F431628
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 390 | 243 | 389 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100196721|Ga0070683_1001967212 |
| Length | 100 |
| Sequence | MYKVRQEDLPYRGSSHHFVGANQGDVNVSVFLFNGEPYDEIQFIRSGRGRYVVNGQEFEATAGDILVIKAGEVHSFTVIGDEPLVQLDVHLSPRFIQENL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 157 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 243 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0.26 |
| Isolates | 0.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.59 |
| Rhizosphere | 95.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10227872 | 3300005288 | Bacteria | 824 |
| 2 | Ga0065715_10108592 | 3300005293 | Bacteria | 2711 |
| 3 | Ga0070658_11483870 | 3300005327 | Bacteria | 588 |
| 4 | Ga0070676_10158260 | 3300005328 | Unclassified | 1456 |
| 5 | Ga0070683_100196721 | 3300005329 | Bacteria | 1914 |
| 6 | Ga0070683_101106055 | 3300005329 | Unclassified | 761 |
| 7 | Ga0070670_100093162 | 3300005331 | Bacteria | 2591 |
| 8 | Ga0070670_100231758 | 3300005331 | Bacteria | 1607 |
| 9 | Ga0068869_100044947 | 3300005334 | Bacteria | 3177 |
| 10 | Ga0068869_100870590 | 3300005334 | Unclassified | 778 |
| 11 | Ga0070666_10317921 | 3300005335 | Unclassified | 1110 |
| 12 | Ga0070666_10440045 | 3300005335 | Archaea | 940 |
| 13 | Ga0070680_100048924 | 3300005336 | Bacteria | 3446 |
| 14 | Ga0070680_100519750 | 3300005336 | Unclassified | 1019 |
| 15 | Ga0070682_100006292 | 3300005337 | Bacteria | 6660 |
| 16 | Ga0068868_100260461 | 3300005338 | Bacteria | 1462 |
| 17 | Ga0068868_100271409 | 3300005338 | Bacteria | 1433 |
| 18 | Ga0070660_100002803 | 3300005339 | Bacteria | 11982 |
| 19 | Ga0070689_100072648 | 3300005340 | Bacteria | 2689 |
| 20 | Ga0070691_10158928 | 3300005341 | Bacteria | 1164 |
| 21 | Ga0070687_100488326 | 3300005343 | Bacteria | 827 |
| 22 | Ga0070661_100022268 | 3300005344 | Bacteria | 4536 |
| 23 | Ga0070661_100314796 | 3300005344 | Unclassified | 1221 |
| 24 | Ga0070692_10014401 | 3300005345 | Bacteria | 3715 |
| 25 | Ga0070669_100136876 | 3300005353 | Bacteria | 1885 |
| 26 | Ga0070675_100005332 | 3300005354 | Bacteria | 9829 |
| 27 | Ga0070675_100031757 | 3300005354 | Bacteria | 4271 |
| 28 | Ga0070671_100001970 | 3300005355 | Bacteria | 15751 |
| 29 | Ga0070671_100359954 | 3300005355 | Bacteria | 1242 |
| 30 | Ga0070671_100795676 | 3300005355 | Bacteria | 823 |
| 31 | Ga0070674_100027822 | 3300005356 | Bacteria | 3708 |
| 32 | Ga0070673_100046339 | 3300005364 | Bacteria | 3376 |
| 33 | Ga0070673_100128132 | 3300005364 | Unclassified | 2126 |
| 34 | Ga0070688_100262900 | 3300005365 | Unclassified | 1233 |
| 35 | Ga0070659_100049798 | 3300005366 | Bacteria | 3294 |
| 36 | Ga0070667_100173604 | 3300005367 | Bacteria | 1904 |
| 37 | Ga0070667_100978319 | 3300005367 | Archaea | 789 |
| 38 | Ga0070667_102077990 | 3300005367 | Bacteria | 535 |
| 39 | Ga0070703_10213538 | 3300005406 | Unclassified | 764 |
| 40 | Ga0070713_100242899 | 3300005436 | Bacteria | 1640 |
| 41 | Ga0070701_11029424 | 3300005438 | Unclassified | 576 |
| 42 | Ga0070705_100048927 | 3300005440 | Bacteria | 2452 |
| 43 | Ga0070705_100102042 | 3300005440 | Bacteria | 1814 |
| 44 | Ga0070700_100337195 | 3300005441 | Unclassified | 1113 |
| 45 | Ga0070694_100586493 | 3300005444 | Unclassified | 896 |
| 46 | Ga0070662_100010807 | 3300005457 | Bacteria | 6011 |
| 47 | Ga0070662_100033684 | 3300005457 | Bacteria | 3609 |
| 48 | Ga0070662_100223792 | 3300005457 | Bacteria | 1502 |
| 49 | Ga0070662_101500607 | 3300005457 | Bacteria | 581 |
| 50 | Ga0068867_100056232 | 3300005459 | Bacteria | 2910 |
| 51 | Ga0070706_101004994 | 3300005467 | Bacteria | 769 |
| 52 | Ga0070706_101319782 | 3300005467 | Unclassified | 661 |
| 53 | Ga0070706_102159193 | 3300005467 | Unclassified | 503 |
| 54 | Ga0070698_100001876 | 3300005471 | Bacteria | 23425 |
| 55 | Ga0070699_100014194 | 3300005518 | Bacteria | 6854 |
| 56 | Ga0070699_100828791 | 3300005518 | Unclassified | 847 |
| 57 | Ga0070679_100009326 | 3300005530 | Bacteria | 9278 |
| 58 | Ga0070684_100055332 | 3300005535 | Bacteria | 3458 |
| 59 | Ga0070684_100105439 | 3300005535 | Bacteria | 2522 |
| 60 | Ga0070684_100150525 | 3300005535 | Bacteria | 2108 |
| 61 | Ga0070697_100328151 | 3300005536 | Bacteria | 1319 |
| 62 | Ga0068853_100488131 | 3300005539 | Bacteria | 1162 |
| 63 | Ga0070672_100008964 | 3300005543 | Bacteria | 6875 |
| 64 | Ga0070672_100538073 | 3300005543 | Unclassified | 1013 |
| 65 | Ga0070695_100160117 | 3300005545 | Bacteria | 1579 |
| 66 | Ga0070695_101654963 | 3300005545 | Unclassified | 535 |
| 67 | Ga0070696_100000076 | 3300005546 | Bacteria | 48224 |
| 68 | Ga0070696_100730806 | 3300005546 | Unclassified | 809 |
| 69 | Ga0070693_100287984 | 3300005547 | Bacteria | 1103 |
| 70 | Ga0068855_100149909 | 3300005563 | Bacteria | 2652 |
| 71 | Ga0070664_100391147 | 3300005564 | Bacteria | 1270 |
| 72 | Ga0068857_100404577 | 3300005577 | Bacteria | 1270 |
| 73 | Ga0068854_100596053 | 3300005578 | Unclassified | 943 |
| 74 | Ga0068856_100943984 | 3300005614 | Bacteria | 881 |
| 75 | Ga0068856_102224740 | 3300005614 | Unclassified | 557 |
| 76 | Ga0070702_100015880 | 3300005615 | Bacteria | 3854 |
| 77 | Ga0068859_100049648 | 3300005617 | Bacteria | 4214 |
| 78 | Ga0068859_103082916 | 3300005617 | Unclassified | 508 |
| 79 | Ga0068864_100011549 | 3300005618 | Bacteria | 7297 |
| 80 | Ga0068864_100063503 | 3300005618 | Bacteria | 3200 |
| 81 | Ga0068864_100206816 | 3300005618 | Bacteria | 1805 |
| 82 | Ga0068866_10213496 | 3300005718 | Bacteria | 1160 |
| 83 | Ga0068861_101363787 | 3300005719 | Unclassified | 691 |
| 84 | Ga0068870_10131906 | 3300005840 | Bacteria | 1452 |
| 85 | Ga0068870_10258732 | 3300005840 | Bacteria | 1082 |
| 86 | Ga0068863_100013713 | 3300005841 | Bacteria | 7813 |
| 87 | Ga0068863_100634961 | 3300005841 | Bacteria | 1058 |
| 88 | Ga0068863_102305426 | 3300005841 | Bacteria | 548 |
| 89 | Ga0068858_100784531 | 3300005842 | Bacteria | 929 |
| 90 | Ga0068860_100099650 | 3300005843 | Bacteria | 2771 |
| 91 | Ga0068860_100221576 | 3300005843 | Bacteria | 1837 |
| 92 | Ga0068860_102326915 | 3300005843 | Archaea | 556 |
| 93 | Ga0068862_100238532 | 3300005844 | Unclassified | 1652 |
| 94 | Ga0068862_100770599 | 3300005844 | Archaea | 937 |
| 95 | Ga0068862_102488750 | 3300005844 | Unclassified | 529 |
| 96 | Ga0070717_10106383 | 3300006028 | Unclassified | 2389 |
| 97 | Ga0070715_10317316 | 3300006163 | Bacteria | 840 |
| 98 | Ga0070716_100917399 | 3300006173 | Unclassified | 687 |
| 99 | Ga0097621_100072877 | 3300006237 | Bacteria | 2842 |
| 100 | Ga0097621_100076536 | 3300006237 | Bacteria | 2776 |
| 101 | Ga0097621_100924898 | 3300006237 | Unclassified | 813 |
| 102 | Ga0068871_100003295 | 3300006358 | Bacteria | 11080 |
| 103 | Ga0068871_100005659 | 3300006358 | Bacteria | 8767 |
| 104 | Ga0075428_100010980 | 3300006844 | Bacteria | 10073 |
| 105 | Ga0075428_100030838 | 3300006844 | Bacteria | 5928 |
| 106 | Ga0075430_100145908 | 3300006846 | Unclassified | 1971 |
| 107 | Ga0075430_100401096 | 3300006846 | Unclassified | 1132 |
| 108 | Ga0075430_100568320 | 3300006846 | Bacteria | 935 |
| 109 | Ga0075430_101432350 | 3300006846 | Unclassified | 568 |
| 110 | Ga0075431_100000029 | 3300006847 | Bacteria | 73283 |
| 111 | Ga0075431_100014007 | 3300006847 | Bacteria | 8101 |
| 112 | Ga0075431_100086156 | 3300006847 | Bacteria | 3242 |
| 113 | Ga0075431_101198791 | 3300006847 | Bacteria | 722 |
| 114 | Ga0075433_10082210 | 3300006852 | Bacteria | 2840 |
| 115 | Ga0075433_11454707 | 3300006852 | Unclassified | 592 |
| 116 | Ga0075434_100119742 | 3300006871 | Bacteria | 2647 |
| 117 | Ga0075429_100328274 | 3300006880 | Bacteria | 1339 |
| 118 | Ga0075429_100451173 | 3300006880 | Bacteria | 1127 |
| 119 | Ga0068865_100079097 | 3300006881 | Bacteria | 2354 |
| 120 | Ga0068865_100144970 | 3300006881 | Bacteria | 1795 |
| 121 | Ga0068865_100535018 | 3300006881 | Unclassified | 982 |
| 122 | Ga0075436_100003773 | 3300006914 | Bacteria | 10390 |
| 123 | Ga0075436_100174320 | 3300006914 | Bacteria | 1519 |
| 124 | Ga0097620_100049648 | 3300006931 | Bacteria | 4214 |
| 125 | Ga0097620_103083951 | 3300006931 | Unclassified | 508 |
| 126 | Ga0075435_100191355 | 3300007076 | Unclassified | 1732 |
| 127 | Ga0105250_10199721 | 3300009092 | Unclassified | 843 |
| 128 | Ga0105240_11521383 | 3300009093 | Unclassified | 701 |
| 129 | Ga0111539_10577310 | 3300009094 | Bacteria | 1309 |
| 130 | Ga0105245_10163410 | 3300009098 | Unclassified | 2114 |
| 131 | Ga0105245_10355825 | 3300009098 | Bacteria | 1452 |
| 132 | Ga0105245_11024602 | 3300009098 | Bacteria | 870 |
| 133 | Ga0105245_11987288 | 3300009098 | Unclassified | 635 |
| 134 | Ga0114129_10268020 | 3300009147 | Unclassified | 2286 |
| 135 | Ga0114129_10643390 | 3300009147 | Bacteria | 1369 |
| 136 | Ga0114129_11276898 | 3300009147 | Bacteria | 911 |
| 137 | Ga0105241_10037753 | 3300009174 | Bacteria | 3639 |
| 138 | Ga0105241_10869904 | 3300009174 | Bacteria | 835 |
| 139 | Ga0105241_11341871 | 3300009174 | Unclassified | 683 |
| 140 | Ga0105242_10057309 | 3300009176 | Unclassified | 3190 |
| 141 | Ga0105248_10031222 | 3300009177 | Bacteria | 5954 |
| 142 | Ga0105248_10293612 | 3300009177 | Bacteria | 1830 |
| 143 | Ga0105248_11439657 | 3300009177 | Unclassified | 780 |
| 144 | Ga0105249_10079566 | 3300009553 | Bacteria | 3043 |
| 145 | Ga0105249_11020120 | 3300009553 | Unclassified | 896 |
| 146 | Ga0105239_10255025 | 3300010375 | Unclassified | 1970 |
| 147 | Ga0105239_11230014 | 3300010375 | Bacteria | 863 |
| 148 | Ga0105239_11751510 | 3300010375 | Unclassified | 719 |
| 149 | Ga0105246_10022012 | 3300011119 | Bacteria | 4111 |
| 150 | Ga0157373_10001837 | 3300013100 | Bacteria | 16137 |
| 151 | Ga0157371_10028177 | 3300013102 | Bacteria | 4069 |
| 152 | Ga0157369_10124983 | 3300013105 | Bacteria | 2728 |
| 153 | Ga0157374_10052267 | 3300013296 | Bacteria | 3804 |
| 154 | Ga0163162_10061933 | 3300013306 | Bacteria | 3780 |
| 155 | Ga0157372_10135986 | 3300013307 | Bacteria | 2830 |
| 156 | Ga0157372_10979111 | 3300013307 | Bacteria | 980 |
| 157 | Ga0157375_10010337 | 3300013308 | Bacteria | 8216 |
| 158 | Ga0157375_10725371 | 3300013308 | Bacteria | 1146 |
| 159 | Ga0157375_13669750 | 3300013308 | Unclassified | 510 |
| 160 | Ga0163163_10037251 | 3300014325 | Bacteria | 4730 |
| 161 | Ga0157377_10000301 | 3300014745 | Bacteria | 23220 |
| 162 | Ga0157377_10298833 | 3300014745 | Bacteria | 1062 |
| 163 | Ga0157376_10003366 | 3300014969 | Bacteria | 11002 |
| 164 | Ga0213875_10202724 | 3300021388 | Bacteria | 933 |
| 165 | Ga0207697_10042371 | 3300025315 | Bacteria | 1871 |
| 166 | Ga0207656_10151908 | 3300025321 | Bacteria | 1097 |
| 167 | Ga0207642_10242373 | 3300025899 | Unclassified | 1019 |
| 168 | Ga0207688_10062658 | 3300025901 | Bacteria | 2097 |
| 169 | Ga0207680_10411468 | 3300025903 | Bacteria | 957 |
| 170 | Ga0207680_10429542 | 3300025903 | Archaea | 936 |
| 171 | Ga0207647_10164272 | 3300025904 | Bacteria | 1294 |
| 172 | Ga0207685_10344658 | 3300025905 | Bacteria | 749 |
| 173 | Ga0207699_10138614 | 3300025906 | Bacteria | 1596 |
| 174 | Ga0207699_10586935 | 3300025906 | Bacteria | 811 |
| 175 | Ga0207645_10348904 | 3300025907 | Bacteria | 990 |
| 176 | Ga0207643_10007393 | 3300025908 | Bacteria | 5893 |
| 177 | Ga0207643_10122402 | 3300025908 | Bacteria | 1542 |
| 178 | Ga0207643_10412329 | 3300025908 | Bacteria | 855 |
| 179 | Ga0207684_10098839 | 3300025910 | Unclassified | 2492 |
| 180 | Ga0207654_10151475 | 3300025911 | Bacteria | 1489 |
| 181 | Ga0207707_10028243 | 3300025912 | Bacteria | 4904 |
| 182 | Ga0207693_10139899 | 3300025915 | Unclassified | 1903 |
| 183 | Ga0207693_10272790 | 3300025915 | Bacteria | 1325 |
| 184 | Ga0207660_10379601 | 3300025917 | Bacteria | 1136 |
| 185 | Ga0207662_10136412 | 3300025918 | Archaea | 1551 |
| 186 | Ga0207662_10883516 | 3300025918 | Unclassified | 632 |
| 187 | Ga0207657_10011766 | 3300025919 | Bacteria | 8667 |
| 188 | Ga0207649_10013428 | 3300025920 | Bacteria | 4573 |
| 189 | Ga0207649_10336951 | 3300025920 | Unclassified | 1113 |
| 190 | Ga0207652_10015246 | 3300025921 | Bacteria | 6237 |
| 191 | Ga0207681_10044441 | 3300025923 | Bacteria | 2977 |
| 192 | Ga0207681_10232744 | 3300025923 | Bacteria | 1431 |
| 193 | Ga0207681_11623882 | 3300025923 | Unclassified | 541 |
| 194 | Ga0207650_10037059 | 3300025925 | Bacteria | 3551 |
| 195 | Ga0207650_10067215 | 3300025925 | Bacteria | 2689 |
| 196 | Ga0207650_10288139 | 3300025925 | Bacteria | 1338 |
| 197 | Ga0207650_11712216 | 3300025925 | Unclassified | 533 |
| 198 | Ga0207659_10054539 | 3300025926 | Bacteria | 2855 |
| 199 | Ga0207659_10235483 | 3300025926 | Bacteria | 1479 |
| 200 | Ga0207687_10121433 | 3300025927 | Bacteria | 1955 |
| 201 | Ga0207700_10916066 | 3300025928 | Unclassified | 784 |
| 202 | Ga0207644_10012984 | 3300025931 | Bacteria | 5543 |
| 203 | Ga0207644_10092880 | 3300025931 | Bacteria | 2252 |
| 204 | Ga0207644_10721075 | 3300025931 | Bacteria | 832 |
| 205 | Ga0207690_10094210 | 3300025932 | Unclassified | 2124 |
| 206 | Ga0207706_10005408 | 3300025933 | Bacteria | 11905 |
| 207 | Ga0207706_10050025 | 3300025933 | Bacteria | 3693 |
| 208 | Ga0207706_10165811 | 3300025933 | Bacteria | 1941 |
| 209 | Ga0207706_11604081 | 3300025933 | Unclassified | 527 |
| 210 | Ga0207686_10056593 | 3300025934 | Unclassified | 2466 |
| 211 | Ga0207670_10013484 | 3300025936 | Bacteria | 4822 |
| 212 | Ga0207704_10140115 | 3300025938 | Bacteria | 1690 |
| 213 | Ga0207704_10419231 | 3300025938 | Unclassified | 1061 |
| 214 | Ga0207665_10459699 | 3300025939 | Unclassified | 978 |
| 215 | Ga0207691_10000448 | 3300025940 | Bacteria | 40796 |
| 216 | Ga0207691_11155928 | 3300025940 | Bacteria | 643 |
| 217 | Ga0207691_11358491 | 3300025940 | Unclassified | 585 |
| 218 | Ga0207711_10042189 | 3300025941 | Bacteria | 3887 |
| 219 | Ga0207711_10052819 | 3300025941 | Bacteria | 3484 |
| 220 | Ga0207711_12004332 | 3300025941 | Unclassified | 522 |
| 221 | Ga0207689_10007389 | 3300025942 | Bacteria | 9634 |
| 222 | Ga0207661_10001687 | 3300025944 | Bacteria | 15068 |
| 223 | Ga0207661_10067558 | 3300025944 | Bacteria | 2908 |
| 224 | Ga0207661_12088455 | 3300025944 | Bacteria | 513 |
| 225 | Ga0207679_10014652 | 3300025945 | Bacteria | 5160 |
| 226 | Ga0207667_10111535 | 3300025949 | Bacteria | 2821 |
| 227 | Ga0207712_10004137 | 3300025961 | Bacteria | 9162 |
| 228 | Ga0207712_10081851 | 3300025961 | Bacteria | 2352 |
| 229 | Ga0207640_10311867 | 3300025981 | Unclassified | 1249 |
| 230 | Ga0207658_10409264 | 3300025986 | Unclassified | 1194 |
| 231 | Ga0207658_10503264 | 3300025986 | Bacteria | 1079 |
| 232 | Ga0207677_10263914 | 3300026023 | Bacteria | 1405 |
| 233 | Ga0207703_11952452 | 3300026035 | Unclassified | 563 |
| 234 | Ga0207639_10310772 | 3300026041 | Bacteria | 1396 |
| 235 | Ga0207678_10337297 | 3300026067 | Bacteria | 1299 |
| 236 | Ga0207708_10160584 | 3300026075 | Bacteria | 1774 |
| 237 | Ga0207702_10047603 | 3300026078 | Bacteria | 3614 |
| 238 | Ga0207702_10948308 | 3300026078 | Bacteria | 853 |
| 239 | Ga0207641_10028691 | 3300026088 | Bacteria | 4600 |
| 240 | Ga0207641_11294618 | 3300026088 | Bacteria | 729 |
| 241 | Ga0207648_10079250 | 3300026089 | Bacteria | 2865 |
| 242 | Ga0207648_10105812 | 3300026089 | Bacteria | 2468 |
| 243 | Ga0207648_10747992 | 3300026089 | Bacteria | 908 |
| 244 | Ga0207676_10007256 | 3300026095 | Bacteria | 7851 |
| 245 | Ga0207676_10383946 | 3300026095 | Bacteria | 1308 |
| 246 | Ga0207676_10642981 | 3300026095 | Unclassified | 1023 |
| 247 | Ga0207676_10646349 | 3300026095 | Bacteria | 1020 |
| 248 | Ga0207674_10000421 | 3300026116 | Bacteria | 55179 |
| 249 | Ga0207674_10008757 | 3300026116 | Bacteria | 11650 |
| 250 | Ga0207675_100069760 | 3300026118 | Bacteria | 3285 |
| 251 | Ga0207675_101392402 | 3300026118 | Unclassified | 722 |
| 252 | Ga0207683_10139600 | 3300026121 | Bacteria | 2183 |
| 253 | Ga0209983_1102479 | 3300027665 | Bacteria | 649 |
| 254 | Ga0209971_1082808 | 3300027682 | Bacteria | 782 |
| 255 | Ga0209998_10008584 | 3300027717 | Bacteria | 2119 |
| 256 | Ga0209974_10079896 | 3300027876 | Bacteria | 1124 |
| 257 | Ga0207428_10360441 | 3300027907 | Unclassified | 1069 |
| 258 | Ga0268265_10700584 | 3300028380 | Unclassified | 978 |
| 259 | Ga0268265_12015510 | 3300028380 | Unclassified | 584 |
| 260 | Ga0268264_10192920 | 3300028381 | Bacteria | 1858 |
| 261 | Ga0268264_11879548 | 3300028381 | Unclassified | 608 |
| 262 | Ga0307511_10288951 | 3300030521 | Bacteria | 751 |
| 263 | Ga0265762_1000576 | 3300030760 | Bacteria | 6473 |
| 264 | Ga0307408_100075118 | 3300031548 | Bacteria | 2510 |
| 265 | Ga0307408_100242494 | 3300031548 | Bacteria | 1482 |
| 266 | Ga0307408_101005086 | 3300031548 | Bacteria | 769 |
| 267 | Ga0307408_101665921 | 3300031548 | Unclassified | 607 |
| 268 | Ga0307405_10236608 | 3300031731 | Bacteria | 1350 |
| 269 | Ga0307405_10697367 | 3300031731 | Bacteria | 840 |
| 270 | Ga0307413_10006492 | 3300031824 | Bacteria | 5349 |
| 271 | Ga0307413_10302819 | 3300031824 | Bacteria | 1213 |
| 272 | Ga0307413_10602228 | 3300031824 | Bacteria | 899 |
| 273 | Ga0307410_10058434 | 3300031852 | Bacteria | 2629 |
| 274 | Ga0307410_10073813 | 3300031852 | Bacteria | 2373 |
| 275 | Ga0307410_11436950 | 3300031852 | Unclassified | 606 |
| 276 | Ga0307406_10151034 | 3300031901 | Bacteria | 1657 |
| 277 | Ga0307407_10269765 | 3300031903 | Bacteria | 1174 |
| 278 | Ga0307407_10330264 | 3300031903 | Bacteria | 1073 |
| 279 | Ga0307407_10849110 | 3300031903 | Bacteria | 697 |
| 280 | Ga0307412_10638871 | 3300031911 | Bacteria | 906 |
| 281 | Ga0307409_100139623 | 3300031995 | Bacteria | 2086 |
| 282 | Ga0307409_101684050 | 3300031995 | Bacteria | 663 |
| 283 | Ga0307409_101745441 | 3300031995 | Bacteria | 651 |
| 284 | Ga0307416_101359078 | 3300032002 | Unclassified | 816 |
| 285 | Ga0307416_102761471 | 3300032002 | Bacteria | 587 |
| 286 | Ga0307416_102972780 | 3300032002 | Unclassified | 567 |
| 287 | Ga0307414_10047439 | 3300032004 | Bacteria | 2956 |
| 288 | Ga0307414_10579489 | 3300032004 | Bacteria | 1004 |
| 289 | Ga0307411_10010863 | 3300032005 | Bacteria | 4879 |
| 290 | Ga0307411_10243207 | 3300032005 | Unclassified | 1410 |
| 291 | Ga0307411_10328310 | 3300032005 | Bacteria | 1238 |
| 292 | Ga0307415_100212620 | 3300032126 | Unclassified | 1544 |
| 293 | Ga0307415_100305849 | 3300032126 | Bacteria | 1319 |
| 294 | Ga0307415_100502309 | 3300032126 | Bacteria | 1060 |
| 295 | Ga0373958_0019816 | 3300034819 | Bacteria | 1233 |
| 296 | Ga0373952_0020746 | 3300035092 | Unclassified | 1380 |
| 297 | Ga0373943_0175397 | 3300035170 | Bacteria | 1175 |
| 298 | Ga0373946_0245742 | 3300035171 | Unclassified | 871 |
| 299 | Ga0373946_0768135 | 3300035171 | Unclassified | 506 |
| 300 | Ga0373962_0137593 | 3300035242 | Unclassified | 791 |
| 301 | Ga0373931_0010987 | 3300035691 | Unclassified | 4365 |
| 302 | Ga0373935_0524336 | 3300035692 | Unclassified | 862 |
| 303 | Ga0373927_0216436 | 3300035695 | Bacteria | 1258 |
| 304 | Ga0373947_0005752 | 3300035725 | Bacteria | 7230 |
| 305 | Ga0373947_0046039 | 3300035725 | Unclassified | 2611 |
| 306 | Ga0373937_0213835 | 3300036401 | Bacteria | 1814 |
| 307 | Ga0373937_0568284 | 3300036401 | Unclassified | 1077 |
| 308 | Ga0373925_0021145 | 3300037068 | Bacteria | 4740 |
| 309 | Ga0373925_0062889 | 3300037068 | Unclassified | 2792 |
| 310 | Ga0373925_0810988 | 3300037068 | Unclassified | 772 |
| 311 | Ga0395898_1988322 | 3300037466 | Unclassified | 501 |
| 312 | Ga0395905_0087159 | 3300037471 | Bacteria | 2927 |
| 313 | Ga0395905_0100110 | 3300037471 | Bacteria | 2721 |
| 314 | Ga0436364_0995426 | 3300037853 | Bacteria | 1000 |
| 315 | Ga0395901_1827824 | 3300038443 | Unclassified | 556 |
| 316 | Ga0436365_1383187 | 3300039437 | Bacteria | 806 |
| 317 | Ga0466967_0124027 | 3300045976 | Bacteria | 2391 |
| 318 | Ga0466967_0784648 | 3300045976 | Unclassified | 946 |
| 319 | Ga0495641_0010584 | 3300046461 | Bacteria | 5327 |
| 320 | Ga0495580_0041829 | 3300046472 | Bacteria | 3267 |
| 321 | Ga0495580_0114660 | 3300046472 | Bacteria | 1872 |
| 322 | Ga0495582_0008213 | 3300046473 | Bacteria | 5760 |
| 323 | Ga0495662_0022173 | 3300046476 | Bacteria | 3068 |
| 324 | Ga0495664_0017273 | 3300046477 | Bacteria | 4124 |
| 325 | Ga0495628_0046005 | 3300046516 | Bacteria | 3468 |
| 326 | Ga0495630_0027182 | 3300046517 | Bacteria | 4241 |
| 327 | Ga0495666_0008350 | 3300046526 | Bacteria | 5189 |
| 328 | Ga0495666_0017579 | 3300046526 | Bacteria | 3561 |
| 329 | Ga0495665_0009743 | 3300046531 | Bacteria | 5200 |
| 330 | Ga0495640_0019422 | 3300046533 | Bacteria | 5015 |
| 331 | Ga0495586_0001912 | 3300046535 | Bacteria | 11342 |
| 332 | Ga0495586_0893951 | 3300046535 | Bacteria | 512 |
| 333 | Ga0495621_0271760 | 3300046539 | Bacteria | 697 |
| 334 | Ga0495622_0228822 | 3300046557 | Unclassified | 822 |
| 335 | Ga0495667_0457580 | 3300046559 | Bacteria | 801 |
| 336 | Ga0495634_0002414 | 3300046642 | Bacteria | 15554 |
| 337 | Ga0495659_0081588 | 3300046664 | Bacteria | 1228 |
| 338 | Ga0495647_0018775 | 3300046681 | Bacteria | 2466 |
| 339 | Ga0495658_0004380 | 3300046683 | Bacteria | 6951 |
| 340 | Ga0495624_0455332 | 3300046690 | Bacteria | 766 |
| 341 | Ga0495670_0270684 | 3300046691 | Bacteria | 907 |
| 342 | Ga0495674_0011963 | 3300047319 | Bacteria | 8183 |
| 343 | Ga0495674_0378162 | 3300047319 | Bacteria | 1146 |
| 344 | Ga0495676_0015714 | 3300047321 | Bacteria | 6730 |
| 345 | Ga0495680_0026403 | 3300047322 | Bacteria | 4787 |
| 346 | Ga0495684_0051356 | 3300047471 | Bacteria | 3147 |
| 347 | Ga0495614_0284246 | 3300048089 | Bacteria | 762 |
| 348 | Ga0496101_0805126 | 3300048904 | Archaea | 741 |
| 349 | Ga0496102_0227865 | 3300048905 | Bacteria | 1757 |
| 350 | Ga0496104_1520975 | 3300048907 | Unclassified | 572 |
| 351 | Ga0496106_0208882 | 3300048909 | Bacteria | 1555 |
| 352 | Ga0496106_0359335 | 3300048909 | Unclassified | 1170 |
| 353 | Ga0496108_0226114 | 3300048911 | Bacteria | 1626 |
| 354 | Ga0496109_0706241 | 3300048912 | Unclassified | 946 |
| 355 | Ga0496110_0007343 | 3300048913 | Bacteria | 8797 |
| 356 | Ga0496111_0447168 | 3300048914 | Unclassified | 953 |
| 357 | Ga0496112_0001305 | 3300048915 | Bacteria | 18935 |
| 358 | Ga0496112_0038131 | 3300048915 | Bacteria | 4692 |
| 359 | Ga0496112_0122850 | 3300048915 | Bacteria | 2567 |
| 360 | Ga0496113_0937985 | 3300048916 | Bacteria | 683 |
| 361 | Ga0496114_0310026 | 3300048917 | Bacteria | 1394 |
| 362 | Ga0501032_0614470 | 3300049569 | Bacteria | 691 |
| 363 | Ga0501039_0046401 | 3300049575 | Bacteria | 3356 |
| 364 | Ga0501046_0764073 | 3300049580 | Bacteria | 678 |
| 365 | Ga0501071_0023709 | 3300049587 | Bacteria | 4287 |
| 366 | Ga0501075_1044816 | 3300049591 | Unclassified | 620 |
| 367 | Ga0501076_0036933 | 3300049592 | Bacteria | 3829 |
| 368 | Ga0501233_038896 | 3300049668 | Bacteria | 1110 |
| 369 | Ga0501079_0037349 | 3300049741 | Bacteria | 3744 |
| 370 | Ga0501080_1498467 | 3300049742 | Unclassified | 573 |
| 371 | Ga0501045_0007212 | 3300049824 | Bacteria | 7715 |
| 372 | nmdc:mga05p37_142076_c1 | 3300050507 | Bacteria | 2940 |
| 373 | nmdc:mga05p37_2066941_c1 | 3300050507 | Unclassified | 535 |
| 374 | nmdc:mga05p37_900070_c1 | 3300050507 | Bacteria | 954 |
| 375 | nmdc:mga09592_314060_c1 | 3300050508 | Bacteria | 1358 |
| 376 | nmdc:mga0qj67_1191127_c1 | 3300050509 | Unclassified | 593 |
| 377 | nmdc:mga0qj67_1556166_c1 | 3300050509 | Bacteria | 508 |
| 378 | nmdc:mga0qj67_643663_c1 | 3300050509 | Bacteria | 846 |
| 379 | nmdc:mga06r32_237026_c1 | 3300050510 | Bacteria | 1812 |
| 380 | nmdc:mga06r32_39025_c1 | 3300050510 | Bacteria | 4504 |
| 381 | nmdc:mga06r32_85_c1 | 3300050510 | Bacteria | 64050 |
| 382 | nmdc:mga06r32_916820_c1 | 3300050510 | Bacteria | 832 |
| 383 | nmdc:mga08y16_1485707_c1 | 3300050511 | Bacteria | 638 |
| 384 | nmdc:mga08y16_227872_c1 | 3300050511 | Unclassified | 1928 |
| 385 | nmdc:mga0n895_372237_c1 | 3300050512 | Bacteria | 1446 |
| 386 | nmdc:mga0a205_731392_c1 | 3300050515 | Bacteria | 839 |
| 387 | Ga0495619_0566238 | 3300053085 | Bacteria | 779 |
| 388 | Ga0501082_0086625 | 3300060353 | Bacteria | 2702 |
| 389 | Ga0530510_0800034 | 3300061734 | Bacteria | 719 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100196721 | Ga0070683_1001967212 | 100 |
| 2 | 3300005331 | Ga0070670_100093162 | Ga0070670_1000931622 | 100 |
| 3 | 3300005334 | Ga0068869_100044947 | Ga0068869_1000449472 | 100 |
| 4 | 3300005335 | Ga0070666_10317921 | Ga0070666_103179213 | 100 |
| 5 | 3300005336 | Ga0070680_100048924 | Ga0070680_1000489242 | 100 |
| 6 | 3300005337 | Ga0070682_100006292 | Ga0070682_1000062925 | 100 |
| 7 | 3300005338 | Ga0068868_100271409 | Ga0068868_1002714093 | 100 |
| 8 | 3300005339 | Ga0070660_100002803 | Ga0070660_1000028035 | 100 |
| 9 | 3300005340 | Ga0070689_100072648 | Ga0070689_1000726482 | 100 |
| 10 | 3300005341 | Ga0070691_10158928 | Ga0070691_101589283 | 100 |
| 11 | 3300005343 | Ga0070687_100488326 | Ga0070687_1004883262 | 100 |
| 12 | 3300005344 | Ga0070661_100022268 | Ga0070661_1000222685 | 100 |
| 13 | 3300005345 | Ga0070692_10014401 | Ga0070692_100144013 | 100 |
| 14 | 3300005354 | Ga0070675_100005332 | Ga0070675_1000053323 | 100 |
| 15 | 3300005365 | Ga0070688_100262900 | Ga0070688_1002629002 | 100 |
| 16 | 3300005366 | Ga0070659_100049798 | Ga0070659_1000497982 | 100 |
| 17 | 3300005367 | Ga0070667_102077990 | Ga0070667_1020779901 | 100 |
| 18 | 3300005457 | Ga0070662_100033684 | Ga0070662_1000336843 | 100 |
| 19 | 3300005457 | Ga0070662_100223792 | Ga0070662_1002237922 | 100 |
| 20 | 3300005530 | Ga0070679_100009326 | Ga0070679_1000093267 | 100 |
| 21 | 3300005535 | Ga0070684_100055332 | Ga0070684_1000553325 | 100 |
| 22 | 3300005539 | Ga0068853_100488131 | Ga0068853_1004881312 | 100 |
| 23 | 3300005545 | Ga0070695_100160117 | Ga0070695_1001601172 | 100 |
| 24 | 3300005547 | Ga0070693_100287984 | Ga0070693_1002879842 | 100 |
| 25 | 3300005563 | Ga0068855_100149909 | Ga0068855_1001499092 | 100 |
| 26 | 3300005564 | Ga0070664_100391147 | Ga0070664_1003911473 | 100 |
| 27 | 3300005577 | Ga0068857_100404577 | Ga0068857_1004045773 | 100 |
| 28 | 3300005615 | Ga0070702_100015880 | Ga0070702_1000158802 | 100 |
| 29 | 3300005617 | Ga0068859_100049648 | Ga0068859_1000496484 | 100 |
| 30 | 3300005618 | Ga0068864_100011549 | Ga0068864_1000115495 | 100 |
| 31 | 3300005840 | Ga0068870_10258732 | Ga0068870_102587322 | 100 |
| 32 | 3300005841 | Ga0068863_100013713 | Ga0068863_1000137135 | 100 |
| 33 | 3300005842 | Ga0068858_100784531 | Ga0068858_1007845312 | 100 |
| 34 | 3300005843 | Ga0068860_100099650 | Ga0068860_1000996502 | 100 |
| 35 | 3300006237 | Ga0097621_100072877 | Ga0097621_1000728772 | 100 |
| 36 | 3300006358 | Ga0068871_100003295 | Ga0068871_1000032955 | 100 |
| 37 | 3300006880 | Ga0075429_100451173 | Ga0075429_1004511732 | 100 |
| 38 | 3300006931 | Ga0097620_100049648 | Ga0097620_1000496484 | 100 |
| 39 | 3300009093 | Ga0105240_11521383 | Ga0105240_115213832 | 100 |
| 40 | 3300009098 | Ga0105245_10163410 | Ga0105245_101634103 | 100 |
| 41 | 3300009098 | Ga0105245_10355825 | Ga0105245_103558252 | 100 |
| 42 | 3300009174 | Ga0105241_10037753 | Ga0105241_100377532 | 100 |
| 43 | 3300009176 | Ga0105242_10057309 | Ga0105242_100573092 | 100 |
| 44 | 3300009177 | Ga0105248_10031222 | Ga0105248_100312222 | 100 |
| 45 | 3300010375 | Ga0105239_10255025 | Ga0105239_102550254 | 100 |
| 46 | 3300010375 | Ga0105239_11751510 | Ga0105239_117515102 | 100 |
| 47 | 3300011119 | Ga0105246_10022012 | Ga0105246_100220123 | 100 |
| 48 | 3300013100 | Ga0157373_10001837 | Ga0157373_100018375 | 100 |
| 49 | 3300013102 | Ga0157371_10028177 | Ga0157371_100281774 | 100 |
| 50 | 3300013105 | Ga0157369_10124983 | Ga0157369_101249832 | 100 |
| 51 | 3300013296 | Ga0157374_10052267 | Ga0157374_100522672 | 100 |
| 52 | 3300013307 | Ga0157372_10135986 | Ga0157372_101359865 | 100 |
| 53 | 3300013307 | Ga0157372_10979111 | Ga0157372_109791111 | 100 |
| 54 | 3300014325 | Ga0163163_10037251 | Ga0163163_100372512 | 100 |
| 55 | 3300014745 | Ga0157377_10000301 | Ga0157377_1000030119 | 100 |
| 56 | 3300014969 | Ga0157376_10003366 | Ga0157376_100033668 | 100 |
| 57 | 3300025315 | Ga0207697_10042371 | Ga0207697_100423712 | 100 |
| 58 | 3300025321 | Ga0207656_10151908 | Ga0207656_101519083 | 100 |
| 59 | 3300025903 | Ga0207680_10411468 | Ga0207680_104114682 | 100 |
| 60 | 3300025904 | Ga0207647_10164272 | Ga0207647_101642722 | 100 |
| 61 | 3300025908 | Ga0207643_10412329 | Ga0207643_104123292 | 100 |
| 62 | 3300025911 | Ga0207654_10151475 | Ga0207654_101514752 | 100 |
| 63 | 3300025912 | Ga0207707_10028243 | Ga0207707_100282433 | 100 |
| 64 | 3300025918 | Ga0207662_10136412 | Ga0207662_101364122 | 100 |
| 65 | 3300025919 | Ga0207657_10011766 | Ga0207657_100117667 | 100 |
| 66 | 3300025920 | Ga0207649_10013428 | Ga0207649_100134282 | 100 |
| 67 | 3300025921 | Ga0207652_10015246 | Ga0207652_100152465 | 100 |
| 68 | 3300025923 | Ga0207681_10044441 | Ga0207681_100444415 | 100 |
| 69 | 3300025925 | Ga0207650_10067215 | Ga0207650_100672152 | 100 |
| 70 | 3300025926 | Ga0207659_10054539 | Ga0207659_100545392 | 100 |
| 71 | 3300025927 | Ga0207687_10121433 | Ga0207687_101214332 | 100 |
| 72 | 3300025932 | Ga0207690_10094210 | Ga0207690_100942104 | 100 |
| 73 | 3300025933 | Ga0207706_10005408 | Ga0207706_100054084 | 100 |
| 74 | 3300025933 | Ga0207706_10165811 | Ga0207706_101658112 | 100 |
| 75 | 3300025934 | Ga0207686_10056593 | Ga0207686_100565931 | 100 |
| 76 | 3300025936 | Ga0207670_10013484 | Ga0207670_100134842 | 100 |
| 77 | 3300025940 | Ga0207691_11155928 | Ga0207691_111559282 | 100 |
| 78 | 3300025941 | Ga0207711_10042189 | Ga0207711_100421893 | 100 |
| 79 | 3300025942 | Ga0207689_10007389 | Ga0207689_100073892 | 100 |
| 80 | 3300025944 | Ga0207661_10001687 | Ga0207661_100016873 | 100 |
| 81 | 3300025945 | Ga0207679_10014652 | Ga0207679_100146523 | 100 |
| 82 | 3300025949 | Ga0207667_10111535 | Ga0207667_101115352 | 100 |
| 83 | 3300025986 | Ga0207658_10503264 | Ga0207658_105032641 | 100 |
| 84 | 3300026023 | Ga0207677_10263914 | Ga0207677_102639142 | 100 |
| 85 | 3300026041 | Ga0207639_10310772 | Ga0207639_103107722 | 100 |
| 86 | 3300026067 | Ga0207678_10337297 | Ga0207678_103372971 | 100 |
| 87 | 3300026078 | Ga0207702_10047603 | Ga0207702_100476032 | 100 |
| 88 | 3300026088 | Ga0207641_10028691 | Ga0207641_100286914 | 100 |
| 89 | 3300026095 | Ga0207676_10007256 | Ga0207676_100072565 | 100 |
| 90 | 3300026116 | Ga0207674_10000421 | Ga0207674_1000042146 | 100 |
| 91 | 3300028381 | Ga0268264_10192920 | Ga0268264_101929203 | 100 |
| 92 | 3300005545 | Ga0070695_101654963 | Ga0070695_1016549631 | 101 |
| 93 | 3300046531 | Ga0495665_0009743 | Ga0495665_0009743_1025_1399 | 101 |
| 94 | 3300046557 | Ga0495622_0228822 | Ga0495622_0228822_401_775 | 101 |
| 95 | 3300048089 | Ga0495614_0284246 | Ga0495614_0284246_137_511 | 101 |
| 96 | 3300026118 | Ga0207675_101392402 | Ga0207675_1013924021 | 103 |
| 97 | 3300031548 | Ga0307408_100242494 | Ga0307408_1002424942 | 104 |
| 98 | 3300025910 | Ga0207684_10098839 | Ga0207684_100988393 | 106 |
| 99 | iso_pu_bacteria | 8006984368 | 8006986791 | 106 |
| 100 | 3300005328 | Ga0070676_10158260 | Ga0070676_101582602 | 110 |
| 101 | 3300005331 | Ga0070670_100231758 | Ga0070670_1002317582 | 110 |
| 102 | 3300005335 | Ga0070666_10440045 | Ga0070666_104400452 | 110 |
| 103 | 3300005338 | Ga0068868_100260461 | Ga0068868_1002604612 | 110 |
| 104 | 3300005355 | Ga0070671_100359954 | Ga0070671_1003599542 | 110 |
| 105 | 3300005364 | Ga0070673_100128132 | Ga0070673_1001281322 | 110 |
| 106 | 3300005367 | Ga0070667_100173604 | Ga0070667_1001736041 | 110 |
| 107 | 3300005367 | Ga0070667_100978319 | Ga0070667_1009783192 | 110 |
| 108 | 3300005436 | Ga0070713_100242899 | Ga0070713_1002428992 | 110 |
| 109 | 3300005438 | Ga0070701_11029424 | Ga0070701_110294241 | 110 |
| 110 | 3300005441 | Ga0070700_100337195 | Ga0070700_1003371952 | 110 |
| 111 | 3300005467 | Ga0070706_101004994 | Ga0070706_1010049942 | 110 |
| 112 | 3300005543 | Ga0070672_100538073 | Ga0070672_1005380732 | 110 |
| 113 | 3300005546 | Ga0070696_100730806 | Ga0070696_1007308062 | 110 |
| 114 | 3300005614 | Ga0068856_102224740 | Ga0068856_1022247401 | 110 |
| 115 | 3300005843 | Ga0068860_100221576 | Ga0068860_1002215762 | 110 |
| 116 | 3300005843 | Ga0068860_102326915 | Ga0068860_1023269152 | 110 |
| 117 | 3300005844 | Ga0068862_100770599 | Ga0068862_1007705992 | 110 |
| 118 | 3300005844 | Ga0068862_102488750 | Ga0068862_1024887501 | 110 |
| 119 | 3300006028 | Ga0070717_10106383 | Ga0070717_101063833 | 110 |
| 120 | 3300006163 | Ga0070715_10317316 | Ga0070715_103173162 | 110 |
| 121 | 3300006173 | Ga0070716_100917399 | Ga0070716_1009173992 | 110 |
| 122 | 3300006237 | Ga0097621_100076536 | Ga0097621_1000765362 | 110 |
| 123 | 3300006237 | Ga0097621_100924898 | Ga0097621_1009248981 | 110 |
| 124 | 3300006358 | Ga0068871_100005659 | Ga0068871_1000056597 | 110 |
| 125 | 3300006844 | Ga0075428_100010980 | Ga0075428_1000109807 | 110 |
| 126 | 3300006844 | Ga0075428_100030838 | Ga0075428_1000308388 | 110 |
| 127 | 3300006846 | Ga0075430_100568320 | Ga0075430_1005683201 | 110 |
| 128 | 3300006846 | Ga0075430_101432350 | Ga0075430_1014323501 | 110 |
| 129 | 3300006847 | Ga0075431_100000029 | Ga0075431_10000002952 | 110 |
| 130 | 3300006847 | Ga0075431_100086156 | Ga0075431_1000861563 | 110 |
| 131 | 3300006880 | Ga0075429_100328274 | Ga0075429_1003282742 | 110 |
| 132 | 3300006881 | Ga0068865_100079097 | Ga0068865_1000790972 | 110 |
| 133 | 3300009092 | Ga0105250_10199721 | Ga0105250_101997211 | 110 |
| 134 | 3300009098 | Ga0105245_11024602 | Ga0105245_110246021 | 110 |
| 135 | 3300009147 | Ga0114129_11276898 | Ga0114129_112768982 | 110 |
| 136 | 3300009174 | Ga0105241_11341871 | Ga0105241_113418712 | 110 |
| 137 | 3300009553 | Ga0105249_10079566 | Ga0105249_100795664 | 110 |
| 138 | 3300010375 | Ga0105239_11230014 | Ga0105239_112300141 | 110 |
| 139 | 3300013306 | Ga0163162_10061933 | Ga0163162_100619333 | 110 |
| 140 | 3300013308 | Ga0157375_13669750 | Ga0157375_136697502 | 110 |
| 141 | 3300025903 | Ga0207680_10429542 | Ga0207680_104295422 | 110 |
| 142 | 3300025905 | Ga0207685_10344658 | Ga0207685_103446581 | 110 |
| 143 | 3300025906 | Ga0207699_10138614 | Ga0207699_101386142 | 110 |
| 144 | 3300025906 | Ga0207699_10586935 | Ga0207699_105869352 | 110 |
| 145 | 3300025907 | Ga0207645_10348904 | Ga0207645_103489042 | 110 |
| 146 | 3300025908 | Ga0207643_10007393 | Ga0207643_100073932 | 110 |
| 147 | 3300025915 | Ga0207693_10139899 | Ga0207693_101398992 | 110 |
| 148 | 3300025918 | Ga0207662_10883516 | Ga0207662_108835162 | 110 |
| 149 | 3300025923 | Ga0207681_10232744 | Ga0207681_102327443 | 110 |
| 150 | 3300025925 | Ga0207650_10037059 | Ga0207650_100370593 | 110 |
| 151 | 3300025925 | Ga0207650_10288139 | Ga0207650_102881393 | 110 |
| 152 | 3300025928 | Ga0207700_10916066 | Ga0207700_109160661 | 110 |
| 153 | 3300025931 | Ga0207644_10092880 | Ga0207644_100928802 | 110 |
| 154 | 3300025933 | Ga0207706_11604081 | Ga0207706_116040812 | 110 |
| 155 | 3300025939 | Ga0207665_10459699 | Ga0207665_104596992 | 110 |
| 156 | 3300025940 | Ga0207691_11358491 | Ga0207691_113584911 | 110 |
| 157 | 3300025941 | Ga0207711_12004332 | Ga0207711_120043322 | 110 |
| 158 | 3300025961 | Ga0207712_10004137 | Ga0207712_100041378 | 110 |
| 159 | 3300025961 | Ga0207712_10081851 | Ga0207712_100818513 | 110 |
| 160 | 3300025986 | Ga0207658_10409264 | Ga0207658_104092643 | 110 |
| 161 | 3300026089 | Ga0207648_10079250 | Ga0207648_100792503 | 110 |
| 162 | 3300026095 | Ga0207676_10642981 | Ga0207676_106429812 | 110 |
| 163 | 3300026116 | Ga0207674_10008757 | Ga0207674_100087574 | 110 |
| 164 | 3300026118 | Ga0207675_100069760 | Ga0207675_1000697603 | 110 |
| 165 | 3300027665 | Ga0209983_1102479 | Ga0209983_11024791 | 110 |
| 166 | 3300027682 | Ga0209971_1082808 | Ga0209971_10828082 | 110 |
| 167 | 3300027717 | Ga0209998_10008584 | Ga0209998_100085843 | 110 |
| 168 | 3300027876 | Ga0209974_10079896 | Ga0209974_100798962 | 110 |
| 169 | 3300027907 | Ga0207428_10360441 | Ga0207428_103604411 | 110 |
| 170 | 3300028380 | Ga0268265_10700584 | Ga0268265_107005841 | 110 |
| 171 | 3300028380 | Ga0268265_12015510 | Ga0268265_120155101 | 110 |
| 172 | 3300028381 | Ga0268264_11879548 | Ga0268264_118795481 | 110 |
| 173 | 3300030760 | Ga0265762_1000576 | Ga0265762_10005762 | 110 |
| 174 | 3300031548 | Ga0307408_101005086 | Ga0307408_1010050861 | 110 |
| 175 | 3300031731 | Ga0307405_10697367 | Ga0307405_106973673 | 110 |
| 176 | 3300031824 | Ga0307413_10602228 | Ga0307413_106022282 | 110 |
| 177 | 3300031852 | Ga0307410_10073813 | Ga0307410_100738131 | 110 |
| 178 | 3300031901 | Ga0307406_10151034 | Ga0307406_101510341 | 110 |
| 179 | 3300031903 | Ga0307407_10849110 | Ga0307407_108491101 | 110 |
| 180 | 3300031911 | Ga0307412_10638871 | Ga0307412_106388712 | 110 |
| 181 | 3300031995 | Ga0307409_101684050 | Ga0307409_1016840502 | 110 |
| 182 | 3300032002 | Ga0307416_101359078 | Ga0307416_1013590781 | 110 |
| 183 | 3300032002 | Ga0307416_102761471 | Ga0307416_1027614712 | 110 |
| 184 | 3300032005 | Ga0307411_10328310 | Ga0307411_103283103 | 110 |
| 185 | 3300032126 | Ga0307415_100502309 | Ga0307415_1005023092 | 110 |
| 186 | 3300035170 | Ga0373943_0175397 | Ga0373943_0175397_120_452 | 110 |
| 187 | 3300035171 | Ga0373946_0768135 | Ga0373946_0768135_24_356 | 110 |
| 188 | 3300035692 | Ga0373935_0524336 | Ga0373935_0524336_26_358 | 110 |
| 189 | 3300035725 | Ga0373947_0046039 | Ga0373947_0046039_1172_1504 | 110 |
| 190 | 3300037068 | Ga0373925_0062889 | Ga0373925_0062889_1083_1415 | 110 |
| 191 | 3300037068 | Ga0373925_0810988 | Ga0373925_0810988_139_471 | 110 |
| 192 | 3300038443 | Ga0395901_1827824 | Ga0395901_1827824_214_546 | 110 |
| 193 | 3300039437 | Ga0436365_1383187 | Ga0436365_1383187_331_663 | 110 |
| 194 | 3300045976 | Ga0466967_0124027 | Ga0466967_0124027_1295_1627 | 110 |
| 195 | 3300045976 | Ga0466967_0784648 | Ga0466967_0784648_113_445 | 110 |
| 196 | 3300046472 | Ga0495580_0114660 | Ga0495580_0114660_1468_1800 | 110 |
| 197 | 3300047319 | Ga0495674_0378162 | Ga0495674_0378162_387_719 | 110 |
| 198 | 3300048904 | Ga0496101_0805126 | Ga0496101_0805126_171_503 | 110 |
| 199 | 3300048907 | Ga0496104_1520975 | Ga0496104_1520975_224_556 | 110 |
| 200 | 3300048915 | Ga0496112_0122850 | Ga0496112_0122850_1076_1408 | 110 |
| 201 | 3300049569 | Ga0501032_0614470 | Ga0501032_0614470_316_648 | 110 |
| 202 | 3300049575 | Ga0501039_0046401 | Ga0501039_0046401_2918_3250 | 110 |
| 203 | 3300049580 | Ga0501046_0764073 | Ga0501046_0764073_98_430 | 110 |
| 204 | 3300049587 | Ga0501071_0023709 | Ga0501071_0023709_2755_3087 | 110 |
| 205 | 3300049591 | Ga0501075_1044816 | Ga0501075_1044816_129_461 | 110 |
| 206 | 3300049592 | Ga0501076_0036933 | Ga0501076_0036933_3344_3676 | 110 |
| 207 | 3300049668 | Ga0501233_038896 | Ga0501233_038896_737_1069 | 110 |
| 208 | 3300049741 | Ga0501079_0037349 | Ga0501079_0037349_3326_3658 | 110 |
| 209 | 3300049742 | Ga0501080_1498467 | Ga0501080_1498467_130_462 | 110 |
| 210 | 3300049824 | Ga0501045_0007212 | Ga0501045_0007212_2265_2597 | 110 |
| 211 | 3300050507 | nmdc:mga05p37_900070_c1 | nmdc:mga05p37_900070_c1_415_747 | 110 |
| 212 | 3300050508 | nmdc:mga09592_314060_c1 | nmdc:mga09592_314060_c1_480_812 | 110 |
| 213 | 3300050509 | nmdc:mga0qj67_1191127_c1 | nmdc:mga0qj67_1191127_c1_59_391 | 110 |
| 214 | 3300050509 | nmdc:mga0qj67_643663_c1 | nmdc:mga0qj67_643663_c1_438_770 | 110 |
| 215 | 3300050510 | nmdc:mga06r32_237026_c1 | nmdc:mga06r32_237026_c1_1215_1547 | 110 |
| 216 | 3300050510 | nmdc:mga06r32_85_c1 | nmdc:mga06r32_85_c1_47206_47538 | 110 |
| 217 | 3300050510 | nmdc:mga06r32_916820_c1 | nmdc:mga06r32_916820_c1_41_373 | 110 |
| 218 | 3300050511 | nmdc:mga08y16_1485707_c1 | nmdc:mga08y16_1485707_c1_146_478 | 110 |
| 219 | 3300050511 | nmdc:mga08y16_227872_c1 | nmdc:mga08y16_227872_c1_1136_1468 | 110 |
| 220 | 3300060353 | Ga0501082_0086625 | Ga0501082_0086625_75_407 | 110 |
| 221 | 3300061734 | Ga0530510_0800034 | Ga0530510_0800034_261_593 | 110 |
| 222 | 3300005329 | Ga0070683_101106055 | Ga0070683_1011060551 | 111 |
| 223 | 3300005336 | Ga0070680_100519750 | Ga0070680_1005197502 | 111 |
| 224 | 3300005344 | Ga0070661_100314796 | Ga0070661_1003147962 | 111 |
| 225 | 3300005353 | Ga0070669_100136876 | Ga0070669_1001368764 | 111 |
| 226 | 3300005354 | Ga0070675_100031757 | Ga0070675_1000317575 | 111 |
| 227 | 3300005355 | Ga0070671_100001970 | Ga0070671_10000197019 | 111 |
| 228 | 3300005356 | Ga0070674_100027822 | Ga0070674_1000278222 | 111 |
| 229 | 3300005364 | Ga0070673_100046339 | Ga0070673_1000463394 | 111 |
| 230 | 3300005440 | Ga0070705_100102042 | Ga0070705_1001020423 | 111 |
| 231 | 3300005457 | Ga0070662_100010807 | Ga0070662_1000108072 | 111 |
| 232 | 3300005457 | Ga0070662_101500607 | Ga0070662_1015006072 | 111 |
| 233 | 3300005459 | Ga0068867_100056232 | Ga0068867_1000562324 | 111 |
| 234 | 3300005518 | Ga0070699_100828791 | Ga0070699_1008287911 | 111 |
| 235 | 3300005535 | Ga0070684_100105439 | Ga0070684_1001054393 | 111 |
| 236 | 3300005543 | Ga0070672_100008964 | Ga0070672_1000089647 | 111 |
| 237 | 3300005578 | Ga0068854_100596053 | Ga0068854_1005960532 | 111 |
| 238 | 3300005617 | Ga0068859_103082916 | Ga0068859_1030829161 | 111 |
| 239 | 3300005618 | Ga0068864_100206816 | Ga0068864_1002068164 | 111 |
| 240 | 3300005718 | Ga0068866_10213496 | Ga0068866_102134962 | 111 |
| 241 | 3300005719 | Ga0068861_101363787 | Ga0068861_1013637871 | 111 |
| 242 | 3300005840 | Ga0068870_10131906 | Ga0068870_101319061 | 111 |
| 243 | 3300005841 | Ga0068863_100634961 | Ga0068863_1006349612 | 111 |
| 244 | 3300005844 | Ga0068862_100238532 | Ga0068862_1002385324 | 111 |
| 245 | 3300006846 | Ga0075430_100145908 | Ga0075430_1001459082 | 111 |
| 246 | 3300006846 | Ga0075430_100401096 | Ga0075430_1004010961 | 111 |
| 247 | 3300006847 | Ga0075431_100014007 | Ga0075431_1000140073 | 111 |
| 248 | 3300006852 | Ga0075433_11454707 | Ga0075433_114547072 | 111 |
| 249 | 3300006881 | Ga0068865_100144970 | Ga0068865_1001449701 | 111 |
| 250 | 3300006881 | Ga0068865_100535018 | Ga0068865_1005350182 | 111 |
| 251 | 3300006931 | Ga0097620_103083951 | Ga0097620_1030839511 | 111 |
| 252 | 3300009098 | Ga0105245_11987288 | Ga0105245_119872882 | 111 |
| 253 | 3300009147 | Ga0114129_10643390 | Ga0114129_106433902 | 111 |
| 254 | 3300009177 | Ga0105248_10293612 | Ga0105248_102936121 | 111 |
| 255 | 3300009177 | Ga0105248_11439657 | Ga0105248_114396572 | 111 |
| 256 | 3300009553 | Ga0105249_11020120 | Ga0105249_110201201 | 111 |
| 257 | 3300013308 | Ga0157375_10010337 | Ga0157375_100103374 | 111 |
| 258 | 3300014745 | Ga0157377_10298833 | Ga0157377_102988333 | 111 |
| 259 | 3300021388 | Ga0213875_10202724 | Ga0213875_102027242 | 111 |
| 260 | 3300025899 | Ga0207642_10242373 | Ga0207642_102423732 | 111 |
| 261 | 3300025901 | Ga0207688_10062658 | Ga0207688_100626584 | 111 |
| 262 | 3300025908 | Ga0207643_10122402 | Ga0207643_101224022 | 111 |
| 263 | 3300025915 | Ga0207693_10272790 | Ga0207693_102727903 | 111 |
| 264 | 3300025917 | Ga0207660_10379601 | Ga0207660_103796012 | 111 |
| 265 | 3300025920 | Ga0207649_10336951 | Ga0207649_103369511 | 111 |
| 266 | 3300025923 | Ga0207681_11623882 | Ga0207681_116238821 | 111 |
| 267 | 3300025926 | Ga0207659_10235483 | Ga0207659_102354833 | 111 |
| 268 | 3300025931 | Ga0207644_10012984 | Ga0207644_100129845 | 111 |
| 269 | 3300025933 | Ga0207706_10050025 | Ga0207706_100500253 | 111 |
| 270 | 3300025938 | Ga0207704_10140115 | Ga0207704_101401151 | 111 |
| 271 | 3300025938 | Ga0207704_10419231 | Ga0207704_104192312 | 111 |
| 272 | 3300025940 | Ga0207691_10000448 | Ga0207691_1000044815 | 111 |
| 273 | 3300025941 | Ga0207711_10052819 | Ga0207711_100528194 | 111 |
| 274 | 3300025944 | Ga0207661_10067558 | Ga0207661_100675585 | 111 |
| 275 | 3300025981 | Ga0207640_10311867 | Ga0207640_103118671 | 111 |
| 276 | 3300026088 | Ga0207641_11294618 | Ga0207641_112946182 | 111 |
| 277 | 3300026089 | Ga0207648_10105812 | Ga0207648_101058123 | 111 |
| 278 | 3300026089 | Ga0207648_10747992 | Ga0207648_107479922 | 111 |
| 279 | 3300026121 | Ga0207683_10139600 | Ga0207683_101396002 | 111 |
| 280 | 3300030521 | Ga0307511_10288951 | Ga0307511_102889511 | 111 |
| 281 | 3300031548 | Ga0307408_100075118 | Ga0307408_1000751182 | 111 |
| 282 | 3300031731 | Ga0307405_10236608 | Ga0307405_102366082 | 111 |
| 283 | 3300031824 | Ga0307413_10006492 | Ga0307413_100064927 | 111 |
| 284 | 3300031852 | Ga0307410_10058434 | Ga0307410_100584345 | 111 |
| 285 | 3300031852 | Ga0307410_11436950 | Ga0307410_114369502 | 111 |
| 286 | 3300031903 | Ga0307407_10330264 | Ga0307407_103302643 | 111 |
| 287 | 3300031995 | Ga0307409_100139623 | Ga0307409_1001396234 | 111 |
| 288 | 3300032002 | Ga0307416_102972780 | Ga0307416_1029727802 | 111 |
| 289 | 3300032004 | Ga0307414_10047439 | Ga0307414_100474396 | 111 |
| 290 | 3300032005 | Ga0307411_10010863 | Ga0307411_100108634 | 111 |
| 291 | 3300032005 | Ga0307411_10243207 | Ga0307411_102432072 | 111 |
| 292 | 3300032126 | Ga0307415_100212620 | Ga0307415_1002126204 | 111 |
| 293 | 3300032126 | Ga0307415_100305849 | Ga0307415_1003058492 | 111 |
| 294 | 3300035242 | Ga0373962_0137593 | Ga0373962_0137593_153_488 | 111 |
| 295 | 3300035691 | Ga0373931_0010987 | Ga0373931_0010987_1804_2139 | 111 |
| 296 | 3300036401 | Ga0373937_0213835 | Ga0373937_0213835_429_764 | 111 |
| 297 | 3300036401 | Ga0373937_0568284 | Ga0373937_0568284_458_793 | 111 |
| 298 | 3300037466 | Ga0395898_1988322 | Ga0395898_1988322_17_352 | 111 |
| 299 | 3300037471 | Ga0395905_0087159 | Ga0395905_0087159_212_547 | 111 |
| 300 | 3300037471 | Ga0395905_0100110 | Ga0395905_0100110_640_975 | 111 |
| 301 | 3300037853 | Ga0436364_0995426 | Ga0436364_0995426_354_689 | 111 |
| 302 | 3300046461 | Ga0495641_0010584 | Ga0495641_0010584_3165_3500 | 111 |
| 303 | 3300046472 | Ga0495580_0041829 | Ga0495580_0041829_1514_1888 | 111 |
| 304 | 3300046473 | Ga0495582_0008213 | Ga0495582_0008213_3445_3780 | 111 |
| 305 | 3300046476 | Ga0495662_0022173 | Ga0495662_0022173_1880_2215 | 111 |
| 306 | 3300046477 | Ga0495664_0017273 | Ga0495664_0017273_1290_1625 | 111 |
| 307 | 3300046516 | Ga0495628_0046005 | Ga0495628_0046005_1548_1883 | 111 |
| 308 | 3300046517 | Ga0495630_0027182 | Ga0495630_0027182_1807_2142 | 111 |
| 309 | 3300046526 | Ga0495666_0008350 | Ga0495666_0008350_1128_1463 | 111 |
| 310 | 3300046533 | Ga0495640_0019422 | Ga0495640_0019422_3603_3938 | 111 |
| 311 | 3300046535 | Ga0495586_0001912 | Ga0495586_0001912_8979_9314 | 111 |
| 312 | 3300046535 | Ga0495586_0893951 | Ga0495586_0893951_39_374 | 111 |
| 313 | 3300046539 | Ga0495621_0271760 | Ga0495621_0271760_97_432 | 111 |
| 314 | 3300046559 | Ga0495667_0457580 | Ga0495667_0457580_406_741 | 111 |
| 315 | 3300046642 | Ga0495634_0002414 | Ga0495634_0002414_867_1202 | 111 |
| 316 | 3300046664 | Ga0495659_0081588 | Ga0495659_0081588_257_592 | 111 |
| 317 | 3300046681 | Ga0495647_0018775 | Ga0495647_0018775_1653_1988 | 111 |
| 318 | 3300046683 | Ga0495658_0004380 | Ga0495658_0004380_5613_5948 | 111 |
| 319 | 3300046690 | Ga0495624_0455332 | Ga0495624_0455332_93_428 | 111 |
| 320 | 3300046691 | Ga0495670_0270684 | Ga0495670_0270684_550_885 | 111 |
| 321 | 3300047319 | Ga0495674_0011963 | Ga0495674_0011963_3744_4079 | 111 |
| 322 | 3300047321 | Ga0495676_0015714 | Ga0495676_0015714_3413_3748 | 111 |
| 323 | 3300047322 | Ga0495680_0026403 | Ga0495680_0026403_3627_3962 | 111 |
| 324 | 3300047471 | Ga0495684_0051356 | Ga0495684_0051356_854_1189 | 111 |
| 325 | 3300048909 | Ga0496106_0208882 | Ga0496106_0208882_745_1080 | 111 |
| 326 | 3300048911 | Ga0496108_0226114 | Ga0496108_0226114_933_1268 | 111 |
| 327 | 3300048913 | Ga0496110_0007343 | Ga0496110_0007343_7982_8317 | 111 |
| 328 | 3300048914 | Ga0496111_0447168 | Ga0496111_0447168_581_916 | 111 |
| 329 | 3300048915 | Ga0496112_0038131 | Ga0496112_0038131_525_860 | 111 |
| 330 | 3300050507 | nmdc:mga05p37_142076_c1 | nmdc:mga05p37_142076_c1_660_995 | 111 |
| 331 | 3300050507 | nmdc:mga05p37_2066941_c1 | nmdc:mga05p37_2066941_c1_146_481 | 111 |
| 332 | 3300050509 | nmdc:mga0qj67_1556166_c1 | nmdc:mga0qj67_1556166_c1_25_360 | 111 |
| 333 | 3300050510 | nmdc:mga06r32_39025_c1 | nmdc:mga06r32_39025_c1_1691_2026 | 111 |
| 334 | 3300053085 | Ga0495619_0566238 | Ga0495619_0566238_213_548 | 111 |
| 335 | 3300005841 | Ga0068863_102305426 | Ga0068863_1023054261 | 112 |
| 336 | 3300006847 | Ga0075431_101198791 | Ga0075431_1011987912 | 112 |
| 337 | 3300006914 | Ga0075436_100003773 | Ga0075436_1000037734 | 112 |
| 338 | 3300006914 | Ga0075436_100174320 | Ga0075436_1001743202 | 112 |
| 339 | 3300009094 | Ga0111539_10577310 | Ga0111539_105773102 | 112 |
| 340 | 3300025944 | Ga0207661_12088455 | Ga0207661_120884551 | 112 |
| 341 | 3300031824 | Ga0307413_10302819 | Ga0307413_103028191 | 112 |
| 342 | 3300031903 | Ga0307407_10269765 | Ga0307407_102697652 | 112 |
| 343 | 3300031995 | Ga0307409_101745441 | Ga0307409_1017454412 | 112 |
| 344 | 3300035171 | Ga0373946_0245742 | Ga0373946_0245742_505_843 | 112 |
| 345 | 3300035695 | Ga0373927_0216436 | Ga0373927_0216436_732_1070 | 112 |
| 346 | 3300035725 | Ga0373947_0005752 | Ga0373947_0005752_3383_3721 | 112 |
| 347 | 3300037068 | Ga0373925_0021145 | Ga0373925_0021145_214_552 | 112 |
| 348 | 3300046526 | Ga0495666_0017579 | Ga0495666_0017579_42_380 | 112 |
| 349 | 3300005334 | Ga0068869_100870590 | Ga0068869_1008705901 | 113 |
| 350 | 3300026075 | Ga0207708_10160584 | Ga0207708_101605842 | 113 |
| 351 | 3300026095 | Ga0207676_10646349 | Ga0207676_106463492 | 113 |
| 352 | 3300031548 | Ga0307408_101665921 | Ga0307408_1016659211 | 113 |
| 353 | 3300048917 | Ga0496114_0310026 | Ga0496114_0310026_407_748 | 113 |
| 354 | 3300005288 | Ga0065714_10227872 | Ga0065714_102278722 | 114 |
| 355 | 3300005293 | Ga0065715_10108592 | Ga0065715_101085926 | 114 |
| 356 | 3300005327 | Ga0070658_11483870 | Ga0070658_114838701 | 114 |
| 357 | 3300005355 | Ga0070671_100795676 | Ga0070671_1007956762 | 114 |
| 358 | 3300005406 | Ga0070703_10213538 | Ga0070703_102135382 | 114 |
| 359 | 3300005440 | Ga0070705_100048927 | Ga0070705_1000489273 | 114 |
| 360 | 3300005444 | Ga0070694_100586493 | Ga0070694_1005864932 | 114 |
| 361 | 3300005467 | Ga0070706_101319782 | Ga0070706_1013197821 | 114 |
| 362 | 3300005467 | Ga0070706_102159193 | Ga0070706_1021591931 | 114 |
| 363 | 3300005471 | Ga0070698_100001876 | Ga0070698_1000018769 | 114 |
| 364 | 3300005518 | Ga0070699_100014194 | Ga0070699_1000141942 | 114 |
| 365 | 3300005535 | Ga0070684_100150525 | Ga0070684_1001505251 | 114 |
| 366 | 3300005536 | Ga0070697_100328151 | Ga0070697_1003281512 | 114 |
| 367 | 3300005546 | Ga0070696_100000076 | Ga0070696_10000007660 | 114 |
| 368 | 3300005614 | Ga0068856_100943984 | Ga0068856_1009439841 | 114 |
| 369 | 3300005618 | Ga0068864_100063503 | Ga0068864_1000635031 | 114 |
| 370 | 3300006852 | Ga0075433_10082210 | Ga0075433_100822104 | 114 |
| 371 | 3300006871 | Ga0075434_100119742 | Ga0075434_1001197423 | 114 |
| 372 | 3300007076 | Ga0075435_100191355 | Ga0075435_1001913552 | 114 |
| 373 | 3300009147 | Ga0114129_10268020 | Ga0114129_102680202 | 114 |
| 374 | 3300009174 | Ga0105241_10869904 | Ga0105241_108699041 | 114 |
| 375 | 3300013308 | Ga0157375_10725371 | Ga0157375_107253712 | 114 |
| 376 | 3300025925 | Ga0207650_11712216 | Ga0207650_117122161 | 114 |
| 377 | 3300025931 | Ga0207644_10721075 | Ga0207644_107210752 | 114 |
| 378 | 3300026035 | Ga0207703_11952452 | Ga0207703_119524521 | 114 |
| 379 | 3300026078 | Ga0207702_10948308 | Ga0207702_109483082 | 114 |
| 380 | 3300026095 | Ga0207676_10383946 | Ga0207676_103839461 | 114 |
| 381 | 3300032004 | Ga0307414_10579489 | Ga0307414_105794891 | 114 |
| 382 | 3300034819 | Ga0373958_0019816 | Ga0373958_0019816_114_458 | 114 |
| 383 | 3300035092 | Ga0373952_0020746 | Ga0373952_0020746_350_694 | 114 |
| 384 | 3300048905 | Ga0496102_0227865 | Ga0496102_0227865_839_1189 | 114 |
| 385 | 3300048909 | Ga0496106_0359335 | Ga0496106_0359335_408_758 | 114 |
| 386 | 3300048912 | Ga0496109_0706241 | Ga0496109_0706241_202_546 | 114 |
| 387 | 3300048915 | Ga0496112_0001305 | Ga0496112_0001305_18345_18689 | 114 |
| 388 | 3300048916 | Ga0496113_0937985 | Ga0496113_0937985_45_389 | 114 |
| 389 | 3300050512 | nmdc:mga0n895_372237_c1 | nmdc:mga0n895_372237_c1_40_390 | 114 |
| 390 | 3300050515 | nmdc:mga0a205_731392_c1 | nmdc:mga0a205_731392_c1_232_582 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uqp-assembly1.cif.gz_B | the crystal structure of cupin protein from rhodococcus jostii rha1 | 0.9424 | 26 | 103 |
| 7u1j-assembly2.cif.gz_B | crystal structure of pisum sativum convicilin | 0.9244 | 27 | 110 |
| 2pfw-assembly1.cif.gz_B | crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution | 0.9205 | 28 | 104 |
| 3ww2-assembly1.cif.gz_A | x-ray structures of cellulomonas parahominis l-ribose isomerase with l-psicose | 0.9204 | 27 | 102 |
| 3ww1-assembly1.cif.gz_A | x-ray structure of cellulomonas parahominis l-ribose isomerase with l-ribose | 0.9192 | 26 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9403 | 28 | 100 | 2.60.120.10 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.94 | 26 | 100 | 2.60.120.10 |
| af_F1LVA4_327_469_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9341 | 28 | 110 | 2.60.120.10 |
| af_F1LVA4_66_267_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9327 | 28 | 111 | 2.60.120.10 |
| 3ww1A00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9192 | 26 | 102 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6D631-F1-model_v4 | Cupin domain-containing protein | 0.9846 | 29 | 110 |
|
| AF-A0A4Q1UZR3-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9794 | 1 | 110 |
|
| AF-A0A1G7MWA7-F1-model_v4 | Cupin domain-containing protein | 0.975 | 1 | 110 |
|
| AF-A0A2V6D631-F1-model_v4 | Cupin domain-containing protein | 0.973 | 29 | 110 |
|
| AF-A0A2W0BMR1-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9727 | 1 | 110 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar