F431628

General Info

Members Datasets Scaffolds Average Seq Length
390 243 389 109

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100196721|Ga0070683_1001967212
Length 100
Sequence MYKVRQEDLPYRGSSHHFVGANQGDVNVSVFLFNGEPYDEIQFIRSGRGRYVVNGQEFEATAGDILVIKAGEVHSFTVIGDEPLVQLDVHLSPRFIQENL

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
243 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.26
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.59
Rhizosphere 95.13
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10227872 3300005288 Bacteria 824
2 Ga0065715_10108592 3300005293 Bacteria 2711
3 Ga0070658_11483870 3300005327 Bacteria 588
4 Ga0070676_10158260 3300005328 Unclassified 1456
5 Ga0070683_100196721 3300005329 Bacteria 1914
6 Ga0070683_101106055 3300005329 Unclassified 761
7 Ga0070670_100093162 3300005331 Bacteria 2591
8 Ga0070670_100231758 3300005331 Bacteria 1607
9 Ga0068869_100044947 3300005334 Bacteria 3177
10 Ga0068869_100870590 3300005334 Unclassified 778
11 Ga0070666_10317921 3300005335 Unclassified 1110
12 Ga0070666_10440045 3300005335 Archaea 940
13 Ga0070680_100048924 3300005336 Bacteria 3446
14 Ga0070680_100519750 3300005336 Unclassified 1019
15 Ga0070682_100006292 3300005337 Bacteria 6660
16 Ga0068868_100260461 3300005338 Bacteria 1462
17 Ga0068868_100271409 3300005338 Bacteria 1433
18 Ga0070660_100002803 3300005339 Bacteria 11982
19 Ga0070689_100072648 3300005340 Bacteria 2689
20 Ga0070691_10158928 3300005341 Bacteria 1164
21 Ga0070687_100488326 3300005343 Bacteria 827
22 Ga0070661_100022268 3300005344 Bacteria 4536
23 Ga0070661_100314796 3300005344 Unclassified 1221
24 Ga0070692_10014401 3300005345 Bacteria 3715
25 Ga0070669_100136876 3300005353 Bacteria 1885
26 Ga0070675_100005332 3300005354 Bacteria 9829
27 Ga0070675_100031757 3300005354 Bacteria 4271
28 Ga0070671_100001970 3300005355 Bacteria 15751
29 Ga0070671_100359954 3300005355 Bacteria 1242
30 Ga0070671_100795676 3300005355 Bacteria 823
31 Ga0070674_100027822 3300005356 Bacteria 3708
32 Ga0070673_100046339 3300005364 Bacteria 3376
33 Ga0070673_100128132 3300005364 Unclassified 2126
34 Ga0070688_100262900 3300005365 Unclassified 1233
35 Ga0070659_100049798 3300005366 Bacteria 3294
36 Ga0070667_100173604 3300005367 Bacteria 1904
37 Ga0070667_100978319 3300005367 Archaea 789
38 Ga0070667_102077990 3300005367 Bacteria 535
39 Ga0070703_10213538 3300005406 Unclassified 764
40 Ga0070713_100242899 3300005436 Bacteria 1640
41 Ga0070701_11029424 3300005438 Unclassified 576
42 Ga0070705_100048927 3300005440 Bacteria 2452
43 Ga0070705_100102042 3300005440 Bacteria 1814
44 Ga0070700_100337195 3300005441 Unclassified 1113
45 Ga0070694_100586493 3300005444 Unclassified 896
46 Ga0070662_100010807 3300005457 Bacteria 6011
47 Ga0070662_100033684 3300005457 Bacteria 3609
48 Ga0070662_100223792 3300005457 Bacteria 1502
49 Ga0070662_101500607 3300005457 Bacteria 581
50 Ga0068867_100056232 3300005459 Bacteria 2910
51 Ga0070706_101004994 3300005467 Bacteria 769
52 Ga0070706_101319782 3300005467 Unclassified 661
53 Ga0070706_102159193 3300005467 Unclassified 503
54 Ga0070698_100001876 3300005471 Bacteria 23425
55 Ga0070699_100014194 3300005518 Bacteria 6854
56 Ga0070699_100828791 3300005518 Unclassified 847
57 Ga0070679_100009326 3300005530 Bacteria 9278
58 Ga0070684_100055332 3300005535 Bacteria 3458
59 Ga0070684_100105439 3300005535 Bacteria 2522
60 Ga0070684_100150525 3300005535 Bacteria 2108
61 Ga0070697_100328151 3300005536 Bacteria 1319
62 Ga0068853_100488131 3300005539 Bacteria 1162
63 Ga0070672_100008964 3300005543 Bacteria 6875
64 Ga0070672_100538073 3300005543 Unclassified 1013
65 Ga0070695_100160117 3300005545 Bacteria 1579
66 Ga0070695_101654963 3300005545 Unclassified 535
67 Ga0070696_100000076 3300005546 Bacteria 48224
68 Ga0070696_100730806 3300005546 Unclassified 809
69 Ga0070693_100287984 3300005547 Bacteria 1103
70 Ga0068855_100149909 3300005563 Bacteria 2652
71 Ga0070664_100391147 3300005564 Bacteria 1270
72 Ga0068857_100404577 3300005577 Bacteria 1270
73 Ga0068854_100596053 3300005578 Unclassified 943
74 Ga0068856_100943984 3300005614 Bacteria 881
75 Ga0068856_102224740 3300005614 Unclassified 557
76 Ga0070702_100015880 3300005615 Bacteria 3854
77 Ga0068859_100049648 3300005617 Bacteria 4214
78 Ga0068859_103082916 3300005617 Unclassified 508
79 Ga0068864_100011549 3300005618 Bacteria 7297
80 Ga0068864_100063503 3300005618 Bacteria 3200
81 Ga0068864_100206816 3300005618 Bacteria 1805
82 Ga0068866_10213496 3300005718 Bacteria 1160
83 Ga0068861_101363787 3300005719 Unclassified 691
84 Ga0068870_10131906 3300005840 Bacteria 1452
85 Ga0068870_10258732 3300005840 Bacteria 1082
86 Ga0068863_100013713 3300005841 Bacteria 7813
87 Ga0068863_100634961 3300005841 Bacteria 1058
88 Ga0068863_102305426 3300005841 Bacteria 548
89 Ga0068858_100784531 3300005842 Bacteria 929
90 Ga0068860_100099650 3300005843 Bacteria 2771
91 Ga0068860_100221576 3300005843 Bacteria 1837
92 Ga0068860_102326915 3300005843 Archaea 556
93 Ga0068862_100238532 3300005844 Unclassified 1652
94 Ga0068862_100770599 3300005844 Archaea 937
95 Ga0068862_102488750 3300005844 Unclassified 529
96 Ga0070717_10106383 3300006028 Unclassified 2389
97 Ga0070715_10317316 3300006163 Bacteria 840
98 Ga0070716_100917399 3300006173 Unclassified 687
99 Ga0097621_100072877 3300006237 Bacteria 2842
100 Ga0097621_100076536 3300006237 Bacteria 2776
101 Ga0097621_100924898 3300006237 Unclassified 813
102 Ga0068871_100003295 3300006358 Bacteria 11080
103 Ga0068871_100005659 3300006358 Bacteria 8767
104 Ga0075428_100010980 3300006844 Bacteria 10073
105 Ga0075428_100030838 3300006844 Bacteria 5928
106 Ga0075430_100145908 3300006846 Unclassified 1971
107 Ga0075430_100401096 3300006846 Unclassified 1132
108 Ga0075430_100568320 3300006846 Bacteria 935
109 Ga0075430_101432350 3300006846 Unclassified 568
110 Ga0075431_100000029 3300006847 Bacteria 73283
111 Ga0075431_100014007 3300006847 Bacteria 8101
112 Ga0075431_100086156 3300006847 Bacteria 3242
113 Ga0075431_101198791 3300006847 Bacteria 722
114 Ga0075433_10082210 3300006852 Bacteria 2840
115 Ga0075433_11454707 3300006852 Unclassified 592
116 Ga0075434_100119742 3300006871 Bacteria 2647
117 Ga0075429_100328274 3300006880 Bacteria 1339
118 Ga0075429_100451173 3300006880 Bacteria 1127
119 Ga0068865_100079097 3300006881 Bacteria 2354
120 Ga0068865_100144970 3300006881 Bacteria 1795
121 Ga0068865_100535018 3300006881 Unclassified 982
122 Ga0075436_100003773 3300006914 Bacteria 10390
123 Ga0075436_100174320 3300006914 Bacteria 1519
124 Ga0097620_100049648 3300006931 Bacteria 4214
125 Ga0097620_103083951 3300006931 Unclassified 508
126 Ga0075435_100191355 3300007076 Unclassified 1732
127 Ga0105250_10199721 3300009092 Unclassified 843
128 Ga0105240_11521383 3300009093 Unclassified 701
129 Ga0111539_10577310 3300009094 Bacteria 1309
130 Ga0105245_10163410 3300009098 Unclassified 2114
131 Ga0105245_10355825 3300009098 Bacteria 1452
132 Ga0105245_11024602 3300009098 Bacteria 870
133 Ga0105245_11987288 3300009098 Unclassified 635
134 Ga0114129_10268020 3300009147 Unclassified 2286
135 Ga0114129_10643390 3300009147 Bacteria 1369
136 Ga0114129_11276898 3300009147 Bacteria 911
137 Ga0105241_10037753 3300009174 Bacteria 3639
138 Ga0105241_10869904 3300009174 Bacteria 835
139 Ga0105241_11341871 3300009174 Unclassified 683
140 Ga0105242_10057309 3300009176 Unclassified 3190
141 Ga0105248_10031222 3300009177 Bacteria 5954
142 Ga0105248_10293612 3300009177 Bacteria 1830
143 Ga0105248_11439657 3300009177 Unclassified 780
144 Ga0105249_10079566 3300009553 Bacteria 3043
145 Ga0105249_11020120 3300009553 Unclassified 896
146 Ga0105239_10255025 3300010375 Unclassified 1970
147 Ga0105239_11230014 3300010375 Bacteria 863
148 Ga0105239_11751510 3300010375 Unclassified 719
149 Ga0105246_10022012 3300011119 Bacteria 4111
150 Ga0157373_10001837 3300013100 Bacteria 16137
151 Ga0157371_10028177 3300013102 Bacteria 4069
152 Ga0157369_10124983 3300013105 Bacteria 2728
153 Ga0157374_10052267 3300013296 Bacteria 3804
154 Ga0163162_10061933 3300013306 Bacteria 3780
155 Ga0157372_10135986 3300013307 Bacteria 2830
156 Ga0157372_10979111 3300013307 Bacteria 980
157 Ga0157375_10010337 3300013308 Bacteria 8216
158 Ga0157375_10725371 3300013308 Bacteria 1146
159 Ga0157375_13669750 3300013308 Unclassified 510
160 Ga0163163_10037251 3300014325 Bacteria 4730
161 Ga0157377_10000301 3300014745 Bacteria 23220
162 Ga0157377_10298833 3300014745 Bacteria 1062
163 Ga0157376_10003366 3300014969 Bacteria 11002
164 Ga0213875_10202724 3300021388 Bacteria 933
165 Ga0207697_10042371 3300025315 Bacteria 1871
166 Ga0207656_10151908 3300025321 Bacteria 1097
167 Ga0207642_10242373 3300025899 Unclassified 1019
168 Ga0207688_10062658 3300025901 Bacteria 2097
169 Ga0207680_10411468 3300025903 Bacteria 957
170 Ga0207680_10429542 3300025903 Archaea 936
171 Ga0207647_10164272 3300025904 Bacteria 1294
172 Ga0207685_10344658 3300025905 Bacteria 749
173 Ga0207699_10138614 3300025906 Bacteria 1596
174 Ga0207699_10586935 3300025906 Bacteria 811
175 Ga0207645_10348904 3300025907 Bacteria 990
176 Ga0207643_10007393 3300025908 Bacteria 5893
177 Ga0207643_10122402 3300025908 Bacteria 1542
178 Ga0207643_10412329 3300025908 Bacteria 855
179 Ga0207684_10098839 3300025910 Unclassified 2492
180 Ga0207654_10151475 3300025911 Bacteria 1489
181 Ga0207707_10028243 3300025912 Bacteria 4904
182 Ga0207693_10139899 3300025915 Unclassified 1903
183 Ga0207693_10272790 3300025915 Bacteria 1325
184 Ga0207660_10379601 3300025917 Bacteria 1136
185 Ga0207662_10136412 3300025918 Archaea 1551
186 Ga0207662_10883516 3300025918 Unclassified 632
187 Ga0207657_10011766 3300025919 Bacteria 8667
188 Ga0207649_10013428 3300025920 Bacteria 4573
189 Ga0207649_10336951 3300025920 Unclassified 1113
190 Ga0207652_10015246 3300025921 Bacteria 6237
191 Ga0207681_10044441 3300025923 Bacteria 2977
192 Ga0207681_10232744 3300025923 Bacteria 1431
193 Ga0207681_11623882 3300025923 Unclassified 541
194 Ga0207650_10037059 3300025925 Bacteria 3551
195 Ga0207650_10067215 3300025925 Bacteria 2689
196 Ga0207650_10288139 3300025925 Bacteria 1338
197 Ga0207650_11712216 3300025925 Unclassified 533
198 Ga0207659_10054539 3300025926 Bacteria 2855
199 Ga0207659_10235483 3300025926 Bacteria 1479
200 Ga0207687_10121433 3300025927 Bacteria 1955
201 Ga0207700_10916066 3300025928 Unclassified 784
202 Ga0207644_10012984 3300025931 Bacteria 5543
203 Ga0207644_10092880 3300025931 Bacteria 2252
204 Ga0207644_10721075 3300025931 Bacteria 832
205 Ga0207690_10094210 3300025932 Unclassified 2124
206 Ga0207706_10005408 3300025933 Bacteria 11905
207 Ga0207706_10050025 3300025933 Bacteria 3693
208 Ga0207706_10165811 3300025933 Bacteria 1941
209 Ga0207706_11604081 3300025933 Unclassified 527
210 Ga0207686_10056593 3300025934 Unclassified 2466
211 Ga0207670_10013484 3300025936 Bacteria 4822
212 Ga0207704_10140115 3300025938 Bacteria 1690
213 Ga0207704_10419231 3300025938 Unclassified 1061
214 Ga0207665_10459699 3300025939 Unclassified 978
215 Ga0207691_10000448 3300025940 Bacteria 40796
216 Ga0207691_11155928 3300025940 Bacteria 643
217 Ga0207691_11358491 3300025940 Unclassified 585
218 Ga0207711_10042189 3300025941 Bacteria 3887
219 Ga0207711_10052819 3300025941 Bacteria 3484
220 Ga0207711_12004332 3300025941 Unclassified 522
221 Ga0207689_10007389 3300025942 Bacteria 9634
222 Ga0207661_10001687 3300025944 Bacteria 15068
223 Ga0207661_10067558 3300025944 Bacteria 2908
224 Ga0207661_12088455 3300025944 Bacteria 513
225 Ga0207679_10014652 3300025945 Bacteria 5160
226 Ga0207667_10111535 3300025949 Bacteria 2821
227 Ga0207712_10004137 3300025961 Bacteria 9162
228 Ga0207712_10081851 3300025961 Bacteria 2352
229 Ga0207640_10311867 3300025981 Unclassified 1249
230 Ga0207658_10409264 3300025986 Unclassified 1194
231 Ga0207658_10503264 3300025986 Bacteria 1079
232 Ga0207677_10263914 3300026023 Bacteria 1405
233 Ga0207703_11952452 3300026035 Unclassified 563
234 Ga0207639_10310772 3300026041 Bacteria 1396
235 Ga0207678_10337297 3300026067 Bacteria 1299
236 Ga0207708_10160584 3300026075 Bacteria 1774
237 Ga0207702_10047603 3300026078 Bacteria 3614
238 Ga0207702_10948308 3300026078 Bacteria 853
239 Ga0207641_10028691 3300026088 Bacteria 4600
240 Ga0207641_11294618 3300026088 Bacteria 729
241 Ga0207648_10079250 3300026089 Bacteria 2865
242 Ga0207648_10105812 3300026089 Bacteria 2468
243 Ga0207648_10747992 3300026089 Bacteria 908
244 Ga0207676_10007256 3300026095 Bacteria 7851
245 Ga0207676_10383946 3300026095 Bacteria 1308
246 Ga0207676_10642981 3300026095 Unclassified 1023
247 Ga0207676_10646349 3300026095 Bacteria 1020
248 Ga0207674_10000421 3300026116 Bacteria 55179
249 Ga0207674_10008757 3300026116 Bacteria 11650
250 Ga0207675_100069760 3300026118 Bacteria 3285
251 Ga0207675_101392402 3300026118 Unclassified 722
252 Ga0207683_10139600 3300026121 Bacteria 2183
253 Ga0209983_1102479 3300027665 Bacteria 649
254 Ga0209971_1082808 3300027682 Bacteria 782
255 Ga0209998_10008584 3300027717 Bacteria 2119
256 Ga0209974_10079896 3300027876 Bacteria 1124
257 Ga0207428_10360441 3300027907 Unclassified 1069
258 Ga0268265_10700584 3300028380 Unclassified 978
259 Ga0268265_12015510 3300028380 Unclassified 584
260 Ga0268264_10192920 3300028381 Bacteria 1858
261 Ga0268264_11879548 3300028381 Unclassified 608
262 Ga0307511_10288951 3300030521 Bacteria 751
263 Ga0265762_1000576 3300030760 Bacteria 6473
264 Ga0307408_100075118 3300031548 Bacteria 2510
265 Ga0307408_100242494 3300031548 Bacteria 1482
266 Ga0307408_101005086 3300031548 Bacteria 769
267 Ga0307408_101665921 3300031548 Unclassified 607
268 Ga0307405_10236608 3300031731 Bacteria 1350
269 Ga0307405_10697367 3300031731 Bacteria 840
270 Ga0307413_10006492 3300031824 Bacteria 5349
271 Ga0307413_10302819 3300031824 Bacteria 1213
272 Ga0307413_10602228 3300031824 Bacteria 899
273 Ga0307410_10058434 3300031852 Bacteria 2629
274 Ga0307410_10073813 3300031852 Bacteria 2373
275 Ga0307410_11436950 3300031852 Unclassified 606
276 Ga0307406_10151034 3300031901 Bacteria 1657
277 Ga0307407_10269765 3300031903 Bacteria 1174
278 Ga0307407_10330264 3300031903 Bacteria 1073
279 Ga0307407_10849110 3300031903 Bacteria 697
280 Ga0307412_10638871 3300031911 Bacteria 906
281 Ga0307409_100139623 3300031995 Bacteria 2086
282 Ga0307409_101684050 3300031995 Bacteria 663
283 Ga0307409_101745441 3300031995 Bacteria 651
284 Ga0307416_101359078 3300032002 Unclassified 816
285 Ga0307416_102761471 3300032002 Bacteria 587
286 Ga0307416_102972780 3300032002 Unclassified 567
287 Ga0307414_10047439 3300032004 Bacteria 2956
288 Ga0307414_10579489 3300032004 Bacteria 1004
289 Ga0307411_10010863 3300032005 Bacteria 4879
290 Ga0307411_10243207 3300032005 Unclassified 1410
291 Ga0307411_10328310 3300032005 Bacteria 1238
292 Ga0307415_100212620 3300032126 Unclassified 1544
293 Ga0307415_100305849 3300032126 Bacteria 1319
294 Ga0307415_100502309 3300032126 Bacteria 1060
295 Ga0373958_0019816 3300034819 Bacteria 1233
296 Ga0373952_0020746 3300035092 Unclassified 1380
297 Ga0373943_0175397 3300035170 Bacteria 1175
298 Ga0373946_0245742 3300035171 Unclassified 871
299 Ga0373946_0768135 3300035171 Unclassified 506
300 Ga0373962_0137593 3300035242 Unclassified 791
301 Ga0373931_0010987 3300035691 Unclassified 4365
302 Ga0373935_0524336 3300035692 Unclassified 862
303 Ga0373927_0216436 3300035695 Bacteria 1258
304 Ga0373947_0005752 3300035725 Bacteria 7230
305 Ga0373947_0046039 3300035725 Unclassified 2611
306 Ga0373937_0213835 3300036401 Bacteria 1814
307 Ga0373937_0568284 3300036401 Unclassified 1077
308 Ga0373925_0021145 3300037068 Bacteria 4740
309 Ga0373925_0062889 3300037068 Unclassified 2792
310 Ga0373925_0810988 3300037068 Unclassified 772
311 Ga0395898_1988322 3300037466 Unclassified 501
312 Ga0395905_0087159 3300037471 Bacteria 2927
313 Ga0395905_0100110 3300037471 Bacteria 2721
314 Ga0436364_0995426 3300037853 Bacteria 1000
315 Ga0395901_1827824 3300038443 Unclassified 556
316 Ga0436365_1383187 3300039437 Bacteria 806
317 Ga0466967_0124027 3300045976 Bacteria 2391
318 Ga0466967_0784648 3300045976 Unclassified 946
319 Ga0495641_0010584 3300046461 Bacteria 5327
320 Ga0495580_0041829 3300046472 Bacteria 3267
321 Ga0495580_0114660 3300046472 Bacteria 1872
322 Ga0495582_0008213 3300046473 Bacteria 5760
323 Ga0495662_0022173 3300046476 Bacteria 3068
324 Ga0495664_0017273 3300046477 Bacteria 4124
325 Ga0495628_0046005 3300046516 Bacteria 3468
326 Ga0495630_0027182 3300046517 Bacteria 4241
327 Ga0495666_0008350 3300046526 Bacteria 5189
328 Ga0495666_0017579 3300046526 Bacteria 3561
329 Ga0495665_0009743 3300046531 Bacteria 5200
330 Ga0495640_0019422 3300046533 Bacteria 5015
331 Ga0495586_0001912 3300046535 Bacteria 11342
332 Ga0495586_0893951 3300046535 Bacteria 512
333 Ga0495621_0271760 3300046539 Bacteria 697
334 Ga0495622_0228822 3300046557 Unclassified 822
335 Ga0495667_0457580 3300046559 Bacteria 801
336 Ga0495634_0002414 3300046642 Bacteria 15554
337 Ga0495659_0081588 3300046664 Bacteria 1228
338 Ga0495647_0018775 3300046681 Bacteria 2466
339 Ga0495658_0004380 3300046683 Bacteria 6951
340 Ga0495624_0455332 3300046690 Bacteria 766
341 Ga0495670_0270684 3300046691 Bacteria 907
342 Ga0495674_0011963 3300047319 Bacteria 8183
343 Ga0495674_0378162 3300047319 Bacteria 1146
344 Ga0495676_0015714 3300047321 Bacteria 6730
345 Ga0495680_0026403 3300047322 Bacteria 4787
346 Ga0495684_0051356 3300047471 Bacteria 3147
347 Ga0495614_0284246 3300048089 Bacteria 762
348 Ga0496101_0805126 3300048904 Archaea 741
349 Ga0496102_0227865 3300048905 Bacteria 1757
350 Ga0496104_1520975 3300048907 Unclassified 572
351 Ga0496106_0208882 3300048909 Bacteria 1555
352 Ga0496106_0359335 3300048909 Unclassified 1170
353 Ga0496108_0226114 3300048911 Bacteria 1626
354 Ga0496109_0706241 3300048912 Unclassified 946
355 Ga0496110_0007343 3300048913 Bacteria 8797
356 Ga0496111_0447168 3300048914 Unclassified 953
357 Ga0496112_0001305 3300048915 Bacteria 18935
358 Ga0496112_0038131 3300048915 Bacteria 4692
359 Ga0496112_0122850 3300048915 Bacteria 2567
360 Ga0496113_0937985 3300048916 Bacteria 683
361 Ga0496114_0310026 3300048917 Bacteria 1394
362 Ga0501032_0614470 3300049569 Bacteria 691
363 Ga0501039_0046401 3300049575 Bacteria 3356
364 Ga0501046_0764073 3300049580 Bacteria 678
365 Ga0501071_0023709 3300049587 Bacteria 4287
366 Ga0501075_1044816 3300049591 Unclassified 620
367 Ga0501076_0036933 3300049592 Bacteria 3829
368 Ga0501233_038896 3300049668 Bacteria 1110
369 Ga0501079_0037349 3300049741 Bacteria 3744
370 Ga0501080_1498467 3300049742 Unclassified 573
371 Ga0501045_0007212 3300049824 Bacteria 7715
372 nmdc:mga05p37_142076_c1 3300050507 Bacteria 2940
373 nmdc:mga05p37_2066941_c1 3300050507 Unclassified 535
374 nmdc:mga05p37_900070_c1 3300050507 Bacteria 954
375 nmdc:mga09592_314060_c1 3300050508 Bacteria 1358
376 nmdc:mga0qj67_1191127_c1 3300050509 Unclassified 593
377 nmdc:mga0qj67_1556166_c1 3300050509 Bacteria 508
378 nmdc:mga0qj67_643663_c1 3300050509 Bacteria 846
379 nmdc:mga06r32_237026_c1 3300050510 Bacteria 1812
380 nmdc:mga06r32_39025_c1 3300050510 Bacteria 4504
381 nmdc:mga06r32_85_c1 3300050510 Bacteria 64050
382 nmdc:mga06r32_916820_c1 3300050510 Bacteria 832
383 nmdc:mga08y16_1485707_c1 3300050511 Bacteria 638
384 nmdc:mga08y16_227872_c1 3300050511 Unclassified 1928
385 nmdc:mga0n895_372237_c1 3300050512 Bacteria 1446
386 nmdc:mga0a205_731392_c1 3300050515 Bacteria 839
387 Ga0495619_0566238 3300053085 Bacteria 779
388 Ga0501082_0086625 3300060353 Bacteria 2702
389 Ga0530510_0800034 3300061734 Bacteria 719

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100196721 Ga0070683_1001967212 100
2 3300005331 Ga0070670_100093162 Ga0070670_1000931622 100
3 3300005334 Ga0068869_100044947 Ga0068869_1000449472 100
4 3300005335 Ga0070666_10317921 Ga0070666_103179213 100
5 3300005336 Ga0070680_100048924 Ga0070680_1000489242 100
6 3300005337 Ga0070682_100006292 Ga0070682_1000062925 100
7 3300005338 Ga0068868_100271409 Ga0068868_1002714093 100
8 3300005339 Ga0070660_100002803 Ga0070660_1000028035 100
9 3300005340 Ga0070689_100072648 Ga0070689_1000726482 100
10 3300005341 Ga0070691_10158928 Ga0070691_101589283 100
11 3300005343 Ga0070687_100488326 Ga0070687_1004883262 100
12 3300005344 Ga0070661_100022268 Ga0070661_1000222685 100
13 3300005345 Ga0070692_10014401 Ga0070692_100144013 100
14 3300005354 Ga0070675_100005332 Ga0070675_1000053323 100
15 3300005365 Ga0070688_100262900 Ga0070688_1002629002 100
16 3300005366 Ga0070659_100049798 Ga0070659_1000497982 100
17 3300005367 Ga0070667_102077990 Ga0070667_1020779901 100
18 3300005457 Ga0070662_100033684 Ga0070662_1000336843 100
19 3300005457 Ga0070662_100223792 Ga0070662_1002237922 100
20 3300005530 Ga0070679_100009326 Ga0070679_1000093267 100
21 3300005535 Ga0070684_100055332 Ga0070684_1000553325 100
22 3300005539 Ga0068853_100488131 Ga0068853_1004881312 100
23 3300005545 Ga0070695_100160117 Ga0070695_1001601172 100
24 3300005547 Ga0070693_100287984 Ga0070693_1002879842 100
25 3300005563 Ga0068855_100149909 Ga0068855_1001499092 100
26 3300005564 Ga0070664_100391147 Ga0070664_1003911473 100
27 3300005577 Ga0068857_100404577 Ga0068857_1004045773 100
28 3300005615 Ga0070702_100015880 Ga0070702_1000158802 100
29 3300005617 Ga0068859_100049648 Ga0068859_1000496484 100
30 3300005618 Ga0068864_100011549 Ga0068864_1000115495 100
31 3300005840 Ga0068870_10258732 Ga0068870_102587322 100
32 3300005841 Ga0068863_100013713 Ga0068863_1000137135 100
33 3300005842 Ga0068858_100784531 Ga0068858_1007845312 100
34 3300005843 Ga0068860_100099650 Ga0068860_1000996502 100
35 3300006237 Ga0097621_100072877 Ga0097621_1000728772 100
36 3300006358 Ga0068871_100003295 Ga0068871_1000032955 100
37 3300006880 Ga0075429_100451173 Ga0075429_1004511732 100
38 3300006931 Ga0097620_100049648 Ga0097620_1000496484 100
39 3300009093 Ga0105240_11521383 Ga0105240_115213832 100
40 3300009098 Ga0105245_10163410 Ga0105245_101634103 100
41 3300009098 Ga0105245_10355825 Ga0105245_103558252 100
42 3300009174 Ga0105241_10037753 Ga0105241_100377532 100
43 3300009176 Ga0105242_10057309 Ga0105242_100573092 100
44 3300009177 Ga0105248_10031222 Ga0105248_100312222 100
45 3300010375 Ga0105239_10255025 Ga0105239_102550254 100
46 3300010375 Ga0105239_11751510 Ga0105239_117515102 100
47 3300011119 Ga0105246_10022012 Ga0105246_100220123 100
48 3300013100 Ga0157373_10001837 Ga0157373_100018375 100
49 3300013102 Ga0157371_10028177 Ga0157371_100281774 100
50 3300013105 Ga0157369_10124983 Ga0157369_101249832 100
51 3300013296 Ga0157374_10052267 Ga0157374_100522672 100
52 3300013307 Ga0157372_10135986 Ga0157372_101359865 100
53 3300013307 Ga0157372_10979111 Ga0157372_109791111 100
54 3300014325 Ga0163163_10037251 Ga0163163_100372512 100
55 3300014745 Ga0157377_10000301 Ga0157377_1000030119 100
56 3300014969 Ga0157376_10003366 Ga0157376_100033668 100
57 3300025315 Ga0207697_10042371 Ga0207697_100423712 100
58 3300025321 Ga0207656_10151908 Ga0207656_101519083 100
59 3300025903 Ga0207680_10411468 Ga0207680_104114682 100
60 3300025904 Ga0207647_10164272 Ga0207647_101642722 100
61 3300025908 Ga0207643_10412329 Ga0207643_104123292 100
62 3300025911 Ga0207654_10151475 Ga0207654_101514752 100
63 3300025912 Ga0207707_10028243 Ga0207707_100282433 100
64 3300025918 Ga0207662_10136412 Ga0207662_101364122 100
65 3300025919 Ga0207657_10011766 Ga0207657_100117667 100
66 3300025920 Ga0207649_10013428 Ga0207649_100134282 100
67 3300025921 Ga0207652_10015246 Ga0207652_100152465 100
68 3300025923 Ga0207681_10044441 Ga0207681_100444415 100
69 3300025925 Ga0207650_10067215 Ga0207650_100672152 100
70 3300025926 Ga0207659_10054539 Ga0207659_100545392 100
71 3300025927 Ga0207687_10121433 Ga0207687_101214332 100
72 3300025932 Ga0207690_10094210 Ga0207690_100942104 100
73 3300025933 Ga0207706_10005408 Ga0207706_100054084 100
74 3300025933 Ga0207706_10165811 Ga0207706_101658112 100
75 3300025934 Ga0207686_10056593 Ga0207686_100565931 100
76 3300025936 Ga0207670_10013484 Ga0207670_100134842 100
77 3300025940 Ga0207691_11155928 Ga0207691_111559282 100
78 3300025941 Ga0207711_10042189 Ga0207711_100421893 100
79 3300025942 Ga0207689_10007389 Ga0207689_100073892 100
80 3300025944 Ga0207661_10001687 Ga0207661_100016873 100
81 3300025945 Ga0207679_10014652 Ga0207679_100146523 100
82 3300025949 Ga0207667_10111535 Ga0207667_101115352 100
83 3300025986 Ga0207658_10503264 Ga0207658_105032641 100
84 3300026023 Ga0207677_10263914 Ga0207677_102639142 100
85 3300026041 Ga0207639_10310772 Ga0207639_103107722 100
86 3300026067 Ga0207678_10337297 Ga0207678_103372971 100
87 3300026078 Ga0207702_10047603 Ga0207702_100476032 100
88 3300026088 Ga0207641_10028691 Ga0207641_100286914 100
89 3300026095 Ga0207676_10007256 Ga0207676_100072565 100
90 3300026116 Ga0207674_10000421 Ga0207674_1000042146 100
91 3300028381 Ga0268264_10192920 Ga0268264_101929203 100
92 3300005545 Ga0070695_101654963 Ga0070695_1016549631 101
93 3300046531 Ga0495665_0009743 Ga0495665_0009743_1025_1399 101
94 3300046557 Ga0495622_0228822 Ga0495622_0228822_401_775 101
95 3300048089 Ga0495614_0284246 Ga0495614_0284246_137_511 101
96 3300026118 Ga0207675_101392402 Ga0207675_1013924021 103
97 3300031548 Ga0307408_100242494 Ga0307408_1002424942 104
98 3300025910 Ga0207684_10098839 Ga0207684_100988393 106
99 iso_pu_bacteria 8006984368 8006986791 106
100 3300005328 Ga0070676_10158260 Ga0070676_101582602 110
101 3300005331 Ga0070670_100231758 Ga0070670_1002317582 110
102 3300005335 Ga0070666_10440045 Ga0070666_104400452 110
103 3300005338 Ga0068868_100260461 Ga0068868_1002604612 110
104 3300005355 Ga0070671_100359954 Ga0070671_1003599542 110
105 3300005364 Ga0070673_100128132 Ga0070673_1001281322 110
106 3300005367 Ga0070667_100173604 Ga0070667_1001736041 110
107 3300005367 Ga0070667_100978319 Ga0070667_1009783192 110
108 3300005436 Ga0070713_100242899 Ga0070713_1002428992 110
109 3300005438 Ga0070701_11029424 Ga0070701_110294241 110
110 3300005441 Ga0070700_100337195 Ga0070700_1003371952 110
111 3300005467 Ga0070706_101004994 Ga0070706_1010049942 110
112 3300005543 Ga0070672_100538073 Ga0070672_1005380732 110
113 3300005546 Ga0070696_100730806 Ga0070696_1007308062 110
114 3300005614 Ga0068856_102224740 Ga0068856_1022247401 110
115 3300005843 Ga0068860_100221576 Ga0068860_1002215762 110
116 3300005843 Ga0068860_102326915 Ga0068860_1023269152 110
117 3300005844 Ga0068862_100770599 Ga0068862_1007705992 110
118 3300005844 Ga0068862_102488750 Ga0068862_1024887501 110
119 3300006028 Ga0070717_10106383 Ga0070717_101063833 110
120 3300006163 Ga0070715_10317316 Ga0070715_103173162 110
121 3300006173 Ga0070716_100917399 Ga0070716_1009173992 110
122 3300006237 Ga0097621_100076536 Ga0097621_1000765362 110
123 3300006237 Ga0097621_100924898 Ga0097621_1009248981 110
124 3300006358 Ga0068871_100005659 Ga0068871_1000056597 110
125 3300006844 Ga0075428_100010980 Ga0075428_1000109807 110
126 3300006844 Ga0075428_100030838 Ga0075428_1000308388 110
127 3300006846 Ga0075430_100568320 Ga0075430_1005683201 110
128 3300006846 Ga0075430_101432350 Ga0075430_1014323501 110
129 3300006847 Ga0075431_100000029 Ga0075431_10000002952 110
130 3300006847 Ga0075431_100086156 Ga0075431_1000861563 110
131 3300006880 Ga0075429_100328274 Ga0075429_1003282742 110
132 3300006881 Ga0068865_100079097 Ga0068865_1000790972 110
133 3300009092 Ga0105250_10199721 Ga0105250_101997211 110
134 3300009098 Ga0105245_11024602 Ga0105245_110246021 110
135 3300009147 Ga0114129_11276898 Ga0114129_112768982 110
136 3300009174 Ga0105241_11341871 Ga0105241_113418712 110
137 3300009553 Ga0105249_10079566 Ga0105249_100795664 110
138 3300010375 Ga0105239_11230014 Ga0105239_112300141 110
139 3300013306 Ga0163162_10061933 Ga0163162_100619333 110
140 3300013308 Ga0157375_13669750 Ga0157375_136697502 110
141 3300025903 Ga0207680_10429542 Ga0207680_104295422 110
142 3300025905 Ga0207685_10344658 Ga0207685_103446581 110
143 3300025906 Ga0207699_10138614 Ga0207699_101386142 110
144 3300025906 Ga0207699_10586935 Ga0207699_105869352 110
145 3300025907 Ga0207645_10348904 Ga0207645_103489042 110
146 3300025908 Ga0207643_10007393 Ga0207643_100073932 110
147 3300025915 Ga0207693_10139899 Ga0207693_101398992 110
148 3300025918 Ga0207662_10883516 Ga0207662_108835162 110
149 3300025923 Ga0207681_10232744 Ga0207681_102327443 110
150 3300025925 Ga0207650_10037059 Ga0207650_100370593 110
151 3300025925 Ga0207650_10288139 Ga0207650_102881393 110
152 3300025928 Ga0207700_10916066 Ga0207700_109160661 110
153 3300025931 Ga0207644_10092880 Ga0207644_100928802 110
154 3300025933 Ga0207706_11604081 Ga0207706_116040812 110
155 3300025939 Ga0207665_10459699 Ga0207665_104596992 110
156 3300025940 Ga0207691_11358491 Ga0207691_113584911 110
157 3300025941 Ga0207711_12004332 Ga0207711_120043322 110
158 3300025961 Ga0207712_10004137 Ga0207712_100041378 110
159 3300025961 Ga0207712_10081851 Ga0207712_100818513 110
160 3300025986 Ga0207658_10409264 Ga0207658_104092643 110
161 3300026089 Ga0207648_10079250 Ga0207648_100792503 110
162 3300026095 Ga0207676_10642981 Ga0207676_106429812 110
163 3300026116 Ga0207674_10008757 Ga0207674_100087574 110
164 3300026118 Ga0207675_100069760 Ga0207675_1000697603 110
165 3300027665 Ga0209983_1102479 Ga0209983_11024791 110
166 3300027682 Ga0209971_1082808 Ga0209971_10828082 110
167 3300027717 Ga0209998_10008584 Ga0209998_100085843 110
168 3300027876 Ga0209974_10079896 Ga0209974_100798962 110
169 3300027907 Ga0207428_10360441 Ga0207428_103604411 110
170 3300028380 Ga0268265_10700584 Ga0268265_107005841 110
171 3300028380 Ga0268265_12015510 Ga0268265_120155101 110
172 3300028381 Ga0268264_11879548 Ga0268264_118795481 110
173 3300030760 Ga0265762_1000576 Ga0265762_10005762 110
174 3300031548 Ga0307408_101005086 Ga0307408_1010050861 110
175 3300031731 Ga0307405_10697367 Ga0307405_106973673 110
176 3300031824 Ga0307413_10602228 Ga0307413_106022282 110
177 3300031852 Ga0307410_10073813 Ga0307410_100738131 110
178 3300031901 Ga0307406_10151034 Ga0307406_101510341 110
179 3300031903 Ga0307407_10849110 Ga0307407_108491101 110
180 3300031911 Ga0307412_10638871 Ga0307412_106388712 110
181 3300031995 Ga0307409_101684050 Ga0307409_1016840502 110
182 3300032002 Ga0307416_101359078 Ga0307416_1013590781 110
183 3300032002 Ga0307416_102761471 Ga0307416_1027614712 110
184 3300032005 Ga0307411_10328310 Ga0307411_103283103 110
185 3300032126 Ga0307415_100502309 Ga0307415_1005023092 110
186 3300035170 Ga0373943_0175397 Ga0373943_0175397_120_452 110
187 3300035171 Ga0373946_0768135 Ga0373946_0768135_24_356 110
188 3300035692 Ga0373935_0524336 Ga0373935_0524336_26_358 110
189 3300035725 Ga0373947_0046039 Ga0373947_0046039_1172_1504 110
190 3300037068 Ga0373925_0062889 Ga0373925_0062889_1083_1415 110
191 3300037068 Ga0373925_0810988 Ga0373925_0810988_139_471 110
192 3300038443 Ga0395901_1827824 Ga0395901_1827824_214_546 110
193 3300039437 Ga0436365_1383187 Ga0436365_1383187_331_663 110
194 3300045976 Ga0466967_0124027 Ga0466967_0124027_1295_1627 110
195 3300045976 Ga0466967_0784648 Ga0466967_0784648_113_445 110
196 3300046472 Ga0495580_0114660 Ga0495580_0114660_1468_1800 110
197 3300047319 Ga0495674_0378162 Ga0495674_0378162_387_719 110
198 3300048904 Ga0496101_0805126 Ga0496101_0805126_171_503 110
199 3300048907 Ga0496104_1520975 Ga0496104_1520975_224_556 110
200 3300048915 Ga0496112_0122850 Ga0496112_0122850_1076_1408 110
201 3300049569 Ga0501032_0614470 Ga0501032_0614470_316_648 110
202 3300049575 Ga0501039_0046401 Ga0501039_0046401_2918_3250 110
203 3300049580 Ga0501046_0764073 Ga0501046_0764073_98_430 110
204 3300049587 Ga0501071_0023709 Ga0501071_0023709_2755_3087 110
205 3300049591 Ga0501075_1044816 Ga0501075_1044816_129_461 110
206 3300049592 Ga0501076_0036933 Ga0501076_0036933_3344_3676 110
207 3300049668 Ga0501233_038896 Ga0501233_038896_737_1069 110
208 3300049741 Ga0501079_0037349 Ga0501079_0037349_3326_3658 110
209 3300049742 Ga0501080_1498467 Ga0501080_1498467_130_462 110
210 3300049824 Ga0501045_0007212 Ga0501045_0007212_2265_2597 110
211 3300050507 nmdc:mga05p37_900070_c1 nmdc:mga05p37_900070_c1_415_747 110
212 3300050508 nmdc:mga09592_314060_c1 nmdc:mga09592_314060_c1_480_812 110
213 3300050509 nmdc:mga0qj67_1191127_c1 nmdc:mga0qj67_1191127_c1_59_391 110
214 3300050509 nmdc:mga0qj67_643663_c1 nmdc:mga0qj67_643663_c1_438_770 110
215 3300050510 nmdc:mga06r32_237026_c1 nmdc:mga06r32_237026_c1_1215_1547 110
216 3300050510 nmdc:mga06r32_85_c1 nmdc:mga06r32_85_c1_47206_47538 110
217 3300050510 nmdc:mga06r32_916820_c1 nmdc:mga06r32_916820_c1_41_373 110
218 3300050511 nmdc:mga08y16_1485707_c1 nmdc:mga08y16_1485707_c1_146_478 110
219 3300050511 nmdc:mga08y16_227872_c1 nmdc:mga08y16_227872_c1_1136_1468 110
220 3300060353 Ga0501082_0086625 Ga0501082_0086625_75_407 110
221 3300061734 Ga0530510_0800034 Ga0530510_0800034_261_593 110
222 3300005329 Ga0070683_101106055 Ga0070683_1011060551 111
223 3300005336 Ga0070680_100519750 Ga0070680_1005197502 111
224 3300005344 Ga0070661_100314796 Ga0070661_1003147962 111
225 3300005353 Ga0070669_100136876 Ga0070669_1001368764 111
226 3300005354 Ga0070675_100031757 Ga0070675_1000317575 111
227 3300005355 Ga0070671_100001970 Ga0070671_10000197019 111
228 3300005356 Ga0070674_100027822 Ga0070674_1000278222 111
229 3300005364 Ga0070673_100046339 Ga0070673_1000463394 111
230 3300005440 Ga0070705_100102042 Ga0070705_1001020423 111
231 3300005457 Ga0070662_100010807 Ga0070662_1000108072 111
232 3300005457 Ga0070662_101500607 Ga0070662_1015006072 111
233 3300005459 Ga0068867_100056232 Ga0068867_1000562324 111
234 3300005518 Ga0070699_100828791 Ga0070699_1008287911 111
235 3300005535 Ga0070684_100105439 Ga0070684_1001054393 111
236 3300005543 Ga0070672_100008964 Ga0070672_1000089647 111
237 3300005578 Ga0068854_100596053 Ga0068854_1005960532 111
238 3300005617 Ga0068859_103082916 Ga0068859_1030829161 111
239 3300005618 Ga0068864_100206816 Ga0068864_1002068164 111
240 3300005718 Ga0068866_10213496 Ga0068866_102134962 111
241 3300005719 Ga0068861_101363787 Ga0068861_1013637871 111
242 3300005840 Ga0068870_10131906 Ga0068870_101319061 111
243 3300005841 Ga0068863_100634961 Ga0068863_1006349612 111
244 3300005844 Ga0068862_100238532 Ga0068862_1002385324 111
245 3300006846 Ga0075430_100145908 Ga0075430_1001459082 111
246 3300006846 Ga0075430_100401096 Ga0075430_1004010961 111
247 3300006847 Ga0075431_100014007 Ga0075431_1000140073 111
248 3300006852 Ga0075433_11454707 Ga0075433_114547072 111
249 3300006881 Ga0068865_100144970 Ga0068865_1001449701 111
250 3300006881 Ga0068865_100535018 Ga0068865_1005350182 111
251 3300006931 Ga0097620_103083951 Ga0097620_1030839511 111
252 3300009098 Ga0105245_11987288 Ga0105245_119872882 111
253 3300009147 Ga0114129_10643390 Ga0114129_106433902 111
254 3300009177 Ga0105248_10293612 Ga0105248_102936121 111
255 3300009177 Ga0105248_11439657 Ga0105248_114396572 111
256 3300009553 Ga0105249_11020120 Ga0105249_110201201 111
257 3300013308 Ga0157375_10010337 Ga0157375_100103374 111
258 3300014745 Ga0157377_10298833 Ga0157377_102988333 111
259 3300021388 Ga0213875_10202724 Ga0213875_102027242 111
260 3300025899 Ga0207642_10242373 Ga0207642_102423732 111
261 3300025901 Ga0207688_10062658 Ga0207688_100626584 111
262 3300025908 Ga0207643_10122402 Ga0207643_101224022 111
263 3300025915 Ga0207693_10272790 Ga0207693_102727903 111
264 3300025917 Ga0207660_10379601 Ga0207660_103796012 111
265 3300025920 Ga0207649_10336951 Ga0207649_103369511 111
266 3300025923 Ga0207681_11623882 Ga0207681_116238821 111
267 3300025926 Ga0207659_10235483 Ga0207659_102354833 111
268 3300025931 Ga0207644_10012984 Ga0207644_100129845 111
269 3300025933 Ga0207706_10050025 Ga0207706_100500253 111
270 3300025938 Ga0207704_10140115 Ga0207704_101401151 111
271 3300025938 Ga0207704_10419231 Ga0207704_104192312 111
272 3300025940 Ga0207691_10000448 Ga0207691_1000044815 111
273 3300025941 Ga0207711_10052819 Ga0207711_100528194 111
274 3300025944 Ga0207661_10067558 Ga0207661_100675585 111
275 3300025981 Ga0207640_10311867 Ga0207640_103118671 111
276 3300026088 Ga0207641_11294618 Ga0207641_112946182 111
277 3300026089 Ga0207648_10105812 Ga0207648_101058123 111
278 3300026089 Ga0207648_10747992 Ga0207648_107479922 111
279 3300026121 Ga0207683_10139600 Ga0207683_101396002 111
280 3300030521 Ga0307511_10288951 Ga0307511_102889511 111
281 3300031548 Ga0307408_100075118 Ga0307408_1000751182 111
282 3300031731 Ga0307405_10236608 Ga0307405_102366082 111
283 3300031824 Ga0307413_10006492 Ga0307413_100064927 111
284 3300031852 Ga0307410_10058434 Ga0307410_100584345 111
285 3300031852 Ga0307410_11436950 Ga0307410_114369502 111
286 3300031903 Ga0307407_10330264 Ga0307407_103302643 111
287 3300031995 Ga0307409_100139623 Ga0307409_1001396234 111
288 3300032002 Ga0307416_102972780 Ga0307416_1029727802 111
289 3300032004 Ga0307414_10047439 Ga0307414_100474396 111
290 3300032005 Ga0307411_10010863 Ga0307411_100108634 111
291 3300032005 Ga0307411_10243207 Ga0307411_102432072 111
292 3300032126 Ga0307415_100212620 Ga0307415_1002126204 111
293 3300032126 Ga0307415_100305849 Ga0307415_1003058492 111
294 3300035242 Ga0373962_0137593 Ga0373962_0137593_153_488 111
295 3300035691 Ga0373931_0010987 Ga0373931_0010987_1804_2139 111
296 3300036401 Ga0373937_0213835 Ga0373937_0213835_429_764 111
297 3300036401 Ga0373937_0568284 Ga0373937_0568284_458_793 111
298 3300037466 Ga0395898_1988322 Ga0395898_1988322_17_352 111
299 3300037471 Ga0395905_0087159 Ga0395905_0087159_212_547 111
300 3300037471 Ga0395905_0100110 Ga0395905_0100110_640_975 111
301 3300037853 Ga0436364_0995426 Ga0436364_0995426_354_689 111
302 3300046461 Ga0495641_0010584 Ga0495641_0010584_3165_3500 111
303 3300046472 Ga0495580_0041829 Ga0495580_0041829_1514_1888 111
304 3300046473 Ga0495582_0008213 Ga0495582_0008213_3445_3780 111
305 3300046476 Ga0495662_0022173 Ga0495662_0022173_1880_2215 111
306 3300046477 Ga0495664_0017273 Ga0495664_0017273_1290_1625 111
307 3300046516 Ga0495628_0046005 Ga0495628_0046005_1548_1883 111
308 3300046517 Ga0495630_0027182 Ga0495630_0027182_1807_2142 111
309 3300046526 Ga0495666_0008350 Ga0495666_0008350_1128_1463 111
310 3300046533 Ga0495640_0019422 Ga0495640_0019422_3603_3938 111
311 3300046535 Ga0495586_0001912 Ga0495586_0001912_8979_9314 111
312 3300046535 Ga0495586_0893951 Ga0495586_0893951_39_374 111
313 3300046539 Ga0495621_0271760 Ga0495621_0271760_97_432 111
314 3300046559 Ga0495667_0457580 Ga0495667_0457580_406_741 111
315 3300046642 Ga0495634_0002414 Ga0495634_0002414_867_1202 111
316 3300046664 Ga0495659_0081588 Ga0495659_0081588_257_592 111
317 3300046681 Ga0495647_0018775 Ga0495647_0018775_1653_1988 111
318 3300046683 Ga0495658_0004380 Ga0495658_0004380_5613_5948 111
319 3300046690 Ga0495624_0455332 Ga0495624_0455332_93_428 111
320 3300046691 Ga0495670_0270684 Ga0495670_0270684_550_885 111
321 3300047319 Ga0495674_0011963 Ga0495674_0011963_3744_4079 111
322 3300047321 Ga0495676_0015714 Ga0495676_0015714_3413_3748 111
323 3300047322 Ga0495680_0026403 Ga0495680_0026403_3627_3962 111
324 3300047471 Ga0495684_0051356 Ga0495684_0051356_854_1189 111
325 3300048909 Ga0496106_0208882 Ga0496106_0208882_745_1080 111
326 3300048911 Ga0496108_0226114 Ga0496108_0226114_933_1268 111
327 3300048913 Ga0496110_0007343 Ga0496110_0007343_7982_8317 111
328 3300048914 Ga0496111_0447168 Ga0496111_0447168_581_916 111
329 3300048915 Ga0496112_0038131 Ga0496112_0038131_525_860 111
330 3300050507 nmdc:mga05p37_142076_c1 nmdc:mga05p37_142076_c1_660_995 111
331 3300050507 nmdc:mga05p37_2066941_c1 nmdc:mga05p37_2066941_c1_146_481 111
332 3300050509 nmdc:mga0qj67_1556166_c1 nmdc:mga0qj67_1556166_c1_25_360 111
333 3300050510 nmdc:mga06r32_39025_c1 nmdc:mga06r32_39025_c1_1691_2026 111
334 3300053085 Ga0495619_0566238 Ga0495619_0566238_213_548 111
335 3300005841 Ga0068863_102305426 Ga0068863_1023054261 112
336 3300006847 Ga0075431_101198791 Ga0075431_1011987912 112
337 3300006914 Ga0075436_100003773 Ga0075436_1000037734 112
338 3300006914 Ga0075436_100174320 Ga0075436_1001743202 112
339 3300009094 Ga0111539_10577310 Ga0111539_105773102 112
340 3300025944 Ga0207661_12088455 Ga0207661_120884551 112
341 3300031824 Ga0307413_10302819 Ga0307413_103028191 112
342 3300031903 Ga0307407_10269765 Ga0307407_102697652 112
343 3300031995 Ga0307409_101745441 Ga0307409_1017454412 112
344 3300035171 Ga0373946_0245742 Ga0373946_0245742_505_843 112
345 3300035695 Ga0373927_0216436 Ga0373927_0216436_732_1070 112
346 3300035725 Ga0373947_0005752 Ga0373947_0005752_3383_3721 112
347 3300037068 Ga0373925_0021145 Ga0373925_0021145_214_552 112
348 3300046526 Ga0495666_0017579 Ga0495666_0017579_42_380 112
349 3300005334 Ga0068869_100870590 Ga0068869_1008705901 113
350 3300026075 Ga0207708_10160584 Ga0207708_101605842 113
351 3300026095 Ga0207676_10646349 Ga0207676_106463492 113
352 3300031548 Ga0307408_101665921 Ga0307408_1016659211 113
353 3300048917 Ga0496114_0310026 Ga0496114_0310026_407_748 113
354 3300005288 Ga0065714_10227872 Ga0065714_102278722 114
355 3300005293 Ga0065715_10108592 Ga0065715_101085926 114
356 3300005327 Ga0070658_11483870 Ga0070658_114838701 114
357 3300005355 Ga0070671_100795676 Ga0070671_1007956762 114
358 3300005406 Ga0070703_10213538 Ga0070703_102135382 114
359 3300005440 Ga0070705_100048927 Ga0070705_1000489273 114
360 3300005444 Ga0070694_100586493 Ga0070694_1005864932 114
361 3300005467 Ga0070706_101319782 Ga0070706_1013197821 114
362 3300005467 Ga0070706_102159193 Ga0070706_1021591931 114
363 3300005471 Ga0070698_100001876 Ga0070698_1000018769 114
364 3300005518 Ga0070699_100014194 Ga0070699_1000141942 114
365 3300005535 Ga0070684_100150525 Ga0070684_1001505251 114
366 3300005536 Ga0070697_100328151 Ga0070697_1003281512 114
367 3300005546 Ga0070696_100000076 Ga0070696_10000007660 114
368 3300005614 Ga0068856_100943984 Ga0068856_1009439841 114
369 3300005618 Ga0068864_100063503 Ga0068864_1000635031 114
370 3300006852 Ga0075433_10082210 Ga0075433_100822104 114
371 3300006871 Ga0075434_100119742 Ga0075434_1001197423 114
372 3300007076 Ga0075435_100191355 Ga0075435_1001913552 114
373 3300009147 Ga0114129_10268020 Ga0114129_102680202 114
374 3300009174 Ga0105241_10869904 Ga0105241_108699041 114
375 3300013308 Ga0157375_10725371 Ga0157375_107253712 114
376 3300025925 Ga0207650_11712216 Ga0207650_117122161 114
377 3300025931 Ga0207644_10721075 Ga0207644_107210752 114
378 3300026035 Ga0207703_11952452 Ga0207703_119524521 114
379 3300026078 Ga0207702_10948308 Ga0207702_109483082 114
380 3300026095 Ga0207676_10383946 Ga0207676_103839461 114
381 3300032004 Ga0307414_10579489 Ga0307414_105794891 114
382 3300034819 Ga0373958_0019816 Ga0373958_0019816_114_458 114
383 3300035092 Ga0373952_0020746 Ga0373952_0020746_350_694 114
384 3300048905 Ga0496102_0227865 Ga0496102_0227865_839_1189 114
385 3300048909 Ga0496106_0359335 Ga0496106_0359335_408_758 114
386 3300048912 Ga0496109_0706241 Ga0496109_0706241_202_546 114
387 3300048915 Ga0496112_0001305 Ga0496112_0001305_18345_18689 114
388 3300048916 Ga0496113_0937985 Ga0496113_0937985_45_389 114
389 3300050512 nmdc:mga0n895_372237_c1 nmdc:mga0n895_372237_c1_40_390 114
390 3300050515 nmdc:mga0a205_731392_c1 nmdc:mga0a205_731392_c1_232_582 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

30

90

0.95

PF02311

AraC_binding

AraC-like ligand binding domain

24

100

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.9424 26 103
7u1j-assembly2.cif.gz_B crystal structure of pisum sativum convicilin 0.9244 27 110
2pfw-assembly1.cif.gz_B crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution 0.9205 28 104
3ww2-assembly1.cif.gz_A x-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose 0.9204 27 102
3ww1-assembly1.cif.gz_A x-ray structure of cellulomonas parahominis l-ribose isomerase with l-ribose 0.9192 26 102
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9403 28 100 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.94 26 100 2.60.120.10
af_F1LVA4_327_469_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9341 28 110 2.60.120.10
af_F1LVA4_66_267_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9327 28 111 2.60.120.10
3ww1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9192 26 102 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V6D631-F1-model_v4 Cupin domain-containing protein 0.9846 29 110
AF-A0A4Q1UZR3-F1-model_v4 Cupin type-2 domain-containing protein 0.9794 1 110
AF-A0A1G7MWA7-F1-model_v4 Cupin domain-containing protein 0.975 1 110
AF-A0A2V6D631-F1-model_v4 Cupin domain-containing protein 0.973 29 110
AF-A0A2W0BMR1-F1-model_v4 Cupin type-2 domain-containing protein 0.9727 1 110

Feature Viewer

pLDDT pTM Quality
89.54 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map