metagRoot

F431549

General Info

Members	Datasets	Scaffolds	Average Seq Length
389	287	362	157

Family's Representative Sequence

Representative Sequence	3300047318\|Ga0495636_0467790\|Ga0495636_0467790_122_595
Length	157
Sequence	MDIDTPATRALEGTGVAYEVVHTERPNSAEESASLQGIHLEQLLRSIVVRLSEDEYVFVLVPGGRQIDWPKLRAHLGVKRLSLPDADEARAATGYERGAITPFGSATAWPVIADAAIARLDRVAIGGGSRGVNLHMAPDDLVASAGAVVIDVTKPDG

Samples

	Sample ID	Description	Type	Environment
1	2501939600	Micromonospora sp. L5	Isolate	Unclassified
2	2622736626	Micromonospora rhizosphaerae DSM 45431	Isolate	Rhizosphere
3	2856858025	Micromonospora aurantiaca 110B(2018)	Isolate	Unclassified
4	2857288857	Micromonospora noduli ONO23	Isolate	Unclassified
5	2858848962	Micromonospora saelicesensis GAR06	Isolate	Unclassified
6	2858868258	Micromonospora sp. MH33	Isolate	Unclassified
7	2858882152	Micromonospora noduli MED15	Isolate	Nodule
8	2858888857	Micromonospora saelicesensis Lupac 06	Isolate	Unclassified
9	2858895516	Micromonospora saelicesensis PSN13	Isolate	Unclassified
10	2867302475	Micromonospora globbae WPS1-2	Isolate	Unclassified
11	2867312974	Micromonospora musae NGC1-4	Isolate	Unclassified
12	2867319477	Micromonospora musae MS1-9	Isolate	Unclassified
13	2869048445	Micromonospora saelicesensis PSN01	Isolate	Unclassified
14	2869061728	Micromonospora noduli ONO86	Isolate	Unclassified
15	2869068681	Micromonospora noduli GUI43	Isolate	Unclassified
16	2880489317	Micromonospora ureilytica DSM 101692	Isolate	Unclassified
17	2880495981	Micromonospora vinacea DSM 101695	Isolate	Unclassified
18	2887478801	Catellatospora paridis NEAU-CL2	Isolate	Rhizosphere
19	2902582711	Micromonospora sp. AP08	Isolate	Unclassified
20	2929219909	Micromonospora sp. R-75348 Hybrid assembly	Isolate	Unclassified
21	2929226422	Micromonospora sp. R-74116 Hybrid assembly	Isolate	Unclassified
22	2996221748	Micromonospora veneta CAP181	Isolate	Unclassified
23	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
24	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
25	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
26	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
27	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
28	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
29	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
30	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
31	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
32	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
33	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
34	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
35	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
36	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
37	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
38	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
39	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
40	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
41	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
42	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
43	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
44	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
45	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
46	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
47	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
48	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
49	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
50	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
51	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
52	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
53	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
54	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
55	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
56	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
57	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
58	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
59	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
60	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
61	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
62	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
63	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
64	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
65	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
66	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
67	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
68	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
69	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
70	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
71	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
72	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
73	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
74	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
75	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
76	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
77	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
78	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
79	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
80	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
81	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
82	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
83	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
84	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
85	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
86	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
87	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
88	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
89	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
90	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
91	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
92	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
93	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
94	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
95	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
96	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
97	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
98	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
99	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
100	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
101	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
102	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
103	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
104	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
105	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
106	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
107	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
108	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
109	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
110	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
111	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
112	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
113	3300009993	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG	Metagenome	Rhizosphere
114	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
115	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
116	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
117	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
118	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
119	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
120	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
121	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
122	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
123	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
124	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
125	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
126	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
127	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
128	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
129	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
130	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
184	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
185	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
186	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
187	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
188	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
189	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
190	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
191	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
192	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
193	3300031889	Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO	Metagenome	Rhizosphere
194	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
195	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
196	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
197	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
198	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
199	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
200	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
201	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
202	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
203	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
204	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
205	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
206	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
207	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
208	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
209	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
210	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
211	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
212	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
213	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
214	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
215	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
216	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
217	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
218	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
219	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
220	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
221	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
222	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
223	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
224	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
225	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
226	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
227	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
228	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
229	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
230	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
231	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
232	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
233	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
234	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
235	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
236	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
237	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
238	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
239	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
240	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
241	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
242	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
243	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
244	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
245	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
246	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
247	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
248	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
249	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
250	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
251	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
252	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
253	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
254	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
255	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
256	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
257	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
258	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
259	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
260	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
261	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
262	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
263	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
264	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
265	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
266	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
267	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
268	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
269	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
270	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
271	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
272	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
273	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
274	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
275	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
276	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
277	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
278	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
279	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
280	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
281	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
282	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
283	649633069	Micromonospora sp. L5	Isolate	Unclassified
284	8001781756	Catellatospora tritici NEAU-YM18	Isolate	Rhizosphere
285	8003830390	Micromonospora parastrephiae STR1_7	Isolate	Rhizosphere
286	8054704163	Micromonospora trifolii NIE79	Isolate	Nodule
287	8054734606	Micromonospora hortensis NIE111	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	92.8
Metatranscriptomes	0.26
Isolates	6.94

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.29
Nodule	0.77
Rhizoplane	5.66
Rhizosphere	82.52
Stem	0
Stem Tuber	0
Unclassified	9.77

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10011423	3300003203	Bacteria	3896
2	rootH2_10016519	3300003320	Bacteria	6700
3	Ga0070658_10000726	3300005327	Bacteria	28475
4	Ga0070658_10126155	3300005327	Bacteria	2131
5	Ga0070658_10480948	3300005327	Bacteria	1072
6	Ga0070676_10054343	3300005328	Bacteria	2361
7	Ga0070676_10974660	3300005328	Bacteria	635
8	Ga0070683_100036419	3300005329	Bacteria	4502
9	Ga0070683_100167949	3300005329	Bacteria	2082
10	Ga0070690_100060100	3300005330	Bacteria	2445
11	Ga0068869_100088826	3300005334	Bacteria	2320
12	Ga0070666_10096256	3300005335	Bacteria	2037
13	Ga0070680_100037767	3300005336	Bacteria	3903
14	Ga0070680_100163778	3300005336	Bacteria	1869
15	Ga0070682_100062246	3300005337	Bacteria	2363
16	Ga0070682_100362487	3300005337	Bacteria	1084
17	Ga0068868_100048749	3300005338	Bacteria	3323
18	Ga0070660_100015918	3300005339	Bacteria	5445
19	Ga0070689_100307581	3300005340	Bacteria	1321
20	Ga0070691_10037767	3300005341	Bacteria	2279
21	Ga0070687_100023576	3300005343	Bacteria	2926
22	Ga0070661_100114083	3300005344	Bacteria	2020
23	Ga0070692_10683995	3300005345	Bacteria	688
24	Ga0070675_100031747	3300005354	Bacteria	4271
25	Ga0070671_100027571	3300005355	Bacteria	4676
26	Ga0070674_100209468	3300005356	Bacteria	1510
27	Ga0070673_100102630	3300005364	Bacteria	2358
28	Ga0070659_100154482	3300005366	Bacteria	1873
29	Ga0070667_100437110	3300005367	Bacteria	1194
30	Ga0070714_100413574	3300005435	Bacteria	1277
31	Ga0070710_10342456	3300005437	Bacteria	987
32	Ga0070710_10476263	3300005437	Bacteria	850
33	Ga0070701_10021312	3300005438	Bacteria	3090
34	Ga0070705_100335693	3300005440	Bacteria	1096
35	Ga0070700_100151291	3300005441	Bacteria	1587
36	Ga0070694_100950006	3300005444	Bacteria	712
37	Ga0070708_100063323	3300005445	Bacteria	3310
38	Ga0070708_100296530	3300005445	Bacteria	1522
39	Ga0070663_100044935	3300005455	Bacteria	3118
40	Ga0070678_100156150	3300005456	Bacteria	1843
41	Ga0070662_100157388	3300005457	Bacteria	1774
42	Ga0070681_10238803	3300005458	Bacteria	1731
43	Ga0070685_10177055	3300005466	Bacteria	1370
44	Ga0070706_100071045	3300005467	Bacteria	3219
45	Ga0070707_100034423	3300005468	Bacteria	4831
46	Ga0070698_100429770	3300005471	Bacteria	1255
47	Ga0070699_100000885	3300005518	Bacteria	27923
48	Ga0070679_100027291	3300005530	Bacteria	5618
49	Ga0070679_100389310	3300005530	Bacteria	1340
50	Ga0070684_100112604	3300005535	Bacteria	2441
51	Ga0070684_100633563	3300005535	Bacteria	995
52	Ga0070697_100001238	3300005536	Bacteria	19324
53	Ga0068853_100076407	3300005539	Bacteria	2924
54	Ga0068853_100994670	3300005539	Bacteria	807
55	Ga0070672_100187868	3300005543	Bacteria	1724
56	Ga0070696_100041514	3300005546	Bacteria	3178
57	Ga0070693_100280045	3300005547	Bacteria	1116
58	Ga0070665_100145344	3300005548	Bacteria	2374
59	Ga0070704_100084006	3300005549	Bacteria	2352
60	Ga0068855_100104482	3300005563	Bacteria	3258
61	Ga0068855_100583550	3300005563	Bacteria	1207
62	Ga0070664_100047974	3300005564	Bacteria	3609
63	Ga0068857_100077294	3300005577	Bacteria	2970
64	Ga0068857_100170742	3300005577	Bacteria	1977
65	Ga0068854_100020345	3300005578	Bacteria	4488
66	Ga0068856_100216441	3300005614	Bacteria	1931
67	Ga0070702_100033244	3300005615	Bacteria	2834
68	Ga0068852_100266662	3300005616	Bacteria	1646
69	Ga0068859_100351677	3300005617	Bacteria	1568
70	Ga0068864_100015888	3300005618	Bacteria	6265
71	Ga0068864_100219849	3300005618	Bacteria	1752
72	Ga0068864_101086847	3300005618	Bacteria	796
73	Ga0068866_10125809	3300005718	Bacteria	1451
74	Ga0068870_10020790	3300005840	Bacteria	3202
75	Ga0068863_100117323	3300005841	Bacteria	2536
76	Ga0068860_100377297	3300005843	Bacteria	1399
77	Ga0068860_101177029	3300005843	Bacteria	787
78	Ga0081540_1014581	3300005983	Bacteria	5026
79	Ga0081539_10000143	3300005985	Bacteria	165345
80	Ga0081539_10001937	3300005985	Bacteria	31729
81	Ga0081539_10017612	3300005985	Bacteria	5005
82	Ga0075363_100231014	3300006048	Bacteria	1062
83	Ga0070715_10021885	3300006163	Bacteria	2485
84	Ga0070716_100130793	3300006173	Bacteria	1586
85	Ga0070716_101005606	3300006173	Bacteria	659
86	Ga0070712_100060748	3300006175	Bacteria	2667
87	Ga0070712_101300609	3300006175	Bacteria	634
88	Ga0070712_101378064	3300006175	Bacteria	615
89	Ga0075367_10534823	3300006178	Bacteria	744
90	Ga0097621_100114646	3300006237	Bacteria	2280
91	Ga0068871_100219568	3300006358	Bacteria	1646
92	Ga0075428_100001140	3300006844	Bacteria	28392
93	Ga0075428_100128866	3300006844	Bacteria	2753
94	Ga0075428_101161888	3300006844	Bacteria	814
95	Ga0075428_101268097	3300006844	Bacteria	776
96	Ga0075430_100016929	3300006846	Bacteria	6208
97	Ga0075430_100614182	3300006846	Bacteria	897
98	Ga0075431_100015806	3300006847	Bacteria	7652
99	Ga0075431_100024291	3300006847	Bacteria	6208
100	Ga0075433_10435640	3300006852	Bacteria	1156
101	Ga0075434_100845839	3300006871	Bacteria	930
102	Ga0075429_100013638	3300006880	Bacteria	7048
103	Ga0075429_100283010	3300006880	Bacteria	1452
104	Ga0068865_100131343	3300006881	Bacteria	1877
105	Ga0097620_100351693	3300006931	Bacteria	1568
106	Ga0075435_100230522	3300007076	Bacteria	1573
107	Ga0105251_10165779	3300009011	Bacteria	996
108	Ga0105251_10492642	3300009011	Bacteria	572
109	Ga0105244_10160207	3300009036	Bacteria	1075
110	Ga0105250_10125997	3300009092	Bacteria	1055
111	Ga0105245_10561659	3300009098	Bacteria	1164
112	Ga0105247_10055788	3300009101	Bacteria	2438
113	Ga0114129_10000031	3300009147	Bacteria	111827
114	Ga0114129_10060028	3300009147	Bacteria	5317
115	Ga0114129_10746117	3300009147	Bacteria	1254
116	Ga0114129_11326907	3300009147	Bacteria	891
117	Ga0105243_10112157	3300009148	Bacteria	2284
118	Ga0105241_10128842	3300009174	Bacteria	2046
119	Ga0105241_11187794	3300009174	Bacteria	722
120	Ga0105242_10022281	3300009176	Bacteria	4980
121	Ga0105248_10009312	3300009177	Bacteria	10814
122	Ga0105248_10221962	3300009177	Bacteria	2128
123	Ga0105248_10770820	3300009177	Bacteria	1085
124	Ga0105249_10065014	3300009553	Bacteria	3354
125	Ga0105028_101940	3300009993	Bacteria	2172
126	Ga0105028_119405	3300009993	Bacteria	734
127	Ga0105246_10061918	3300011119	Bacteria	2605
128	Ga0157347_1027717	3300012502	Bacteria	696
129	Ga0157373_10017956	3300013100	Bacteria	5151
130	Ga0157371_10084494	3300013102	Bacteria	2248
131	Ga0157370_10664135	3300013104	Bacteria	952
132	Ga0157369_10306510	3300013105	Bacteria	1652
133	Ga0157374_10620037	3300013296	Bacteria	1092
134	Ga0157374_11662770	3300013296	Bacteria	663
135	Ga0157378_10201299	3300013297	Bacteria	1883
136	Ga0163162_10358189	3300013306	Bacteria	1592
137	Ga0157372_12352535	3300013307	Bacteria	612
138	Ga0157375_10150345	3300013308	Bacteria	2463
139	Ga0157375_11923693	3300013308	Bacteria	702
140	Ga0163163_10010315	3300014325	Bacteria	8398
141	Ga0163163_10066678	3300014325	Bacteria	3576
142	Ga0163163_10109270	3300014325	Bacteria	2792
143	Ga0157377_10009201	3300014745	Bacteria	4838
144	Ga0157379_10318616	3300014968	Bacteria	1419
145	Ga0157379_10542187	3300014968	Bacteria	1082
146	Ga0163161_10165584	3300017792	Bacteria	1688
147	Ga0206356_10480471	3300020070	Bacteria	1121
148	Ga0207692_10135539	3300025898	Bacteria	1395
149	Ga0207642_10051983	3300025899	Bacteria	1857
150	Ga0207688_10024658	3300025901	Bacteria	3300
151	Ga0207680_10338334	3300025903	Bacteria	1055
152	Ga0207647_10129363	3300025904	Bacteria	1485
153	Ga0207699_10003744	3300025906	Bacteria	7261
154	Ga0207643_10035795	3300025908	Bacteria	2784
155	Ga0207705_10000605	3300025909	Bacteria	30085
156	Ga0207684_10103587	3300025910	Bacteria	2433
157	Ga0207654_10448107	3300025911	Bacteria	905
158	Ga0207707_10143144	3300025912	Bacteria	2090
159	Ga0207695_10326415	3300025913	Bacteria	1424
160	Ga0207671_10385581	3300025914	Bacteria	1114
161	Ga0207693_10160040	3300025915	Bacteria	1771
162	Ga0207693_11118812	3300025915	Bacteria	597
163	Ga0207663_10111712	3300025916	Bacteria	1855
164	Ga0207660_10044885	3300025917	Bacteria	3111
165	Ga0207660_10133010	3300025917	Bacteria	1895
166	Ga0207657_10010070	3300025919	Bacteria	9452
167	Ga0207649_10082144	3300025920	Bacteria	2088
168	Ga0207652_10039531	3300025921	Bacteria	4003
169	Ga0207652_10270140	3300025921	Bacteria	1534
170	Ga0207646_10005488	3300025922	Bacteria	13331
171	Ga0207659_10576074	3300025926	Bacteria	958
172	Ga0207687_10172456	3300025927	Bacteria	1670
173	Ga0207700_10026263	3300025928	Bacteria	4058
174	Ga0207700_10294716	3300025928	Bacteria	1399
175	Ga0207664_10557640	3300025929	Bacteria	1028
176	Ga0207644_10489594	3300025931	Bacteria	1013
177	Ga0207690_10150798	3300025932	Bacteria	1723
178	Ga0207686_10024158	3300025934	Bacteria	3518
179	Ga0207709_10585564	3300025935	Bacteria	882
180	Ga0207669_10031628	3300025937	Bacteria	2960
181	Ga0207665_10033867	3300025939	Bacteria	3388
182	Ga0207691_10113173	3300025940	Bacteria	2411
183	Ga0207711_10086994	3300025941	Bacteria	2741
184	Ga0207711_10167005	3300025941	Bacteria	1995
185	Ga0207711_10784150	3300025941	Bacteria	888
186	Ga0207689_10004179	3300025942	Bacteria	13124
187	Ga0207661_10298164	3300025944	Bacteria	1445
188	Ga0207661_10518060	3300025944	Bacteria	1090
189	Ga0207679_10191692	3300025945	Bacteria	1700
190	Ga0207667_10500031	3300025949	Bacteria	1233
191	Ga0207651_11016525	3300025960	Bacteria	741
192	Ga0207668_10809550	3300025972	Bacteria	830
193	Ga0207658_10121742	3300025986	Bacteria	2082
194	Ga0207677_10186332	3300026023	Bacteria	1637
195	Ga0207703_10191554	3300026035	Bacteria	1811
196	Ga0207703_10210543	3300026035	Bacteria	1733
197	Ga0207703_10857357	3300026035	Bacteria	869
198	Ga0207639_10068882	3300026041	Bacteria	2758
199	Ga0207678_10081533	3300026067	Bacteria	2769
200	Ga0207708_10833562	3300026075	Bacteria	795
201	Ga0207708_10920620	3300026075	Bacteria	757
202	Ga0207702_10091007	3300026078	Bacteria	2670
203	Ga0207641_10210812	3300026088	Bacteria	1796
204	Ga0207676_10009848	3300026095	Bacteria	6799
205	Ga0207676_10738425	3300026095	Bacteria	956
206	Ga0207674_10006720	3300026116	Bacteria	13502
207	Ga0207675_101944183	3300026118	Bacteria	606
208	Ga0207683_10007652	3300026121	Bacteria	9249
209	Ga0207698_10271620	3300026142	Bacteria	1563
210	Ga0268266_10082777	3300028379	Bacteria	2800
211	Ga0268266_10147131	3300028379	Bacteria	2119
212	Ga0268265_10410122	3300028380	Bacteria	1255
213	Ga0307517_10247246	3300028786	Bacteria	1051
214	Ga0307517_10283153	3300028786	Bacteria	943
215	Ga0307515_10031541	3300028794	Bacteria	8830
216	Ga0307515_10277205	3300028794	Bacteria	1389
217	Ga0307513_10072512	3300031456	Bacteria	3589
218	Ga0307513_10127434	3300031456	Bacteria	2498
219	Ga0307513_10222715	3300031456	Bacteria	1706
220	Ga0307509_10109948	3300031507	Bacteria	2763
221	Ga0307408_101629354	3300031548	Bacteria	613
222	Ga0307508_10005625	3300031616	Bacteria	11877
223	Ga0307508_10190061	3300031616	Bacteria	1655
224	Ga0307508_10476510	3300031616	Bacteria	842
225	Ga0307516_10003647	3300031730	Bacteria	19562
226	Ga0307516_10109006	3300031730	Bacteria	2575
227	Ga0307516_10111386	3300031730	Bacteria	2538
228	Ga0307405_10105647	3300031731	Bacteria	1897
229	Ga0307405_10219872	3300031731	Bacteria	1393
230	Ga0307413_10107365	3300031824	Bacteria	1860
231	Ga0307413_10412985	3300031824	Bacteria	1061
232	Ga0307413_11182367	3300031824	Bacteria	664
233	Ga0307410_10051279	3300031852	Bacteria	2780
234	Ga0307410_10266998	3300031852	Bacteria	1337
235	Ga0326468_10000272	3300031889	Bacteria	5468
236	Ga0307406_10010747	3300031901	Bacteria	5173
237	Ga0307406_10103107	3300031901	Bacteria	1948
238	Ga0307406_10388967	3300031901	Bacteria	1102
239	Ga0307406_11150810	3300031901	Bacteria	672
240	Ga0307407_10250565	3300031903	Bacteria	1213
241	Ga0307407_10740451	3300031903	Bacteria	743
242	Ga0307409_100042089	3300031995	Bacteria	3418
243	Ga0307409_100161456	3300031995	Bacteria	1960
244	Ga0307409_101691970	3300031995	Bacteria	661
245	Ga0307416_100007273	3300032002	Bacteria	7020
246	Ga0307416_100113051	3300032002	Bacteria	2398
247	Ga0307411_10280862	3300032005	Bacteria	1325
248	Ga0307415_100022961	3300032126	Bacteria	3862
249	Ga0307415_100082490	3300032126	Bacteria	2300
250	Ga0307415_100307351	3300032126	Bacteria	1316
251	Ga0307415_101075048	3300032126	Bacteria	752
252	Ga0307510_10145762	3300033180	Bacteria	2000
253	Ga0373930_0015350	3300034816	Bacteria	1437
254	Ga0373948_0017949	3300034817	Bacteria	1324
255	Ga0373959_0004765	3300034820	Bacteria	2203
256	Ga0373928_0060432	3300035084	Bacteria	915
257	Ga0373929_0007369	3300035085	Bacteria	2007
258	Ga0373940_0053511	3300035088	Bacteria	1139
259	Ga0373949_0068723	3300035090	Bacteria	924
260	Ga0373951_0000026	3300035091	Bacteria	60332
261	Ga0373951_0079715	3300035091	Bacteria	846
262	Ga0373932_0273704	3300035112	Bacteria	622
263	Ga0373939_0250148	3300035114	Bacteria	689
264	Ga0373953_0015168	3300035117	Bacteria	2786
265	Ga0373954_0145387	3300035118	Bacteria	1157
266	Ga0373956_0140935	3300035119	Bacteria	1132
267	Ga0373960_0047575	3300035121	Bacteria	1262
268	Ga0373955_0297958	3300035172	Bacteria	972
269	Ga0373942_0085833	3300035207	Bacteria	941
270	Ga0373961_0029515	3300035241	Bacteria	1520
271	Ga0373962_0030154	3300035242	Bacteria	1482
272	Ga0373931_0073545	3300035691	Bacteria	1870
273	Ga0373937_0167564	3300036401	Bacteria	2060
274	Ga0373925_0360337	3300037068	Bacteria	1182
275	Ga0395899_0010366	3300037312	Bacteria	7142
276	Ga0395899_0166258	3300037312	Bacteria	1556
277	Ga0395900_0011237	3300037418	Bacteria	9158
278	Ga0395898_0003376	3300037466	Bacteria	17886
279	Ga0395905_0030199	3300037471	Bacteria	5108
280	Ga0395901_0028014	3300038443	Bacteria	5794
281	Ga0395901_0077160	3300038443	Bacteria	3477
282	Ga0395901_1702782	3300038443	Bacteria	582
283	Ga0451853_1043740	3300041512	Bacteria	3125
284	Ga0466966_0663190	3300044684	Bacteria	628
285	Ga0466961_0064424	3300044693	Bacteria	2329
286	Ga0466961_0875241	3300044693	Bacteria	535
287	Ga0466963_0028863	3300044694	Bacteria	3566
288	Ga0466963_0175868	3300044694	Bacteria	1493
289	Ga0466971_0133779	3300044719	Bacteria	1152
290	Ga0466957_0039035	3300044842	Bacteria	2863
291	Ga0466957_0178649	3300044842	Bacteria	1385
292	Ga0466960_0507733	3300044901	Bacteria	707
293	Ga0466958_0021353	3300045836	Bacteria	3782
294	Ga0466967_0306331	3300045976	Bacteria	1529
295	Ga0466967_0877703	3300045976	Bacteria	892
296	Ga0495629_0080408	3300046459	Bacteria	2276
297	Ga0495629_0193240	3300046459	Bacteria	1408
298	Ga0495638_0213696	3300046460	Bacteria	1082
299	Ga0495641_0149347	3300046461	Bacteria	1044
300	Ga0495639_0094380	3300046475	Bacteria	1407
301	Ga0495606_0001145	3300046507	Bacteria	37635
302	Ga0495608_0437656	3300046511	Bacteria	797
303	Ga0495630_0298136	3300046517	Bacteria	1232
304	Ga0495632_0120963	3300046519	Bacteria	1223
305	Ga0495640_0566647	3300046533	Bacteria	688
306	Ga0495667_0479032	3300046559	Bacteria	780
307	Ga0495668_0001706	3300046616	Bacteria	20297
308	Ga0495625_0000792	3300046660	Bacteria	43853
309	Ga0495658_0076421	3300046683	Bacteria	1957
310	Ga0495581_0260924	3300047315	Bacteria	1013
311	Ga0495636_0235116	3300047318	Bacteria	844
312	Ga0495636_0467790	3300047318	Bacteria	607
313	Ga0495676_0264434	3300047321	Bacteria	1169
314	Ga0495683_0104289	3300047323	Bacteria	1360
315	Ga0495593_0123806	3300047673	Bacteria	1315
316	Ga0495626_0030028	3300048091	Bacteria	2623
317	Ga0496100_0281163	3300048903	Bacteria	1240
318	Ga0496101_0051909	3300048904	Bacteria	2955
319	Ga0496103_0015619	3300048906	Bacteria	4523
320	Ga0496104_0009833	3300048907	Bacteria	8531
321	Ga0496104_0038580	3300048907	Bacteria	4471
322	Ga0496104_0128297	3300048907	Bacteria	2435
323	Ga0496105_0006568	3300048908	Bacteria	8949
324	Ga0496105_0022950	3300048908	Bacteria	5059
325	Ga0496107_0088501	3300048910	Bacteria	2260
326	Ga0496108_0146442	3300048911	Bacteria	2036
327	Ga0496109_0004875	3300048912	Bacteria	11205
328	Ga0496109_0449926	3300048912	Bacteria	1216
329	Ga0496110_0023879	3300048913	Bacteria	5205
330	Ga0496110_0053536	3300048913	Bacteria	3548
331	Ga0496111_0051654	3300048914	Bacteria	2967
332	Ga0496111_0418041	3300048914	Bacteria	990
333	Ga0496112_0128355	3300048915	Bacteria	2506
334	Ga0496112_0450655	3300048915	Bacteria	1224
335	Ga0496112_0663385	3300048915	Bacteria	972
336	Ga0496112_1434598	3300048915	Bacteria	605
337	Ga0496113_0006425	3300048916	Bacteria	7448
338	Ga0496115_0059669	3300048918	Bacteria	3072
339	Ga0496126_0227441	3300048929	Bacteria	1564
340	Ga0501034_0931588	3300049571	Bacteria	755
341	Ga0501034_1350748	3300049571	Bacteria	588
342	Ga0501042_0019824	3300049578	Bacteria	4675
343	Ga0501081_0189019	3300049743	Bacteria	1491
344	nmdc:mga05p37_21141_c1	3300050507	Bacteria	7878
345	nmdc:mga05p37_680153_c1	3300050507	Bacteria	1147
346	nmdc:mga05p37_988_c1	3300050507	Bacteria	32390
347	nmdc:mga09592_11_c2	3300050508	Bacteria	31986
348	nmdc:mga09592_280453_c1	3300050508	Bacteria	1445
349	nmdc:mga09592_949473_c1	3300050508	Bacteria	721
350	nmdc:mga0qj67_1095322_c1	3300050509	Bacteria	622
351	nmdc:mga0qj67_330120_c1	3300050509	Bacteria	1234
352	nmdc:mga0qj67_95_c1	3300050509	Bacteria	59712
353	nmdc:mga06r32_112228_c1	3300050510	Bacteria	2682
354	nmdc:mga06r32_5_c1	3300050510	Bacteria	79813
355	nmdc:mga06r32_9621_c1	3300050510	Bacteria	8732
356	nmdc:mga0rr50_470583_c1	3300050513	Bacteria	1067
357	nmdc:mga08x19_178282_c1	3300050514	Bacteria	1450
358	nmdc:mga0a205_433111_c1	3300050515	Bacteria	1176
359	Ga0495619_0021122	3300053085	Bacteria	4154
360	Ga0500646_0002206	3300053090	Bacteria	5084
361	Ga0500651_0062607	3300053093	Bacteria	2323
362	Ga0500579_234694	3300053143	Bacteria	618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005327	Ga0070658_10126155	Ga0070658_101261553	149
2	3300005985	Ga0081539_10017612	Ga0081539_100176123	150
3	3300037312	Ga0395899_0166258	Ga0395899_0166258_254_757	150
4	3300038443	Ga0395901_0028014	Ga0395901_0028014_1302_1805	150
5	3300005458	Ga0070681_10238803	Ga0070681_102388032	151
6	3300044684	Ga0466966_0663190	Ga0466966_0663190_14_475	151
7	3300044693	Ga0466961_0064424	Ga0466961_0064424_633_1094	151
8	3300050509	nmdc:mga0qj67_1095322_c1	nmdc:mga0qj67_1095322_c1_18_476	151
9	3300003320	rootH2_10016519	rootH2_100165193	152
10	3300005327	Ga0070658_10000726	Ga0070658_100007268	152
11	3300005329	Ga0070683_100167949	Ga0070683_1001679491	152
12	3300005336	Ga0070680_100037767	Ga0070680_1000377675	152
13	3300005456	Ga0070678_100156150	Ga0070678_1001561502	152
14	3300005530	Ga0070679_100389310	Ga0070679_1003893101	152
15	3300006844	Ga0075428_101268097	Ga0075428_1012680972	152
16	3300006846	Ga0075430_100614182	Ga0075430_1006141822	152
17	3300006847	Ga0075431_100015806	Ga0075431_1000158064	152
18	3300009174	Ga0105241_10128842	Ga0105241_101288422	152
19	3300009993	Ga0105028_101940	Ga0105028_1019404	152
20	3300009993	Ga0105028_119405	Ga0105028_1194052	152
21	3300013296	Ga0157374_11662770	Ga0157374_116627702	152
22	3300020070	Ga0206356_10480471	Ga0206356_104804711	152
23	3300025909	Ga0207705_10000605	Ga0207705_100006057	152
24	3300025917	Ga0207660_10044885	Ga0207660_100448852	152
25	3300025921	Ga0207652_10270140	Ga0207652_102701402	152
26	3300025928	Ga0207700_10294716	Ga0207700_102947162	152
27	3300035091	Ga0373951_0000026	Ga0373951_0000026_22464_22925	152
28	3300038443	Ga0395901_1702782	Ga0395901_1702782_42_512	152
29	3300041512	Ga0451853_1043740	Ga0451853_1043740_1958_2479	152
30	3300044693	Ga0466961_0875241	Ga0466961_0875241_56_520	152
31	3300044901	Ga0466960_0507733	Ga0466960_0507733_20_484	152
32	3300046459	Ga0495629_0080408	Ga0495629_0080408_308_781	152
33	3300046459	Ga0495629_0193240	Ga0495629_0193240_250_711	152
34	3300046461	Ga0495641_0149347	Ga0495641_0149347_527_991	152
35	3300046475	Ga0495639_0094380	Ga0495639_0094380_130_603	152
36	3300046517	Ga0495630_0298136	Ga0495630_0298136_350_811	152
37	3300046533	Ga0495640_0566647	Ga0495640_0566647_38_499	152
38	3300046683	Ga0495658_0076421	Ga0495658_0076421_953_1417	152
39	3300047315	Ga0495581_0260924	Ga0495581_0260924_115_576	152
40	3300047321	Ga0495676_0264434	Ga0495676_0264434_337_801	152
41	3300047673	Ga0495593_0123806	Ga0495593_0123806_735_1196	152
42	3300048915	Ga0496112_1434598	Ga0496112_1434598_86_547	152
43	3300050509	nmdc:mga0qj67_330120_c1	nmdc:mga0qj67_330120_c1_338_796	152
44	3300050510	nmdc:mga06r32_9621_c1	nmdc:mga06r32_9621_c1_4555_5016	152
45	iso_pu_bacteria	2856858025	2856860730	152
46	iso_pu_bacteria	2857288857	2857292092	152
47	iso_pu_bacteria	2858848962	2858850881	152
48	iso_pu_bacteria	2858868258	2858869643	152
49	iso_pu_bacteria	2858882152	2858883751	152
50	iso_pu_bacteria	2858888857	2858894163	152
51	iso_pu_bacteria	2858895516	2858901033	152
52	iso_pu_bacteria	2867302475	2867306517	152
53	iso_pu_bacteria	2867312974	2867312999	152
54	iso_pu_bacteria	2867319477	2867325024	152
55	iso_pu_bacteria	2869048445	2869049845	152
56	iso_pu_bacteria	2869061728	2869062451	152
57	iso_pu_bacteria	2869068681	2869070822	152
58	iso_pu_bacteria	2880489317	2880493385	152
59	iso_pu_bacteria	2880495981	2880498915	152
60	iso_pu_bacteria	2887478801	2887484162	152
61	iso_pu_bacteria	2902582711	2902586521	152
62	iso_pu_bacteria	2929219909	2929220924	152
63	iso_pu_bacteria	2929226422	2929227506	152
64	iso_pu_bacteria	8001781756	8001785753	152
65	iso_pu_bacteria	8003830390	8003831278	152
66	iso_pu_bacteria	8054704163	8054710844	152
67	iso_pu_bacteria	8054734606	8054734947	152
68	3300006048	Ga0075363_100231014	Ga0075363_1002310142	153
69	3300009147	Ga0114129_10060028	Ga0114129_100600282	153
70	3300026035	Ga0207703_10210543	Ga0207703_102105432	153
71	3300031548	Ga0307408_101629354	Ga0307408_1016293541	153
72	3300031731	Ga0307405_10105647	Ga0307405_101056474	153
73	3300031731	Ga0307405_10219872	Ga0307405_102198722	153
74	3300031824	Ga0307413_10412985	Ga0307413_104129852	153
75	3300031824	Ga0307413_11182367	Ga0307413_111823672	153
76	3300031852	Ga0307410_10266998	Ga0307410_102669981	153
77	3300031901	Ga0307406_10388967	Ga0307406_103889671	153
78	3300031901	Ga0307406_11150810	Ga0307406_111508102	153
79	3300031903	Ga0307407_10740451	Ga0307407_107404511	153
80	3300031995	Ga0307409_100042089	Ga0307409_1000420895	153
81	3300031995	Ga0307409_100161456	Ga0307409_1001614562	153
82	3300032002	Ga0307416_100007273	Ga0307416_1000072732	153
83	3300032005	Ga0307411_10280862	Ga0307411_102808623	153
84	3300032126	Ga0307415_100022961	Ga0307415_1000229612	153
85	3300032126	Ga0307415_100082490	Ga0307415_1000824904	153
86	3300032126	Ga0307415_100307351	Ga0307415_1003073512	153
87	3300037312	Ga0395899_0010366	Ga0395899_0010366_915_1379	153
88	3300037418	Ga0395900_0011237	Ga0395900_0011237_5977_6441	153
89	3300037466	Ga0395898_0003376	Ga0395898_0003376_16688_17152	153
90	3300037471	Ga0395905_0030199	Ga0395905_0030199_2027_2491	153
91	3300038443	Ga0395901_0077160	Ga0395901_0077160_1360_1824	153
92	3300047318	Ga0495636_0467790	Ga0495636_0467790_122_595	153
93	3300050507	nmdc:mga05p37_21141_c1	nmdc:mga05p37_21141_c1_6972_7436	153
94	3300050508	nmdc:mga09592_949473_c1	nmdc:mga09592_949473_c1_97_561	153
95	3300050510	nmdc:mga06r32_112228_c1	nmdc:mga06r32_112228_c1_498_962	153
96	3300005435	Ga0070714_100413574	Ga0070714_1004135741	154
97	3300005843	Ga0068860_101177029	Ga0068860_1011770292	154
98	3300005985	Ga0081539_10000143	Ga0081539_10000143157	154
99	3300025929	Ga0207664_10557640	Ga0207664_105576401	154
100	3300031456	Ga0307513_10127434	Ga0307513_101274343	154
101	3300031456	Ga0307513_10222715	Ga0307513_102227152	154
102	3300031730	Ga0307516_10111386	Ga0307516_101113862	154
103	3300031889	Ga0326468_10000272	Ga0326468_100002726	154
104	3300031901	Ga0307406_10103107	Ga0307406_101031073	154
105	3300037068	Ga0373925_0360337	Ga0373925_0360337_580_1077	154
106	3300045976	Ga0466967_0877703	Ga0466967_0877703_181_672	154
107	3300005327	Ga0070658_10480948	Ga0070658_104809481	155
108	3300005328	Ga0070676_10054343	Ga0070676_100543432	155
109	3300005329	Ga0070683_100036419	Ga0070683_1000364194	155
110	3300005330	Ga0070690_100060100	Ga0070690_1000601002	155
111	3300005335	Ga0070666_10096256	Ga0070666_100962561	155
112	3300005336	Ga0070680_100163778	Ga0070680_1001637783	155
113	3300005337	Ga0070682_100062246	Ga0070682_1000622462	155
114	3300005337	Ga0070682_100362487	Ga0070682_1003624872	155
115	3300005338	Ga0068868_100048749	Ga0068868_1000487495	155
116	3300005339	Ga0070660_100015918	Ga0070660_1000159184	155
117	3300005340	Ga0070689_100307581	Ga0070689_1003075812	155
118	3300005341	Ga0070691_10037767	Ga0070691_100377672	155
119	3300005343	Ga0070687_100023576	Ga0070687_1000235763	155
120	3300005344	Ga0070661_100114083	Ga0070661_1001140831	155
121	3300005345	Ga0070692_10683995	Ga0070692_106839951	155
122	3300005354	Ga0070675_100031747	Ga0070675_1000317473	155
123	3300005355	Ga0070671_100027571	Ga0070671_1000275715	155
124	3300005356	Ga0070674_100209468	Ga0070674_1002094682	155
125	3300005364	Ga0070673_100102630	Ga0070673_1001026303	155
126	3300005366	Ga0070659_100154482	Ga0070659_1001544822	155
127	3300005367	Ga0070667_100437110	Ga0070667_1004371101	155
128	3300005437	Ga0070710_10342456	Ga0070710_103424562	155
129	3300005437	Ga0070710_10476263	Ga0070710_104762631	155
130	3300005438	Ga0070701_10021312	Ga0070701_100213123	155
131	3300005440	Ga0070705_100335693	Ga0070705_1003356932	155
132	3300005441	Ga0070700_100151291	Ga0070700_1001512912	155
133	3300005444	Ga0070694_100950006	Ga0070694_1009500062	155
134	3300005445	Ga0070708_100063323	Ga0070708_1000633236	155
135	3300005445	Ga0070708_100296530	Ga0070708_1002965301	155
136	3300005455	Ga0070663_100044935	Ga0070663_1000449353	155
137	3300005457	Ga0070662_100157388	Ga0070662_1001573882	155
138	3300005466	Ga0070685_10177055	Ga0070685_101770552	155
139	3300005467	Ga0070706_100071045	Ga0070706_1000710454	155
140	3300005468	Ga0070707_100034423	Ga0070707_1000344236	155
141	3300005471	Ga0070698_100429770	Ga0070698_1004297704	155
142	3300005518	Ga0070699_100000885	Ga0070699_10000088512	155
143	3300005530	Ga0070679_100027291	Ga0070679_1000272915	155
144	3300005535	Ga0070684_100112604	Ga0070684_1001126044	155
145	3300005536	Ga0070697_100001238	Ga0070697_1000012387	155
146	3300005539	Ga0068853_100076407	Ga0068853_1000764072	155
147	3300005539	Ga0068853_100994670	Ga0068853_1009946702	155
148	3300005543	Ga0070672_100187868	Ga0070672_1001878681	155
149	3300005546	Ga0070696_100041514	Ga0070696_1000415142	155
150	3300005547	Ga0070693_100280045	Ga0070693_1002800452	155
151	3300005548	Ga0070665_100145344	Ga0070665_1001453442	155
152	3300005549	Ga0070704_100084006	Ga0070704_1000840061	155
153	3300005563	Ga0068855_100104482	Ga0068855_1001044822	155
154	3300005563	Ga0068855_100583550	Ga0068855_1005835502	155
155	3300005564	Ga0070664_100047974	Ga0070664_1000479744	155
156	3300005577	Ga0068857_100077294	Ga0068857_1000772943	155
157	3300005577	Ga0068857_100170742	Ga0068857_1001707422	155
158	3300005578	Ga0068854_100020345	Ga0068854_1000203454	155
159	3300005614	Ga0068856_100216441	Ga0068856_1002164412	155
160	3300005615	Ga0070702_100033244	Ga0070702_1000332442	155
161	3300005616	Ga0068852_100266662	Ga0068852_1002666622	155
162	3300005617	Ga0068859_100351677	Ga0068859_1003516772	155
163	3300005618	Ga0068864_100015888	Ga0068864_1000158884	155
164	3300005618	Ga0068864_100219849	Ga0068864_1002198492	155
165	3300005718	Ga0068866_10125809	Ga0068866_101258092	155
166	3300005840	Ga0068870_10020790	Ga0068870_100207904	155
167	3300005841	Ga0068863_100117323	Ga0068863_1001173232	155
168	3300005843	Ga0068860_100377297	Ga0068860_1003772971	155
169	3300005983	Ga0081540_1014581	Ga0081540_10145812	155
170	3300006163	Ga0070715_10021885	Ga0070715_100218852	155
171	3300006173	Ga0070716_101005606	Ga0070716_1010056061	155
172	3300006175	Ga0070712_100060748	Ga0070712_1000607482	155
173	3300006175	Ga0070712_101300609	Ga0070712_1013006091	155
174	3300006237	Ga0097621_100114646	Ga0097621_1001146462	155
175	3300006358	Ga0068871_100219568	Ga0068871_1002195682	155
176	3300006844	Ga0075428_101161888	Ga0075428_1011618882	155
177	3300006852	Ga0075433_10435640	Ga0075433_104356402	155
178	3300006871	Ga0075434_100845839	Ga0075434_1008458392	155
179	3300006880	Ga0075429_100283010	Ga0075429_1002830101	155
180	3300006881	Ga0068865_100131343	Ga0068865_1001313432	155
181	3300006931	Ga0097620_100351693	Ga0097620_1003516932	155
182	3300007076	Ga0075435_100230522	Ga0075435_1002305222	155
183	3300009011	Ga0105251_10165779	Ga0105251_101657792	155
184	3300009036	Ga0105244_10160207	Ga0105244_101602072	155
185	3300009092	Ga0105250_10125997	Ga0105250_101259972	155
186	3300009098	Ga0105245_10561659	Ga0105245_105616592	155
187	3300009101	Ga0105247_10055788	Ga0105247_100557882	155
188	3300009147	Ga0114129_10746117	Ga0114129_107461173	155
189	3300009147	Ga0114129_11326907	Ga0114129_113269072	155
190	3300009148	Ga0105243_10112157	Ga0105243_101121571	155
191	3300009174	Ga0105241_11187794	Ga0105241_111877941	155
192	3300009176	Ga0105242_10022281	Ga0105242_100222815	155
193	3300009177	Ga0105248_10009312	Ga0105248_100093126	155
194	3300009177	Ga0105248_10221962	Ga0105248_102219622	155
195	3300009177	Ga0105248_10770820	Ga0105248_107708202	155
196	3300009553	Ga0105249_10065014	Ga0105249_100650141	155
197	3300011119	Ga0105246_10061918	Ga0105246_100619183	155
198	3300012502	Ga0157347_1027717	Ga0157347_10277171	155
199	3300013100	Ga0157373_10017956	Ga0157373_100179563	155
200	3300013102	Ga0157371_10084494	Ga0157371_100844941	155
201	3300013104	Ga0157370_10664135	Ga0157370_106641351	155
202	3300013105	Ga0157369_10306510	Ga0157369_103065102	155
203	3300013296	Ga0157374_10620037	Ga0157374_106200371	155
204	3300013297	Ga0157378_10201299	Ga0157378_102012991	155
205	3300013306	Ga0163162_10358189	Ga0163162_103581892	155
206	3300013307	Ga0157372_12352535	Ga0157372_123525351	155
207	3300013308	Ga0157375_10150345	Ga0157375_101503454	155
208	3300014325	Ga0163163_10010315	Ga0163163_100103155	155
209	3300014325	Ga0163163_10066678	Ga0163163_100666784	155
210	3300014325	Ga0163163_10109270	Ga0163163_101092702	155
211	3300014745	Ga0157377_10009201	Ga0157377_100092014	155
212	3300014968	Ga0157379_10318616	Ga0157379_103186161	155
213	3300014968	Ga0157379_10542187	Ga0157379_105421872	155
214	3300017792	Ga0163161_10165584	Ga0163161_101655841	155
215	3300025898	Ga0207692_10135539	Ga0207692_101355392	155
216	3300025899	Ga0207642_10051983	Ga0207642_100519832	155
217	3300025901	Ga0207688_10024658	Ga0207688_100246585	155
218	3300025903	Ga0207680_10338334	Ga0207680_103383341	155
219	3300025904	Ga0207647_10129363	Ga0207647_101293631	155
220	3300025906	Ga0207699_10003744	Ga0207699_100037446	155
221	3300025908	Ga0207643_10035795	Ga0207643_100357953	155
222	3300025910	Ga0207684_10103587	Ga0207684_101035872	155
223	3300025911	Ga0207654_10448107	Ga0207654_104481071	155
224	3300025912	Ga0207707_10143144	Ga0207707_101431442	155
225	3300025913	Ga0207695_10326415	Ga0207695_103264152	155
226	3300025914	Ga0207671_10385581	Ga0207671_103855812	155
227	3300025915	Ga0207693_10160040	Ga0207693_101600402	155
228	3300025915	Ga0207693_11118812	Ga0207693_111188121	155
229	3300025916	Ga0207663_10111712	Ga0207663_101117121	155
230	3300025917	Ga0207660_10133010	Ga0207660_101330102	155
231	3300025919	Ga0207657_10010070	Ga0207657_100100705	155
232	3300025920	Ga0207649_10082144	Ga0207649_100821441	155
233	3300025921	Ga0207652_10039531	Ga0207652_100395313	155
234	3300025922	Ga0207646_10005488	Ga0207646_1000548810	155
235	3300025926	Ga0207659_10576074	Ga0207659_105760741	155
236	3300025927	Ga0207687_10172456	Ga0207687_101724562	155
237	3300025928	Ga0207700_10026263	Ga0207700_100262632	155
238	3300025931	Ga0207644_10489594	Ga0207644_104895941	155
239	3300025932	Ga0207690_10150798	Ga0207690_101507983	155
240	3300025934	Ga0207686_10024158	Ga0207686_100241584	155
241	3300025935	Ga0207709_10585564	Ga0207709_105855641	155
242	3300025937	Ga0207669_10031628	Ga0207669_100316283	155
243	3300025939	Ga0207665_10033867	Ga0207665_100338671	155
244	3300025940	Ga0207691_10113173	Ga0207691_101131732	155
245	3300025941	Ga0207711_10086994	Ga0207711_100869942	155
246	3300025941	Ga0207711_10167005	Ga0207711_101670052	155
247	3300025941	Ga0207711_10784150	Ga0207711_107841502	155
248	3300025942	Ga0207689_10004179	Ga0207689_100041799	155
249	3300025944	Ga0207661_10518060	Ga0207661_105180602	155
250	3300025945	Ga0207679_10191692	Ga0207679_101916921	155
251	3300025949	Ga0207667_10500031	Ga0207667_105000312	155
252	3300025960	Ga0207651_11016525	Ga0207651_110165251	155
253	3300025986	Ga0207658_10121742	Ga0207658_101217422	155
254	3300026023	Ga0207677_10186332	Ga0207677_101863321	155
255	3300026035	Ga0207703_10191554	Ga0207703_101915542	155
256	3300026041	Ga0207639_10068882	Ga0207639_100688821	155
257	3300026067	Ga0207678_10081533	Ga0207678_100815332	155
258	3300026075	Ga0207708_10833562	Ga0207708_108335621	155
259	3300026078	Ga0207702_10091007	Ga0207702_100910072	155
260	3300026088	Ga0207641_10210812	Ga0207641_102108122	155
261	3300026095	Ga0207676_10009848	Ga0207676_100098484	155
262	3300026095	Ga0207676_10738425	Ga0207676_107384251	155
263	3300026116	Ga0207674_10006720	Ga0207674_100067203	155
264	3300026121	Ga0207683_10007652	Ga0207683_100076523	155
265	3300026142	Ga0207698_10271620	Ga0207698_102716202	155
266	3300028379	Ga0268266_10082777	Ga0268266_100827771	155
267	3300028379	Ga0268266_10147131	Ga0268266_101471312	155
268	3300028380	Ga0268265_10410122	Ga0268265_104101222	155
269	3300028786	Ga0307517_10283153	Ga0307517_102831532	155
270	3300028794	Ga0307515_10031541	Ga0307515_100315416	155
271	3300031456	Ga0307513_10072512	Ga0307513_100725124	155
272	3300031616	Ga0307508_10005625	Ga0307508_100056259	155
273	3300031616	Ga0307508_10190061	Ga0307508_101900612	155
274	3300031730	Ga0307516_10109006	Ga0307516_101090065	155
275	3300033180	Ga0307510_10145762	Ga0307510_101457623	155
276	3300034816	Ga0373930_0015350	Ga0373930_0015350_155_625	155
277	3300034817	Ga0373948_0017949	Ga0373948_0017949_791_1261	155
278	3300034820	Ga0373959_0004765	Ga0373959_0004765_1680_2150	155
279	3300035084	Ga0373928_0060432	Ga0373928_0060432_215_685	155
280	3300035085	Ga0373929_0007369	Ga0373929_0007369_591_1061	155
281	3300035088	Ga0373940_0053511	Ga0373940_0053511_410_880	155
282	3300035090	Ga0373949_0068723	Ga0373949_0068723_239_709	155
283	3300035091	Ga0373951_0079715	Ga0373951_0079715_315_785	155
284	3300035112	Ga0373932_0273704	Ga0373932_0273704_118_588	155
285	3300035114	Ga0373939_0250148	Ga0373939_0250148_88_558	155
286	3300035121	Ga0373960_0047575	Ga0373960_0047575_155_625	155
287	3300035207	Ga0373942_0085833	Ga0373942_0085833_410_880	155
288	3300035241	Ga0373961_0029515	Ga0373961_0029515_869_1339	155
289	3300035242	Ga0373962_0030154	Ga0373962_0030154_17_487	155
290	3300035691	Ga0373931_0073545	Ga0373931_0073545_1016_1486	155
291	3300046460	Ga0495638_0213696	Ga0495638_0213696_20_490	155
292	3300046507	Ga0495606_0001145	Ga0495606_0001145_1574_2044	155
293	3300046519	Ga0495632_0120963	Ga0495632_0120963_458_928	155
294	3300046616	Ga0495668_0001706	Ga0495668_0001706_18231_18701	155
295	3300046660	Ga0495625_0000792	Ga0495625_0000792_26870_27340	155
296	3300047323	Ga0495683_0104289	Ga0495683_0104289_775_1245	155
297	3300048091	Ga0495626_0030028	Ga0495626_0030028_475_945	155
298	3300048903	Ga0496100_0281163	Ga0496100_0281163_348_818	155
299	3300048904	Ga0496101_0051909	Ga0496101_0051909_945_1415	155
300	3300048906	Ga0496103_0015619	Ga0496103_0015619_2357_2827	155
301	3300048907	Ga0496104_0009833	Ga0496104_0009833_7036_7518	155
302	3300048907	Ga0496104_0038580	Ga0496104_0038580_3410_3892	155
303	3300048907	Ga0496104_0128297	Ga0496104_0128297_282_752	155
304	3300048908	Ga0496105_0006568	Ga0496105_0006568_6588_7070	155
305	3300048908	Ga0496105_0022950	Ga0496105_0022950_1954_2424	155
306	3300048910	Ga0496107_0088501	Ga0496107_0088501_164_634	155
307	3300048911	Ga0496108_0146442	Ga0496108_0146442_215_697	155
308	3300048912	Ga0496109_0004875	Ga0496109_0004875_5813_6295	155
309	3300048912	Ga0496109_0449926	Ga0496109_0449926_646_1116	155
310	3300048913	Ga0496110_0023879	Ga0496110_0023879_893_1375	155
311	3300048913	Ga0496110_0053536	Ga0496110_0053536_533_1003	155
312	3300048914	Ga0496111_0051654	Ga0496111_0051654_2170_2640	155
313	3300048914	Ga0496111_0418041	Ga0496111_0418041_177_659	155
314	3300048915	Ga0496112_0128355	Ga0496112_0128355_753_1235	155
315	3300048915	Ga0496112_0450655	Ga0496112_0450655_258_728	155
316	3300048916	Ga0496113_0006425	Ga0496113_0006425_1745_2227	155
317	3300048918	Ga0496115_0059669	Ga0496115_0059669_1499_1969	155
318	3300048929	Ga0496126_0227441	Ga0496126_0227441_93_563	155
319	3300049571	Ga0501034_0931588	Ga0501034_0931588_14_493	155
320	3300049743	Ga0501081_0189019	Ga0501081_0189019_516_986	155
321	3300050507	nmdc:mga05p37_680153_c1	nmdc:mga05p37_680153_c1_386_856	155
322	3300050508	nmdc:mga09592_280453_c1	nmdc:mga09592_280453_c1_288_758	155
323	3300050513	nmdc:mga0rr50_470583_c1	nmdc:mga0rr50_470583_c1_270_740	155
324	3300050514	nmdc:mga08x19_178282_c1	nmdc:mga08x19_178282_c1_370_840	155
325	3300050515	nmdc:mga0a205_433111_c1	nmdc:mga0a205_433111_c1_610_1080	155
326	3300053090	Ga0500646_0002206	Ga0500646_0002206_3777_4247	155
327	3300053093	Ga0500651_0062607	Ga0500651_0062607_1731_2201	155
328	3300053143	Ga0500579_234694	Ga0500579_234694_115_588	155
329	3300005328	Ga0070676_10974660	Ga0070676_109746601	156
330	3300005334	Ga0068869_100088826	Ga0068869_1000888264	156
331	3300005535	Ga0070684_100633563	Ga0070684_1006335632	156
332	3300005618	Ga0068864_101086847	Ga0068864_1010868472	156
333	3300005985	Ga0081539_10001937	Ga0081539_1000193723	156
334	3300006173	Ga0070716_100130793	Ga0070716_1001307932	156
335	3300006175	Ga0070712_101378064	Ga0070712_1013780641	156
336	3300006178	Ga0075367_10534823	Ga0075367_105348232	156
337	3300006844	Ga0075428_100001140	Ga0075428_1000011403	156
338	3300006844	Ga0075428_100128866	Ga0075428_1001288662	156
339	3300006846	Ga0075430_100016929	Ga0075430_1000169293	156
340	3300006847	Ga0075431_100024291	Ga0075431_1000242913	156
341	3300006880	Ga0075429_100013638	Ga0075429_1000136384	156
342	3300009147	Ga0114129_10000031	Ga0114129_1000003182	156
343	3300013308	Ga0157375_11923693	Ga0157375_119236932	156
344	3300025944	Ga0207661_10298164	Ga0207661_102981641	156
345	3300025972	Ga0207668_10809550	Ga0207668_108095501	156
346	3300026035	Ga0207703_10857357	Ga0207703_108573572	156
347	3300026075	Ga0207708_10920620	Ga0207708_109206201	156
348	3300026118	Ga0207675_101944183	Ga0207675_1019441832	156
349	3300028786	Ga0307517_10247246	Ga0307517_102472461	156
350	3300028794	Ga0307515_10277205	Ga0307515_102772052	156
351	3300031507	Ga0307509_10109948	Ga0307509_101099481	156
352	3300031616	Ga0307508_10476510	Ga0307508_104765102	156
353	3300031730	Ga0307516_10003647	Ga0307516_1000364720	156
354	3300031824	Ga0307413_10107365	Ga0307413_101073653	156
355	3300031852	Ga0307410_10051279	Ga0307410_100512792	156
356	3300031901	Ga0307406_10010747	Ga0307406_100107474	156
357	3300031903	Ga0307407_10250565	Ga0307407_102505652	156
358	3300031995	Ga0307409_101691970	Ga0307409_1016919701	156
359	3300032002	Ga0307416_100113051	Ga0307416_1001130512	156
360	3300032126	Ga0307415_101075048	Ga0307415_1010750481	156
361	3300035117	Ga0373953_0015168	Ga0373953_0015168_1461_1943	156
362	3300035118	Ga0373954_0145387	Ga0373954_0145387_216_698	156
363	3300035119	Ga0373956_0140935	Ga0373956_0140935_289_771	156
364	3300035172	Ga0373955_0297958	Ga0373955_0297958_333_815	156
365	3300036401	Ga0373937_0167564	Ga0373937_0167564_854_1327	156
366	3300044694	Ga0466963_0028863	Ga0466963_0028863_402_902	156
367	3300044694	Ga0466963_0175868	Ga0466963_0175868_243_743	156
368	3300044719	Ga0466971_0133779	Ga0466971_0133779_356_856	156
369	3300044842	Ga0466957_0039035	Ga0466957_0039035_992_1492	156
370	3300044842	Ga0466957_0178649	Ga0466957_0178649_57_557	156
371	3300045836	Ga0466958_0021353	Ga0466958_0021353_2436_2936	156
372	3300046511	Ga0495608_0437656	Ga0495608_0437656_42_524	156
373	3300046559	Ga0495667_0479032	Ga0495667_0479032_239_712	156
374	3300047318	Ga0495636_0235116	Ga0495636_0235116_12_497	156
375	3300048915	Ga0496112_0663385	Ga0496112_0663385_69_554	156
376	3300049571	Ga0501034_1350748	Ga0501034_1350748_54_545	156
377	3300049578	Ga0501042_0019824	Ga0501042_0019824_3765_4247	156
378	3300050507	nmdc:mga05p37_988_c1	nmdc:mga05p37_988_c1_3433_3909	156
379	3300050508	nmdc:mga09592_11_c2	nmdc:mga09592_11_c2_3248_3724	156
380	3300050509	nmdc:mga0qj67_95_c1	nmdc:mga0qj67_95_c1_28263_28739	156
381	3300050510	nmdc:mga06r32_5_c1	nmdc:mga06r32_5_c1_22717_23193	156
382	3300053085	Ga0495619_0021122	Ga0495619_0021122_2246_2728	156
383	iso_pu_bacteria	2501939600	2501943966	157
384	iso_pu_bacteria	2622736626	2623586836	157
385	iso_pu_bacteria	649633069	649811465	157
386	3300009011	Ga0105251_10492642	Ga0105251_104926421	159
387	3300045976	Ga0466967_0306331	Ga0466967_0306331_399_911	159
388	iso_pu_bacteria	2996221748	2996222597	161
389	3300003203	JGI25406J46586_10011423	JGI25406J46586_100114232	162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

23

143

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1dbu-assembly1.cif.gz_A	crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434)	0.921	7	155
3ri0-assembly1.cif.gz_A	epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins	0.9184	8	155
1dbx-assembly2.cif.gz_B	crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434)	0.9174	7	155
3rij-assembly2.cif.gz_B	epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins	0.9143	8	155
2dxa-assembly1.cif.gz_A	crystal structure of trans editing enzyme prox from e.coli	0.9133	6	155

ID	Description	Score	Start	End	Superfamily
af_Q2G0A0_1_158_3.90.960.10	Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain	0.92	1	153	3.90.960.10
af_Q4DLP0_103_258_3.90.960.10	Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain	0.9132	29	153	3.90.960.10
1wdvB00	Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain	0.9111	8	155	3.90.960.10
1dbxB00	Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain	0.9019	7	155	3.90.960.10
3rijC00	Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain	0.9011	8	155	3.90.960.10

ID	Description	Score	Start	End	GO Terms
AF-A0A6F8Y425-F1-model_v4	YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein	0.9983	63	158	GO:0002161
AF-A0A401UX48-F1-model_v4	YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein	0.9905	8	158	GO:0002161
AF-A0A5Q4FQ93-F1-model_v4	YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein	0.9895	17	153	GO:0002161
AF-A0A4Q5T7A9-F1-model_v4	YbaK/EbsC family protein	0.9893	57	155	GO:0002161
AF-A0A7K3X8P5-F1-model_v4	YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein	0.9892	2	160	GO:0002161

Feature Viewer

pLDDT	pTM	Quality
93.69	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F431549

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

23

143

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map