F431539

General Info

Members Datasets Scaffolds Average Seq Length
389 206 778 197

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0018569|Ga0495642_0018569_675_1382
Length 221
Sequence MNDVIYETVISTVAADGTPHVAPMGVRYRGSETGSDVILMPFKPSTTLSNILANRHAVLNIVADTRVFAGAVTGRRAWPLQPAERIAGMRLDCALHHVELELAELQDDAQRPVLRMARVFEATHAPYIGFNRAQAAVIEGAILVSRLHMLPAAKVDAEMNYLQIAIDKTAGPEEHEAWGWLTEAVARRSRLHRPEGAARGCARRPGRRDDCGDRARARDHR

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
122 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
178 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
181 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
194 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
202 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
203 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
204 2643221660 Methylibium sp. Root1272 Isolate Unclassified
205 2738543013 Variovorax sp. BT01 Isolate Unclassified
206 2894510363 Methylomonas sp. Kb3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.2
Nodule 0.51
Rhizoplane 1.29
Rhizosphere 73.01
Stem 0
Stem Tuber 0
Unclassified 3.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0018569 3300046528 Bacteria 2722
2 rootH1_10126052 3300003316 Bacteria 1659
3 rootL2_10037605 3300003322 Bacteria 2582
4 rootL2_10095678 3300003322 Bacteria 2581
5 Ga0065707_10497003 3300005295 Bacteria 760
6 Ga0070676_10002447 3300005328 Bacteria 9511
7 Ga0070676_10041727 3300005328 Bacteria 2662
8 Ga0070676_10105635 3300005328 Bacteria 1746
9 Ga0070670_100017955 3300005331 Bacteria 6072
10 Ga0070670_100096094 3300005331 Bacteria 2549
11 Ga0070670_100295693 3300005331 Bacteria 1416
12 Ga0070677_10014306 3300005333 Bacteria 2792
13 Ga0070677_10035883 3300005333 Bacteria 1925
14 Ga0068869_100004085 3300005334 Bacteria 9039
15 Ga0068869_100108796 3300005334 Bacteria 2106
16 Ga0068869_100137294 3300005334 Bacteria 1885
17 Ga0068869_100348949 3300005334 Bacteria 1206
18 Ga0070666_10320942 3300005335 Bacteria 1105
19 Ga0068868_100050272 3300005338 Bacteria 3273
20 Ga0068868_100120551 3300005338 Bacteria 2139
21 Ga0068868_100311330 3300005338 Bacteria 1340
22 Ga0068868_100377324 3300005338 Bacteria 1219
23 Ga0068868_100512801 3300005338 Bacteria 1052
24 Ga0070661_100136507 3300005344 Bacteria 1846
25 Ga0070668_100219286 3300005347 Unclassified 1568
26 Ga0070669_100028234 3300005353 Bacteria 4040
27 Ga0070669_100034786 3300005353 Bacteria 3647
28 Ga0070669_100373866 3300005353 Bacteria 1161
29 Ga0070675_100005687 3300005354 Bacteria 9544
30 Ga0070675_100022853 3300005354 Bacteria 4996
31 Ga0070675_100414901 3300005354 Bacteria 1203
32 Ga0070671_100004053 3300005355 Bacteria 11555
33 Ga0070671_100009554 3300005355 Bacteria 7791
34 Ga0070671_100522590 3300005355 Bacteria 1022
35 Ga0070674_100005673 3300005356 Bacteria 7236
36 Ga0070674_100005938 3300005356 Bacteria 7099
37 Ga0070674_100009749 3300005356 Bacteria 5770
38 Ga0070674_100064945 3300005356 Bacteria 2560
39 Ga0070673_100003178 3300005364 Bacteria 10179
40 Ga0070673_100377574 3300005364 Bacteria 1263
41 Ga0070673_100604307 3300005364 Bacteria 1001
42 Ga0070667_100009151 3300005367 Bacteria 8198
43 Ga0070667_100016532 3300005367 Bacteria 6106
44 Ga0070667_100393000 3300005367 Bacteria 1261
45 Ga0070667_100572828 3300005367 Bacteria 1039
46 Ga0070700_100036079 3300005441 Bacteria 2997
47 Ga0070708_100044895 3300005445 Bacteria 3890
48 Ga0070663_100069304 3300005455 Bacteria 2562
49 Ga0070663_100204796 3300005455 Bacteria 1542
50 Ga0070663_100490679 3300005455 Unclassified 1018
51 Ga0070678_100013872 3300005456 Bacteria 5065
52 Ga0070678_100766606 3300005456 Bacteria 874
53 Ga0068867_100000248 3300005459 Bacteria 35579
54 Ga0068867_100003838 3300005459 Bacteria 10560
55 Ga0068867_100049653 3300005459 Bacteria 3089
56 Ga0068867_100070461 3300005459 Bacteria 2614
57 Ga0068867_100202012 3300005459 Bacteria 1592
58 Ga0068867_100222150 3300005459 Bacteria 1523
59 Ga0068867_100370884 3300005459 Bacteria 1200
60 Ga0068867_100374657 3300005459 Unclassified 1194
61 Ga0068867_100442949 3300005459 Bacteria 1105
62 Ga0070706_100005610 3300005467 Bacteria 11942
63 Ga0070707_100113609 3300005468 Bacteria 2628
64 Ga0070699_100262226 3300005518 Bacteria 1545
65 Ga0068853_100268602 3300005539 Bacteria 1570
66 Ga0068853_100456540 3300005539 Bacteria 1202
67 Ga0068853_100504409 3300005539 Bacteria 1142
68 Ga0068853_100642112 3300005539 Bacteria 1010
69 Ga0070672_100001426 3300005543 Bacteria 14764
70 Ga0070672_100031578 3300005543 Bacteria 3987
71 Ga0070686_100044850 3300005544 Bacteria 2782
72 Ga0070686_100208306 3300005544 Bacteria 1406
73 Ga0070693_100628814 3300005547 Bacteria 778
74 Ga0070665_100451583 3300005548 Bacteria 1295
75 Ga0070665_101358191 3300005548 Unclassified 720
76 Ga0068855_100277775 3300005563 Bacteria 1861
77 Ga0068855_101176948 3300005563 Bacteria 798
78 Ga0070664_100106867 3300005564 Bacteria 2439
79 Ga0070664_100404467 3300005564 Bacteria 1249
80 Ga0070664_100618636 3300005564 Bacteria 1005
81 Ga0068857_100002253 3300005577 Bacteria 15682
82 Ga0068857_100063922 3300005577 Bacteria 3272
83 Ga0068854_101136529 3300005578 Unclassified 697
84 Ga0068856_100093276 3300005614 Bacteria 2996
85 Ga0068852_100029477 3300005616 Bacteria 4510
86 Ga0068859_100139153 3300005617 Bacteria 2501
87 Ga0068864_100090495 3300005618 Bacteria 2698
88 Ga0068866_10031342 3300005718 Bacteria 2560
89 Ga0068861_100005644 3300005719 Bacteria 8485
90 Ga0068870_10015589 3300005840 Bacteria 3611
91 Ga0068863_100126354 3300005841 Bacteria 2440
92 Ga0068858_100095554 3300005842 Bacteria 2769
93 Ga0068860_100002241 3300005843 Bacteria 20355
94 Ga0068860_101084665 3300005843 Bacteria 820
95 Ga0068862_100065519 3300005844 Bacteria 3129
96 Ga0075368_10016207 3300006042 Bacteria 2776
97 Ga0075368_10050393 3300006042 Bacteria 1654
98 Ga0075363_100004326 3300006048 Bacteria 6186
99 Ga0075364_10063073 3300006051 Bacteria 2433
100 Ga0075432_10016146 3300006058 Bacteria 2550
101 Ga0075362_10000208 3300006177 Bacteria 16362
102 Ga0075362_10007612 3300006177 Bacteria 4113
103 Ga0075362_10087674 3300006177 Bacteria 1441
104 Ga0075367_10006257 3300006178 Bacteria 5999
105 Ga0075367_10036635 3300006178 Bacteria 2846
106 Ga0075367_10108804 3300006178 Bacteria 1699
107 Ga0075367_10157657 3300006178 Bacteria 1411
108 Ga0075369_10009311 3300006186 Bacteria 3810
109 Ga0075366_10001779 3300006195 Bacteria 10878
110 Ga0075366_10032338 3300006195 Bacteria 3079
111 Ga0075366_10037373 3300006195 Bacteria 2866
112 Ga0075366_10053978 3300006195 Bacteria 2387
113 Ga0075366_10130832 3300006195 Bacteria 1514
114 Ga0075366_10159838 3300006195 Bacteria 1365
115 Ga0075366_10171486 3300006195 Bacteria 1316
116 Ga0075366_10209026 3300006195 Bacteria 1187
117 Ga0075366_10248489 3300006195 Bacteria 1085
118 Ga0097621_101179561 3300006237 Bacteria 721
119 Ga0075370_10001084 3300006353 Bacteria 11328
120 Ga0075370_10009026 3300006353 Bacteria 5156
121 Ga0075370_10049363 3300006353 Bacteria 2385
122 Ga0075370_10067468 3300006353 Bacteria 2042
123 Ga0075370_10086435 3300006353 Bacteria 1806
124 Ga0075370_10155387 3300006353 Bacteria 1341
125 Ga0068871_100108521 3300006358 Bacteria 2333
126 Ga0068865_100033058 3300006881 Bacteria 3460
127 Ga0068865_100047959 3300006881 Bacteria 2938
128 Ga0068865_100134179 3300006881 Bacteria 1858
129 Ga0068865_100355323 3300006881 Bacteria 1188
130 Ga0097620_100139152 3300006931 Bacteria 2501
131 Ga0099826_10069767 3300006948 Bacteria 2238
132 Ga0105240_10002721 3300009093 Bacteria 28041
133 Ga0105240_10252218 3300009093 Bacteria 2040
134 Ga0105240_10600178 3300009093 Bacteria 1212
135 Ga0105245_10089357 3300009098 Bacteria 2832
136 Ga0105243_10110012 3300009148 Bacteria 2303
137 Ga0105243_10168050 3300009148 Bacteria 1897
138 Ga0105241_11203659 3300009174 Bacteria 718
139 Ga0105242_10284161 3300009176 Bacteria 1504
140 Ga0105237_10002887 3300009545 Bacteria 20848
141 Ga0105237_10009836 3300009545 Bacteria 10225
142 Ga0105237_10212667 3300009545 Bacteria 1933
143 Ga0105237_10388403 3300009545 Bacteria 1401
144 Ga0105238_10004350 3300009551 Bacteria 14055
145 Ga0105249_10006901 3300009553 Bacteria 9898
146 Ga0105249_10790713 3300009553 Bacteria 1012
147 Ga0105239_10000595 3300010375 Bacteria 51559
148 Ga0105239_10030125 3300010375 Bacteria 5966
149 Ga0105239_10620304 3300010375 Bacteria 1234
150 Ga0105239_10623201 3300010375 Unclassified 1231
151 Ga0105246_10218208 3300011119 Bacteria 1493
152 Ga0105246_10971451 3300011119 Unclassified 767
153 Ga0157374_11134287 3300013296 Bacteria 803
154 Ga0157378_10309654 3300013297 Bacteria 1531
155 Ga0157378_10331221 3300013297 Bacteria 1482
156 Ga0157378_11638138 3300013297 Bacteria 690
157 Ga0163162_10009794 3300013306 Bacteria 9325
158 Ga0163162_10064571 3300013306 Bacteria 3705
159 Ga0157375_10031194 3300013308 Bacteria 5033
160 Ga0157375_10072279 3300013308 Bacteria 3465
161 Ga0157375_10378999 3300013308 Unclassified 1581
162 Ga0157375_10404731 3300013308 Bacteria 1531
163 Ga0157375_10539169 3300013308 Bacteria 1329
164 Ga0163163_10500835 3300014325 Bacteria 1276
165 Ga0157380_10101064 3300014326 Bacteria 2402
166 Ga0157380_11060966 3300014326 Bacteria 847
167 Ga0157379_10011761 3300014968 Bacteria 7643
168 Ga0157379_10599573 3300014968 Bacteria 1028
169 Ga0157379_10654637 3300014968 Bacteria 984
170 Ga0157376_10700272 3300014969 Bacteria 1018
171 Ga0163161_10002424 3300017792 Bacteria 13341
172 Ga0163161_10387219 3300017792 Bacteria 1118
173 Ga0207697_10015315 3300025315 Bacteria 3170
174 Ga0207682_10035247 3300025893 Bacteria 2020
175 Ga0207642_10018016 3300025899 Bacteria 2701
176 Ga0207688_10125104 3300025901 Bacteria 1503
177 Ga0207688_10278463 3300025901 Bacteria 1019
178 Ga0207645_10003280 3300025907 Bacteria 12342
179 Ga0207645_10129595 3300025907 Bacteria 1641
180 Ga0207643_10031764 3300025908 Bacteria 2945
181 Ga0207684_10007959 3300025910 Bacteria 9474
182 Ga0207695_10002052 3300025913 Bacteria 30853
183 Ga0207695_10066109 3300025913 Bacteria 3715
184 Ga0207671_10008495 3300025914 Bacteria 8701
185 Ga0207671_10323670 3300025914 Bacteria 1220
186 Ga0207649_10110032 3300025920 Bacteria 1839
187 Ga0207681_10020444 3300025923 Bacteria 4195
188 Ga0207681_10096032 3300025923 Bacteria 2127
189 Ga0207681_10153255 3300025923 Bacteria 1729
190 Ga0207694_10038590 3300025924 Bacteria 3672
191 Ga0207650_10133402 3300025925 Bacteria 1946
192 Ga0207650_10212898 3300025925 Bacteria 1552
193 Ga0207659_10000995 3300025926 Bacteria 16847
194 Ga0207659_10005157 3300025926 Bacteria 7922
195 Ga0207659_10126508 3300025926 Bacteria 1966
196 Ga0207687_10249114 3300025927 Bacteria 1411
197 Ga0207644_10001125 3300025931 Bacteria 17128
198 Ga0207644_11087163 3300025931 Bacteria 672
199 Ga0207706_10030451 3300025933 Bacteria 4813
200 Ga0207706_10465316 3300025933 Bacteria 1093
201 Ga0207709_10200993 3300025935 Bacteria 1423
202 Ga0207709_10341849 3300025935 Bacteria 1127
203 Ga0207669_10005451 3300025937 Bacteria 5710
204 Ga0207669_10007454 3300025937 Bacteria 5061
205 Ga0207669_10116226 3300025937 Unclassified 1805
206 Ga0207704_10202469 3300025938 Bacteria 1454
207 Ga0207704_10427125 3300025938 Bacteria 1052
208 Ga0207691_10001107 3300025940 Bacteria 26821
209 Ga0207691_10010805 3300025940 Bacteria 8764
210 Ga0207691_10065963 3300025940 Bacteria 3276
211 Ga0207689_10008319 3300025942 Bacteria 9037
212 Ga0207689_10132063 3300025942 Bacteria 2055
213 Ga0207689_10283194 3300025942 Bacteria 1373
214 Ga0207679_10066591 3300025945 Bacteria 2699
215 Ga0207651_10501092 3300025960 Bacteria 1050
216 Ga0207712_10038731 3300025961 Bacteria 3261
217 Ga0207668_10606341 3300025972 Unclassified 954
218 Ga0207640_10068791 3300025981 Bacteria 2375
219 Ga0207640_10778013 3300025981 Bacteria 827
220 Ga0207640_11279194 3300025981 Unclassified 654
221 Ga0207658_10005991 3300025986 Bacteria 8310
222 Ga0207658_10234221 3300025986 Bacteria 1552
223 Ga0207658_10242306 3300025986 Bacteria 1528
224 Ga0207658_10412538 3300025986 Bacteria 1189
225 Ga0207677_10040304 3300026023 Bacteria 3078
226 Ga0207677_10117473 3300026023 Bacteria 1994
227 Ga0207703_10129299 3300026035 Bacteria 2179
228 Ga0207639_10784794 3300026041 Bacteria 887
229 Ga0207678_10008501 3300026067 Bacteria 9050
230 Ga0207678_10191604 3300026067 Bacteria 1747
231 Ga0207708_10024066 3300026075 Bacteria 4604
232 Ga0207702_10673603 3300026078 Bacteria 1018
233 Ga0207641_10094822 3300026088 Bacteria 2618
234 Ga0207641_11165845 3300026088 Bacteria 770
235 Ga0207648_10002736 3300026089 Bacteria 18733
236 Ga0207648_10010925 3300026089 Bacteria 8580
237 Ga0207648_10013623 3300026089 Bacteria 7550
238 Ga0207648_10091092 3300026089 Bacteria 2665
239 Ga0207648_10185596 3300026089 Bacteria 1842
240 Ga0207648_10277008 3300026089 Bacteria 1500
241 Ga0207648_10366550 3300026089 Bacteria 1300
242 Ga0207648_10380465 3300026089 Bacteria 1276
243 Ga0207676_10074001 3300026095 Bacteria 2743
244 Ga0207674_10012959 3300026116 Bacteria 9298
245 Ga0207674_10049770 3300026116 Bacteria 4284
246 Ga0207675_100036187 3300026118 Bacteria 4605
247 Ga0207683_10001407 3300026121 Bacteria 21720
248 Ga0207683_10171529 3300026121 Bacteria 1965
249 Ga0207698_10387984 3300026142 Bacteria 1331
250 Ga0209281_1021048 3300027111 Bacteria 1266
251 Ga0209968_1000228 3300027526 Bacteria 9674
252 Ga0209966_1000003 3300027695 Bacteria 111077
253 Ga0209813_10091591 3300027866 Bacteria 1021
254 Ga0268266_10567510 3300028379 Unclassified 1088
255 Ga0268265_10022438 3300028380 Bacteria 4435
256 Ga0268264_10322793 3300028381 Bacteria 1460
257 Ga0307517_10001466 3300028786 Bacteria 39485
258 Ga0307517_10057282 3300028786 Bacteria 3779
259 Ga0307517_10094534 3300028786 Bacteria 2413
260 Ga0307517_10110525 3300028786 Bacteria 2094
261 Ga0265331_10012262 3300031250 Bacteria 4649
262 Ga0265327_10000271 3300031251 Bacteria 102433
263 Ga0265327_10004439 3300031251 Bacteria 12422
264 Ga0307513_10039550 3300031456 Bacteria 5227
265 Ga0307513_10062764 3300031456 Bacteria 3925
266 Ga0307513_10317206 3300031456 Bacteria 1318
267 Ga0307509_10001831 3300031507 Bacteria 35184
268 Ga0307509_10010770 3300031507 Bacteria 11152
269 Ga0307509_10017196 3300031507 Bacteria 8331
270 Ga0307509_10053021 3300031507 Bacteria 4328
271 Ga0307509_10135890 3300031507 Bacteria 2404
272 Ga0307509_10180061 3300031507 Bacteria 1980
273 Ga0307509_10355715 3300031507 Bacteria 1186
274 Ga0307408_100250617 3300031548 Bacteria 1460
275 Ga0307508_10002623 3300031616 Bacteria 18890
276 Ga0307508_10025096 3300031616 Bacteria 5406
277 Ga0307508_10270316 3300031616 Bacteria 1294
278 Ga0307514_10001249 3300031649 Bacteria 33368
279 Ga0307516_10002058 3300031730 Bacteria 27388
280 Ga0307516_10421690 3300031730 Bacteria 992
281 Ga0307405_10756394 3300031731 Bacteria 810
282 Ga0307412_10105945 3300031911 Bacteria 1998
283 Ga0307412_10604303 3300031911 Bacteria 929
284 Ga0307416_100037886 3300032002 Bacteria 3715
285 Ga0307416_100528079 3300032002 Bacteria 1250
286 Ga0307416_100751082 3300032002 Bacteria 1068
287 Ga0307414_10724591 3300032004 Bacteria 902
288 Ga0307414_11193308 3300032004 Bacteria 704
289 Ga0307411_10305936 3300032005 Bacteria 1277
290 Ga0307411_10457308 3300032005 Bacteria 1069
291 Ga0307507_10215691 3300033179 Bacteria 1300
292 Ga0307510_10037876 3300033180 Bacteria 5342
293 Ga0307510_10043378 3300033180 Bacteria 4890
294 Ga0307510_10079528 3300033180 Bacteria 3196
295 Ga0307510_10170730 3300033180 Bacteria 1754
296 Ga0373925_0100189 3300037068 Bacteria 2226
297 Ga0395905_0006398 3300037471 Bacteria 11860
298 Ga0395905_0113530 3300037471 Bacteria 2545
299 Ga0395905_0181939 3300037471 Bacteria 1973
300 Ga0451793_1668321 3300041452 Bacteria 769
301 Ga0451853_3233438 3300041512 Bacteria 1376
302 Ga0451577_0002810 3300042876 Bacteria 20070
303 Ga0453684_0444100 3300044712 Bacteria 1445
304 Ga0453684_1909061 3300044712 Bacteria 601
305 Ga0495592_0001945 3300046454 Bacteria 14569
306 Ga0495638_0051079 3300046460 Bacteria 2580
307 Ga0495650_0002965 3300046471 Bacteria 12844
308 Ga0495650_0091444 3300046471 Bacteria 1157
309 Ga0495605_0280344 3300046474 Unclassified 708
310 Ga0495583_0218346 3300046506 Bacteria 771
311 Ga0495610_0036300 3300046512 Bacteria 2520
312 Ga0495620_0154022 3300046515 Bacteria 895
313 Ga0495632_0046753 3300046519 Bacteria 2149
314 Ga0495632_0184342 3300046519 Bacteria 955
315 Ga0495643_0110909 3300046522 Bacteria 1395
316 Ga0495621_0007705 3300046539 Bacteria 3196
317 Ga0495621_0025597 3300046539 Bacteria 1983
318 Ga0495597_0019682 3300046542 Bacteria 3154
319 Ga0495668_0063388 3300046616 Bacteria 2036
320 Ga0495668_0115648 3300046616 Bacteria 1467
321 Ga0495611_0113198 3300046648 Bacteria 1264
322 Ga0495625_0156895 3300046660 Bacteria 1527
323 Ga0495625_0208799 3300046660 Bacteria 1284
324 Ga0495625_0565298 3300046660 Bacteria 687
325 Ga0495646_0063318 3300046680 Bacteria 2196
326 Ga0495649_0009803 3300046694 Bacteria 5670
327 Ga0495649_0310598 3300046694 Bacteria 801
328 Ga0495660_0176113 3300046810 Bacteria 1038
329 Ga0495687_000336 3300047443 Bacteria 60212
330 Ga0495687_003091 3300047443 Bacteria 12466
331 Ga0495687_003635 3300047443 Bacteria 11004
332 Ga0495686_0000751 3300047472 Bacteria 42784
333 Ga0495626_0077383 3300048091 Bacteria 1483
334 Ga0495626_0104453 3300048091 Bacteria 1232
335 Ga0495626_0240978 3300048091 Bacteria 728
336 Ga0496100_0778813 3300048903 Bacteria 749
337 Ga0496102_0110713 3300048905 Bacteria 2560
338 Ga0496106_0321741 3300048909 Bacteria 1242
339 Ga0496111_0956222 3300048914 Bacteria 615
340 Ga0496124_0365590 3300048927 Bacteria 1015
341 Ga0495682_0076746 3300049460 Unclassified 1202
342 Ga0501298_077969 3300049521 Bacteria 725
343 Ga0501298_104918 3300049521 Bacteria 649
344 Ga0501198_000076 3300049649 Bacteria 24439
345 Ga0501222_000259 3300049662 Bacteria 8948
346 Ga0501222_008830 3300049662 Bacteria 1335
347 Ga0501225_0001432 3300049705 Bacteria 7451
348 Ga0501265_001927 3300049762 Bacteria 2364
349 Ga0501281_01279 3300049777 Bacteria 1999
350 nmdc:mga03683_57560_c1 3300050489 Bacteria 1636
351 nmdc:mga03683_7870_c1 3300050489 Bacteria 3722
352 nmdc:mga03n38_17220_c1 3300050490 Bacteria 2826
353 nmdc:mga00v17_28491_c1 3300050491 Bacteria 3271
354 nmdc:mga0yw44_19024_c1 3300050492 Bacteria 3778
355 nmdc:mga0k408_108275_c1 3300050493 Bacteria 1642
356 nmdc:mga0k408_12715_c1 3300050493 Bacteria 4603
357 nmdc:mga0k408_200652_c1 3300050493 Bacteria 1191
358 nmdc:mga0k408_227295_c1 3300050493 Bacteria 1114
359 nmdc:mga0k408_27685_c1 3300050493 Bacteria 3221
360 nmdc:mga0k408_4136_c1 3300050493 Bacteria 7707
361 nmdc:mga0k408_7422_c1 3300050493 Bacteria 5853
362 nmdc:mga06z11_133151_c1 3300050494 Bacteria 1398
363 nmdc:mga06z11_48800_c1 3300050494 Bacteria 2157
364 nmdc:mga07m45_15704_c1 3300050496 Bacteria 4045
365 nmdc:mga07m45_30495_c1 3300050496 Bacteria 2987
366 nmdc:mga07m45_321_c1 3300050496 Bacteria 19397
367 nmdc:mga07m45_406_c1 3300050496 Bacteria 17815
368 nmdc:mga07m45_79848_c1 3300050496 Bacteria 1868
369 nmdc:mga07m45_84833_c1 3300050496 Bacteria 1811
370 nmdc:mga0sz30_4263_c1 3300050516 Bacteria 5157
371 nmdc:mga0sz30_74937_c1 3300050516 Bacteria 1460
372 Ga0500578_0237182 3300053086 Bacteria 1103
373 Ga0500644_0001836 3300053088 Bacteria 5487
374 Ga0500583_0117177 3300053092 Bacteria 1316
375 Ga0500650_0222728 3300053098 Bacteria 853
376 Ga0500594_0000833 3300053118 Bacteria 6582
377 Ga0500658_0003687 3300053134 Bacteria 5773
378 Ga0500559_0000203 3300053136 Bacteria 47280
379 Ga0500568_0029747 3300053139 Bacteria 2264
380 Ga0500568_0175555 3300053139 Bacteria 788
381 Ga0500619_017984 3300053154 Bacteria 1977
382 Ga0500636_0271026 3300053177 Unclassified 853
383 Ga0500645_016379 3300053730 Bacteria 2334
384 Ga0500661_047265 3300055283 Bacteria 766
385 2523105954 2522572158 Bacteria 6514390
386 2644301665 2643221654 Bacteria 5273570
387 2644340663 2643221660 Bacteria 4208257
388 2739248691 2738543013 Bacteria 5618633
389 2894514954 2894510363 Bacteria 5121143
390 Ga0495642_0018569
391 rootH1_10126052
392 rootL2_10037605
393 rootL2_10095678
394 Ga0065707_10497003
395 Ga0070676_10002447
396 Ga0070676_10041727
397 Ga0070676_10105635
398 Ga0070670_100017955
399 Ga0070670_100096094
400 Ga0070670_100295693
401 Ga0070677_10014306
402 Ga0070677_10035883
403 Ga0068869_100004085
404 Ga0068869_100108796
405 Ga0068869_100137294
406 Ga0068869_100348949
407 Ga0070666_10320942
408 Ga0068868_100050272
409 Ga0068868_100120551
410 Ga0068868_100311330
411 Ga0068868_100377324
412 Ga0068868_100512801
413 Ga0070661_100136507
414 Ga0070668_100219286
415 Ga0070669_100028234
416 Ga0070669_100034786
417 Ga0070669_100373866
418 Ga0070675_100005687
419 Ga0070675_100022853
420 Ga0070675_100414901
421 Ga0070671_100004053
422 Ga0070671_100009554
423 Ga0070671_100522590
424 Ga0070674_100005673
425 Ga0070674_100005938
426 Ga0070674_100009749
427 Ga0070674_100064945
428 Ga0070673_100003178
429 Ga0070673_100377574
430 Ga0070673_100604307
431 Ga0070667_100009151
432 Ga0070667_100016532
433 Ga0070667_100393000
434 Ga0070667_100572828
435 Ga0070700_100036079
436 Ga0070708_100044895
437 Ga0070663_100069304
438 Ga0070663_100204796
439 Ga0070663_100490679
440 Ga0070678_100013872
441 Ga0070678_100766606
442 Ga0068867_100000248
443 Ga0068867_100003838
444 Ga0068867_100049653
445 Ga0068867_100070461
446 Ga0068867_100202012
447 Ga0068867_100222150
448 Ga0068867_100370884
449 Ga0068867_100374657
450 Ga0068867_100442949
451 Ga0070706_100005610
452 Ga0070707_100113609
453 Ga0070699_100262226
454 Ga0068853_100268602
455 Ga0068853_100456540
456 Ga0068853_100504409
457 Ga0068853_100642112
458 Ga0070672_100001426
459 Ga0070672_100031578
460 Ga0070686_100044850
461 Ga0070686_100208306
462 Ga0070693_100628814
463 Ga0070665_100451583
464 Ga0070665_101358191
465 Ga0068855_100277775
466 Ga0068855_101176948
467 Ga0070664_100106867
468 Ga0070664_100404467
469 Ga0070664_100618636
470 Ga0068857_100002253
471 Ga0068857_100063922
472 Ga0068854_101136529
473 Ga0068856_100093276
474 Ga0068852_100029477
475 Ga0068859_100139153
476 Ga0068864_100090495
477 Ga0068866_10031342
478 Ga0068861_100005644
479 Ga0068870_10015589
480 Ga0068863_100126354
481 Ga0068858_100095554
482 Ga0068860_100002241
483 Ga0068860_101084665
484 Ga0068862_100065519
485 Ga0075368_10016207
486 Ga0075368_10050393
487 Ga0075363_100004326
488 Ga0075364_10063073
489 Ga0075432_10016146
490 Ga0075362_10000208
491 Ga0075362_10007612
492 Ga0075362_10087674
493 Ga0075367_10006257
494 Ga0075367_10036635
495 Ga0075367_10108804
496 Ga0075367_10157657
497 Ga0075369_10009311
498 Ga0075366_10001779
499 Ga0075366_10032338
500 Ga0075366_10037373
501 Ga0075366_10053978
502 Ga0075366_10130832
503 Ga0075366_10159838
504 Ga0075366_10171486
505 Ga0075366_10209026
506 Ga0075366_10248489
507 Ga0097621_101179561
508 Ga0075370_10001084
509 Ga0075370_10009026
510 Ga0075370_10049363
511 Ga0075370_10067468
512 Ga0075370_10086435
513 Ga0075370_10155387
514 Ga0068871_100108521
515 Ga0068865_100033058
516 Ga0068865_100047959
517 Ga0068865_100134179
518 Ga0068865_100355323
519 Ga0097620_100139152
520 Ga0099826_10069767
521 Ga0105240_10002721
522 Ga0105240_10252218
523 Ga0105240_10600178
524 Ga0105245_10089357
525 Ga0105243_10110012
526 Ga0105243_10168050
527 Ga0105241_11203659
528 Ga0105242_10284161
529 Ga0105237_10002887
530 Ga0105237_10009836
531 Ga0105237_10212667
532 Ga0105237_10388403
533 Ga0105238_10004350
534 Ga0105249_10006901
535 Ga0105249_10790713
536 Ga0105239_10000595
537 Ga0105239_10030125
538 Ga0105239_10620304
539 Ga0105239_10623201
540 Ga0105246_10218208
541 Ga0105246_10971451
542 Ga0157374_11134287
543 Ga0157378_10309654
544 Ga0157378_10331221
545 Ga0157378_11638138
546 Ga0163162_10009794
547 Ga0163162_10064571
548 Ga0157375_10031194
549 Ga0157375_10072279
550 Ga0157375_10378999
551 Ga0157375_10404731
552 Ga0157375_10539169
553 Ga0163163_10500835
554 Ga0157380_10101064
555 Ga0157380_11060966
556 Ga0157379_10011761
557 Ga0157379_10599573
558 Ga0157379_10654637
559 Ga0157376_10700272
560 Ga0163161_10002424
561 Ga0163161_10387219
562 Ga0207697_10015315
563 Ga0207682_10035247
564 Ga0207642_10018016
565 Ga0207688_10125104
566 Ga0207688_10278463
567 Ga0207645_10003280
568 Ga0207645_10129595
569 Ga0207643_10031764
570 Ga0207684_10007959
571 Ga0207695_10002052
572 Ga0207695_10066109
573 Ga0207671_10008495
574 Ga0207671_10323670
575 Ga0207649_10110032
576 Ga0207681_10020444
577 Ga0207681_10096032
578 Ga0207681_10153255
579 Ga0207694_10038590
580 Ga0207650_10133402
581 Ga0207650_10212898
582 Ga0207659_10000995
583 Ga0207659_10005157
584 Ga0207659_10126508
585 Ga0207687_10249114
586 Ga0207644_10001125
587 Ga0207644_11087163
588 Ga0207706_10030451
589 Ga0207706_10465316
590 Ga0207709_10200993
591 Ga0207709_10341849
592 Ga0207669_10005451
593 Ga0207669_10007454
594 Ga0207669_10116226
595 Ga0207704_10202469
596 Ga0207704_10427125
597 Ga0207691_10001107
598 Ga0207691_10010805
599 Ga0207691_10065963
600 Ga0207689_10008319
601 Ga0207689_10132063
602 Ga0207689_10283194
603 Ga0207679_10066591
604 Ga0207651_10501092
605 Ga0207712_10038731
606 Ga0207668_10606341
607 Ga0207640_10068791
608 Ga0207640_10778013
609 Ga0207640_11279194
610 Ga0207658_10005991
611 Ga0207658_10234221
612 Ga0207658_10242306
613 Ga0207658_10412538
614 Ga0207677_10040304
615 Ga0207677_10117473
616 Ga0207703_10129299
617 Ga0207639_10784794
618 Ga0207678_10008501
619 Ga0207678_10191604
620 Ga0207708_10024066
621 Ga0207702_10673603
622 Ga0207641_10094822
623 Ga0207641_11165845
624 Ga0207648_10002736
625 Ga0207648_10010925
626 Ga0207648_10013623
627 Ga0207648_10091092
628 Ga0207648_10185596
629 Ga0207648_10277008
630 Ga0207648_10366550
631 Ga0207648_10380465
632 Ga0207676_10074001
633 Ga0207674_10012959
634 Ga0207674_10049770
635 Ga0207675_100036187
636 Ga0207683_10001407
637 Ga0207683_10171529
638 Ga0207698_10387984
639 Ga0209281_1021048
640 Ga0209968_1000228
641 Ga0209966_1000003
642 Ga0209813_10091591
643 Ga0268266_10567510
644 Ga0268265_10022438
645 Ga0268264_10322793
646 Ga0307517_10001466
647 Ga0307517_10057282
648 Ga0307517_10094534
649 Ga0307517_10110525
650 Ga0265331_10012262
651 Ga0265327_10000271
652 Ga0265327_10004439
653 Ga0307513_10039550
654 Ga0307513_10062764
655 Ga0307513_10317206
656 Ga0307509_10001831
657 Ga0307509_10010770
658 Ga0307509_10017196
659 Ga0307509_10053021
660 Ga0307509_10135890
661 Ga0307509_10180061
662 Ga0307509_10355715
663 Ga0307408_100250617
664 Ga0307508_10002623
665 Ga0307508_10025096
666 Ga0307508_10270316
667 Ga0307514_10001249
668 Ga0307516_10002058
669 Ga0307516_10421690
670 Ga0307405_10756394
671 Ga0307412_10105945
672 Ga0307412_10604303
673 Ga0307416_100037886
674 Ga0307416_100528079
675 Ga0307416_100751082
676 Ga0307414_10724591
677 Ga0307414_11193308
678 Ga0307411_10305936
679 Ga0307411_10457308
680 Ga0307507_10215691
681 Ga0307510_10037876
682 Ga0307510_10043378
683 Ga0307510_10079528
684 Ga0307510_10170730
685 Ga0373925_0100189
686 Ga0395905_0006398
687 Ga0395905_0113530
688 Ga0395905_0181939
689 Ga0451793_1668321
690 Ga0451853_3233438
691 Ga0451577_0002810
692 Ga0453684_0444100
693 Ga0453684_1909061
694 Ga0495592_0001945
695 Ga0495638_0051079
696 Ga0495650_0002965
697 Ga0495650_0091444
698 Ga0495605_0280344
699 Ga0495583_0218346
700 Ga0495610_0036300
701 Ga0495620_0154022
702 Ga0495632_0046753
703 Ga0495632_0184342
704 Ga0495643_0110909
705 Ga0495621_0007705
706 Ga0495621_0025597
707 Ga0495597_0019682
708 Ga0495668_0063388
709 Ga0495668_0115648
710 Ga0495611_0113198
711 Ga0495625_0156895
712 Ga0495625_0208799
713 Ga0495625_0565298
714 Ga0495646_0063318
715 Ga0495649_0009803
716 Ga0495649_0310598
717 Ga0495660_0176113
718 Ga0495687_000336
719 Ga0495687_003091
720 Ga0495687_003635
721 Ga0495686_0000751
722 Ga0495626_0077383
723 Ga0495626_0104453
724 Ga0495626_0240978
725 Ga0496100_0778813
726 Ga0496102_0110713
727 Ga0496106_0321741
728 Ga0496111_0956222
729 Ga0496124_0365590
730 Ga0495682_0076746
731 Ga0501298_077969
732 Ga0501298_104918
733 Ga0501198_000076
734 Ga0501222_000259
735 Ga0501222_008830
736 Ga0501225_0001432
737 Ga0501265_001927
738 Ga0501281_01279
739 nmdc:mga03683_57560_c1
740 nmdc:mga03683_7870_c1
741 nmdc:mga03n38_17220_c1
742 nmdc:mga00v17_28491_c1
743 nmdc:mga0yw44_19024_c1
744 nmdc:mga0k408_108275_c1
745 nmdc:mga0k408_12715_c1
746 nmdc:mga0k408_200652_c1
747 nmdc:mga0k408_227295_c1
748 nmdc:mga0k408_27685_c1
749 nmdc:mga0k408_4136_c1
750 nmdc:mga0k408_7422_c1
751 nmdc:mga06z11_133151_c1
752 nmdc:mga06z11_48800_c1
753 nmdc:mga07m45_15704_c1
754 nmdc:mga07m45_30495_c1
755 nmdc:mga07m45_321_c1
756 nmdc:mga07m45_406_c1
757 nmdc:mga07m45_79848_c1
758 nmdc:mga07m45_84833_c1
759 nmdc:mga0sz30_4263_c1
760 nmdc:mga0sz30_74937_c1
761 Ga0500578_0237182
762 Ga0500644_0001836
763 Ga0500583_0117177
764 Ga0500650_0222728
765 Ga0500594_0000833
766 Ga0500658_0003687
767 Ga0500559_0000203
768 Ga0500568_0029747
769 Ga0500568_0175555
770 Ga0500619_017984
771 Ga0500636_0271026
772 Ga0500645_016379
773 Ga0500661_047265
774 2523105954
775 2644301665
776 2644340663
777 2739248691
778 2894514954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20766

DUF447_C

Protein of unknown function (DUF447)

131

183

0.98

PF04289

DUF447_N

Protein of unknown function (DUF447) N-terminal domain

6

125

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b5m-assembly2.cif.gz_C crystal structure of conserved uncharacterized protein from rhodopirellula baltica 0.9285 4 182
2nr4-assembly1.cif.gz_A crystal structure of fmn-bound protein mm1853 from methanosarcina mazei, pfam duf447 0.8664 2 180
3fge-assembly1.cif.gz_A-2 crystal structure of putative flavin reductase with split barrel domain (yp_750721.1) from shewanella frigidimarina ncimb 400 at 1.74 a resolution 0.8544 7 119
2iml-assembly2.cif.gz_B crystal structure of a hypothetical protein from archaeoglobus fulgidus binding riboflavin 5'-phosphate 0.8402 1 181
2r6v-assembly1.cif.gz_A crystal structure of fmn-binding protein (np_142786.1) from pyrococcus horikoshii at 1.35 a resolution 0.8346 5 119
ID Description Score Start End Superfamily
2ptfB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Hypothetical membrane protein ta0354_69_121. 0.9434 127 182 1.20.58.290
3b5mD02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Hypothetical membrane protein ta0354_69_121. 0.9259 124 185 1.20.58.290
2ptfB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Hypothetical membrane protein ta0354_69_121. 0.9129 127 182 1.20.58.290
3b5mA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Hypothetical membrane protein ta0354_69_121. 0.8956 124 184 1.20.58.290
2ptfB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8715 1 126 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A4U8V4R1-F1-model_v4 DUF447 family protein 0.9935 4 191
AF-A0A853HFZ6-F1-model_v4 deleted 0.9921 3 192
AF-A0A0F7JXF3-F1-model_v4 Tetrahydromethanopterin synthesis protein 0.9883 1 188
AF-A0A8A7D0F1-F1-model_v4 deleted 0.9856 4 188
AF-A0A6J5K1D4-F1-model_v4 Tetrahydromethanopterin synthesis protein 0.9855 1 188

Map