Ga0207646_100129297 128
171 3300025922 Ga0207646_10118762 Ga0207646_101187623 128
172 3300025922 Ga0207646_10166538 Ga0207646_101665382 128
173 3300025922 Ga0207646_10183374 Ga0207646_101833742 128
174 3300025922 Ga0207646_10361158 Ga0207646_103611582 128
175 3300025923 Ga0207681_10005775 Ga0207681_100057755 128
176 3300025927 Ga0207687_10003262 Ga0207687_100032626 128
177 3300025928 Ga0207700_10349751 Ga0207700_103497511 128
178 3300025931 Ga0207644_10692088 Ga0207644_106920882 128
179 3300025932 Ga0207690_11087959 Ga0207690_110879591 128
180 3300025933 Ga0207706_10000288 Ga0207706_1000028819 128
181 3300025934 Ga0207686_10002590 Ga0207686_100025905 128
182 3300025935 Ga0207709_10010164 Ga0207709_100101645 128
183 3300025936 Ga0207670_10820005 Ga0207670_108200052 128
184 3300025937 Ga0207669_10000644 Ga0207669_100006448 128
185 3300025938 Ga0207704_10000083 Ga0207704_1000008342 128
186 3300025939 Ga0207665_10000513 Ga0207665_1000051310 128
187 3300025939 Ga0207665_10078488 Ga0207665_100784883 128
188 3300025940 Ga0207691_10100383 Ga0207691_101003833 128
189 3300025941 Ga0207711_10046018 Ga0207711_100460182 128
190 3300025941 Ga0207711_10374419 Ga0207711_103744192 128
191 3300025942 Ga0207689_10217562 Ga0207689_102175622 128
192 3300025961 Ga0207712_10003359 Ga0207712_100033596 128
193 3300025972 Ga0207668_10001110 Ga0207668_100011106 128
194 3300025972 Ga0207668_10004363 Ga0207668_100043635 128
195 3300025981 Ga0207640_10001883 Ga0207640_100018835 128
196 3300025986 Ga0207658_10025584 Ga0207658_100255843 128
197 3300025986 Ga0207658_10276191 Ga0207658_102761912 128
198 3300026023 Ga0207677_10003217 Ga0207677_100032175 128
199 3300026035 Ga0207703_10019047 Ga0207703_100190475 128
200 3300026041 Ga0207639_10013122 Ga0207639_100131225 128
201 3300026067 Ga0207678_10037920 Ga0207678_100379202 128
202 3300026075 Ga0207708_10001720 Ga0207708_100017204 128
203 3300026078 Ga0207702_10087711 Ga0207702_100877113 128
204 3300026078 Ga0207702_11692685 Ga0207702_116926851 128
205 3300026089 Ga0207648_10001622 Ga0207648_1000162223 128
206 3300026089 Ga0207648_10441348 Ga0207648_104413482 128
207 3300026118 Ga0207675_100000324 Ga0207675_10000032431 128
208 3300026121 Ga0207683_10000077 Ga0207683_1000007754 128
209 3300026142 Ga0207698_10037930 Ga0207698_100379304 128
210 3300027671 Ga0209588_1080181 Ga0209588_10801811 128
211 3300028379 Ga0268266_10059922 Ga0268266_100599224 128
212 3300028380 Ga0268265_10008356 Ga0268265_100083565 128
213 3300028381 Ga0268264_10021807 Ga0268264_100218075 128
214 3300028381 Ga0268264_10481154 Ga0268264_104811542 128
215 3300035088 Ga0373940_0314496 Ga0373940_0314496_129_515 128
216 3300035114 Ga0373939_0024573 Ga0373939_0024573_289_675 128
217 3300035118 Ga0373954_0054833 Ga0373954_0054833_1008_1400 128
218 3300035207 Ga0373942_0168519 Ga0373942_0168519_102_488 128
219 3300035242 Ga0373962_0320060 Ga0373962_0320060_91_477 128
220 3300035398 Ga0316574_0101357 Ga0316574_0101357_1268_1663 128
221 3300035695 Ga0373927_0234123 Ga0373927_0234123_711_1103 128
222 3300036712 Ga0316584_0067342 Ga0316584_0067342_1863_2258 128
223 3300038735 Ga0400485_18803 Ga0400485_18803_587_1069 128
224 3300039437 Ga0436365_0431317 Ga0436365_0431317_60_449 128
225 3300039437 Ga0436365_0662372 Ga0436365_0662372_3786_4178 128
226 3300039450 Ga0436363_1265155 Ga0436363_1265155_65571_65963 128
227 3300039453 Ga0436362_1146574 Ga0436362_1146574_1201_1593 128
228 3300041451 Ga0451791_1889493 Ga0451791_1889493_222_608 128
229 3300041459 Ga0451800_0083973 Ga0451800_0083973_109_498 128
230 3300042003 Ga0439443_047414 Ga0439443_047414_47_439 128
231 3300042005 Ga0439448_0278800 Ga0439448_0278800_67_453 128
232 3300044693 Ga0466961_0113864 Ga0466961_0113864_793_1200 128
233 3300044694 Ga0466963_1078422 Ga0466963_1078422_132_521 128
234 3300044901 Ga0466960_0650338 Ga0466960_0650338_69_461 128
235 3300045836 Ga0466958_0396363 Ga0466958_0396363_424_816 128
236 3300045976 Ga0466967_0005898 Ga0466967_0005898_5815_6204 128
237 3300046506 Ga0495583_0091316 Ga0495583_0091316_400_786 128
238 3300046507 Ga0495606_0040587 Ga0495606_0040587_324_710 128
239 3300046524 Ga0495648_0006622 Ga0495648_0006622_6684_7070 128
240 3300046530 Ga0495654_0023897 Ga0495654_0023897_1683_2069 128
241 3300046648 Ga0495611_0070786 Ga0495611_0070786_396_782 128
242 3300046660 Ga0495625_0308276 Ga0495625_0308276_559_945 128
243 3300046663 Ga0495635_0069721 Ga0495635_0069721_1257_1643 128
244 3300046681 Ga0495647_0060465 Ga0495647_0060465_716_1108 128
245 3300046683 Ga0495658_0153602 Ga0495658_0153602_619_1011 128
246 3300046694 Ga0495649_0265055 Ga0495649_0265055_304_690 128
247 3300047315 Ga0495581_0544124 Ga0495581_0544124_54_446 128
248 3300047319 Ga0495674_0331276 Ga0495674_0331276_760_1152 128
249 3300047320 Ga0495672_0003170 Ga0495672_0003170_11371_11757 128
250 3300047469 Ga0495673_0005474 Ga0495673_0005474_511_897 128
251 3300048089 Ga0495614_0090889 Ga0495614_0090889_860_1252 128
252 3300048091 Ga0495626_0017832 Ga0495626_0017832_2696_3082 128
253 3300048903 Ga0496100_0001517 Ga0496100_0001517_9506_9892 128
254 3300048903 Ga0496100_0004555 Ga0496100_0004555_3783_4175 128
255 3300048904 Ga0496101_0000176 Ga0496101_0000176_40813_41205 128
256 3300048904 Ga0496101_0002224 Ga0496101_0002224_4367_4753 128
257 3300048905 Ga0496102_0000915 Ga0496102_0000915_22718_23104 128
258 3300048905 Ga0496102_0027557 Ga0496102_0027557_4531_4923 128
259 3300048906 Ga0496103_0003103 Ga0496103_0003103_6576_6962 128
260 3300048906 Ga0496103_0397594 Ga0496103_0397594_160_552 128
261 3300048907 Ga0496104_0003864 Ga0496104_0003864_3642_4034 128
262 3300048908 Ga0496105_0032092 Ga0496105_0032092_2357_2749 128
263 3300048909 Ga0496106_0000359 Ga0496106_0000359_23114_23500 128
264 3300048909 Ga0496106_0009115 Ga0496106_0009115_2264_2656 128
265 3300048910 Ga0496107_0045217 Ga0496107_0045217_1616_2002 128
266 3300048912 Ga0496109_0000697 Ga0496109_0000697_22116_22508 128
267 3300048912 Ga0496109_0646126 Ga0496109_0646126_313_699 128
268 3300048912 Ga0496109_0762154 Ga0496109_0762154_63_449 128
269 3300048912 Ga0496109_1398670 Ga0496109_1398670_115_585 128
270 3300048915 Ga0496112_1027097 Ga0496112_1027097_284_670 128
271 3300048917 Ga0496114_0001108 Ga0496114_0001108_1407_1793 128
272 3300048917 Ga0496114_0004574 Ga0496114_0004574_6572_6964 128
273 3300048918 Ga0496115_0000890 Ga0496115_0000890_6624_7010 128
274 3300048918 Ga0496115_0001243 Ga0496115_0001243_6134_6526 128
275 3300049568 Ga0501031_0010009 Ga0501031_0010009_3907_4305 128
276 3300049568 Ga0501031_0194238 Ga0501031_0194238_788_1180 128
277 3300049568 Ga0501031_1021150 Ga0501031_1021150_32_442 128
278 3300049569 Ga0501032_0039256 Ga0501032_0039256_819_1217 128
279 3300049570 Ga0501033_0036152 Ga0501033_0036152_1887_2285 128
280 3300049570 Ga0501033_0052993 Ga0501033_0052993_1994_2404 128
281 3300049571 Ga0501034_0101654 Ga0501034_0101654_2376_2786 128
282 3300049572 Ga0501036_0009272 Ga0501036_0009272_4349_4747 128
283 3300049572 Ga0501036_0196942 Ga0501036_0196942_590_982 128
284 3300049572 Ga0501036_0338287 Ga0501036_0338287_54_446 128
285 3300049573 Ga0501037_0017017 Ga0501037_0017017_2906_3304 128
286 3300049573 Ga0501037_0069038 Ga0501037_0069038_1193_1603 128
287 3300049573 Ga0501037_0455904 Ga0501037_0455904_442_834 128
288 3300049573 Ga0501037_0952486 Ga0501037_0952486_29_424 128
289 3300049574 Ga0501038_0005615 Ga0501038_0005615_7699_8097 128
290 3300049574 Ga0501038_0037524 Ga0501038_0037524_188_598 128
291 3300049574 Ga0501038_1283357 Ga0501038_1283357_105_497 128
292 3300049575 Ga0501039_0007399 Ga0501039_0007399_7181_7579 128
293 3300049575 Ga0501039_0034951 Ga0501039_0034951_2187_2579 128
294 3300049576 Ga0501040_0000558 Ga0501040_0000558_21872_22270 128
295 3300049576 Ga0501040_0207183 Ga0501040_0207183_382_774 128
296 3300049576 Ga0501040_0230961 Ga0501040_0230961_579_971 128
297 3300049576 Ga0501040_0497059 Ga0501040_0497059_386_778 128
298 3300049576 Ga0501040_0726100 Ga0501040_0726100_195_587 128
299 3300049577 Ga0501041_0004106 Ga0501041_0004106_3918_4310 128
300 3300049577 Ga0501041_0004732 Ga0501041_0004732_3655_4053 128
301 3300049578 Ga0501042_0000539 Ga0501042_0000539_15350_15748 128
302 3300049578 Ga0501042_0064185 Ga0501042_0064185_2189_2581 128
303 3300049578 Ga0501042_0416224 Ga0501042_0416224_116_508 128
304 3300049579 Ga0501043_0002036 Ga0501043_0002036_15642_16040 128
305 3300049579 Ga0501043_0018164 Ga0501043_0018164_3332_3742 128
306 3300049580 Ga0501046_0014971 Ga0501046_0014971_691_1089 128
307 3300049580 Ga0501046_0364971 Ga0501046_0364971_97_489 128
308 3300049581 Ga0501047_0035946 Ga0501047_0035946_2375_2785 128
309 3300049581 Ga0501047_0614961 Ga0501047_0614961_368_766 128
310 3300049582 Ga0501048_0001536 Ga0501048_0001536_15837_16235 128
311 3300049582 Ga0501048_0129156 Ga0501048_0129156_86_478 128
312 3300049584 Ga0501068_0013181 Ga0501068_0013181_3099_3497 128
313 3300049584 Ga0501068_0161843 Ga0501068_0161843_723_1115 128
314 3300049585 Ga0501069_0008434 Ga0501069_0008434_854_1252 128
315 3300049585 Ga0501069_0580950 Ga0501069_0580950_32_424 128
316 3300049585 Ga0501069_0624222 Ga0501069_0624222_103_495 128
317 3300049586 Ga0501070_0024678 Ga0501070_0024678_3222_3632 128
318 3300049586 Ga0501070_0322611 Ga0501070_0322611_751_1161 128
319 3300049586 Ga0501070_0523382 Ga0501070_0523382_60_470 128
320 3300049586 Ga0501070_0710071 Ga0501070_0710071_276_668 128
321 3300049587 Ga0501071_0006354 Ga0501071_0006354_3693_4091 128
322 3300049587 Ga0501071_0036918 Ga0501071_0036918_100_492 128
323 3300049587 Ga0501071_0085550 Ga0501071_0085550_1902_2294 128
324 3300049587 Ga0501071_0882476 Ga0501071_0882476_261_653 128
325 3300049588 Ga0501072_0000588 Ga0501072_0000588_3676_4074 128
326 3300049588 Ga0501072_0056297 Ga0501072_0056297_1154_1546 128
327 3300049589 Ga0501073_0071175 Ga0501073_0071175_523_921 128
328 3300049590 Ga0501074_0300410 Ga0501074_0300410_183_575 128
329 3300049590 Ga0501074_0460315 Ga0501074_0460315_263_661 128
330 3300049590 Ga0501074_1073979 Ga0501074_1073979_62_454 128
331 3300049591 Ga0501075_0000468 Ga0501075_0000468_14494_14892 128
332 3300049591 Ga0501075_0002879 Ga0501075_0002879_1698_2090 128
333 3300049591 Ga0501075_0069758 Ga0501075_0069758_618_1010 128
334 3300049591 Ga0501075_0272676 Ga0501075_0272676_475_867 128
335 3300049592 Ga0501076_0004870 Ga0501076_0004870_1835_2233 128
336 3300049592 Ga0501076_0027250 Ga0501076_0027250_2106_2498 128
337 3300049592 Ga0501076_0075732 Ga0501076_0075732_995_1387 128
338 3300049592 Ga0501076_0710166 Ga0501076_0710166_283_675 128
339 3300049592 Ga0501076_0784928 Ga0501076_0784928_133_525 128
340 3300049593 Ga0501077_0017032 Ga0501077_0017032_550_942 128
341 3300049593 Ga0501077_0052841 Ga0501077_0052841_863_1261 128
342 3300049741 Ga0501079_0003213 Ga0501079_0003213_7598_7996 128
343 3300049741 Ga0501079_0003281 Ga0501079_0003281_9502_9894 128
344 3300049741 Ga0501079_0165122 Ga0501079_0165122_946_1338 128
345 3300049741 Ga0501079_0166657 Ga0501079_0166657_618_1010 128
346 3300049742 Ga0501080_0027728 Ga0501080_0027728_2920_3318 128
347 3300049743 Ga0501081_0015155 Ga0501081_0015155_1639_2037 128
348 3300049743 Ga0501081_0015451 Ga0501081_0015451_2711_3103 128
349 3300049743 Ga0501081_0160223 Ga0501081_0160223_455_847 128
350 3300049743 Ga0501081_1112199 Ga0501081_1112199_171_581 128
351 3300049744 Ga0501083_0005130 Ga0501083_0005130_1627_2022 128
352 3300049744 Ga0501083_0033891 Ga0501083_0033891_262_660 128
353 3300049744 Ga0501083_0455234 Ga0501083_0455234_167_559 128
354 3300049822 Ga0501035_0008541 Ga0501035_0008541_304_714 128
355 3300049822 Ga0501035_0079375 Ga0501035_0079375_735_1133 128
356 3300049822 Ga0501035_0751034 Ga0501035_0751034_28_420 128
357 3300049822 Ga0501035_1079263 Ga0501035_1079263_140_550 128
358 3300049823 Ga0501044_0018598 Ga0501044_0018598_2160_2570 128
359 3300049823 Ga0501044_0113850 Ga0501044_0113850_1698_2096 128
360 3300049823 Ga0501044_0217711 Ga0501044_0217711_256_666 128
361 3300049824 Ga0501045_0001327 Ga0501045_0001327_1127_1525 128
362 3300049824 Ga0501045_0390729 Ga0501045_0390729_602_994 128
363 3300049824 Ga0501045_0827265 Ga0501045_0827265_175_567 128
364 3300050490 nmdc:mga03n38_177585_c1 nmdc:mga03n38_177585_c1_424_816 128
365 3300050490 nmdc:mga03n38_25771_c1 nmdc:mga03n38_25771_c1_1368_1760 128
366 3300050492 nmdc:mga0yw44_224371_c1 nmdc:mga0yw44_224371_c1_437_829 128
367 3300050494 nmdc:mga06z11_7755_c1 nmdc:mga06z11_7755_c1_1368_1760 128
368 3300050507 nmdc:mga05p37_27209_c1 nmdc:mga05p37_27209_c1_4085_4471 128
369 3300050508 nmdc:mga09592_443111_c1 nmdc:mga09592_443111_c1_67_459 128
370 3300050509 nmdc:mga0qj67_26830_c1 nmdc:mga0qj67_26830_c1_943_1329 128
371 3300050509 nmdc:mga0qj67_294591_c1 nmdc:mga0qj67_294591_c1_295_687 128
372 3300050510 nmdc:mga06r32_12263_c1 nmdc:mga06r32_12263_c1_3345_3731 128
373 3300050510 nmdc:mga06r32_7798_c1 nmdc:mga06r32_7798_c1_8221_8613 128
374 3300050511 nmdc:mga08y16_1695790_c1 nmdc:mga08y16_1695790_c1_50_436 128
375 3300050516 nmdc:mga0sz30_137063_c1 nmdc:mga0sz30_137063_c1_170_556 128
376 3300050516 nmdc:mga0sz30_387880_c1 nmdc:mga0sz30_387880_c1_111_497 128
377 3300053079 Ga0500610_0010213 Ga0500610_0010213_2216_2602 128
378 3300053088 Ga0500644_0104027 Ga0500644_0104027_497_883 128
379 3300053104 Ga0500556_0005125 Ga0500556_0005125_2312_2761 128
380 3300053142 Ga0500577_0174647 Ga0500577_0174647_402_851 128
381 3300053146 Ga0500588_0305105 Ga0500588_0305105_158_574 128
382 3300054114 Ga0501084_0001042 Ga0501084_0001042_17190_17588 128
383 3300054114 Ga0501084_0341517 Ga0501084_0341517_748_1140 128
384 3300060353 Ga0501082_0002382 Ga0501082_0002382_725_1123 128
385 3300060353 Ga0501082_0047208 Ga0501082_0047208_730_1122 128
386 3300060353 Ga0501082_1327346 Ga0501082_1327346_148_540 128
387 3300060353 Ga0501082_1523051 Ga0501082_1523051_28_423 128
388 3300061734 Ga0530510_0000781 Ga0530510_0000781_14619_15017 128
389 3300061734 Ga0530510_0050805 Ga0530510_0050805_152_544 128
390 3300061734 Ga0530510_0600328 Ga0530510_0600328_100_492 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09996

DUF2237

Uncharacterized protein conserved in bacteria (DUF2237)

11

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.8926 4 120
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.8784 4 120
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.7763 1 120
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.7703 1 120
3j6b-assembly1.cif.gz_G structure of the yeast mitochondrial large ribosomal subunit 0.5965 31 98
ID Description Score Start End Superfamily
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8799 4 120 3.30.56.110
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8655 4 120 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.7961 5 120 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.7772 5 120 3.30.56.110
2lq3A01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.6538 47 120 1.10.1660.80
ID Description Score Start End GO Terms
AF-A0A0S1YR09-F1-model_v4 deleted 1.006 70 120
AF-A0A383B302-F1-model_v4 DUF2237 domain-containing protein 1.004 44 112
AF-A0A353DFF3-F1-model_v4 DUF2237 domain-containing protein 1.002 48 119
AF-A0A7C3R3I1-F1-model_v4 DUF2237 family protein 1.001 54 119
AF-Q0FK62-F1-model_v4 DUF2237 domain-containing protein 1 47 119

Feature Viewer

pLDDT pTM Quality
80.9 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map