F431501

General Info

Members Datasets Scaffolds Average Seq Length
389 253 778 140

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0765398|Ga0436365_0765398_661_1134
Length 157
Sequence VLRFDPFSDIDALTRSWLTGQTGSTRSPRFMPMDLYKVEDHYVLTADLPGVDPGSVDVNVDNGTLTVTAHRTAQPAEDAVQWLANERFFGTYRRQLSLGEGIDTPAISATYENGVLSITIPVAERAKPRRIEVTNAGSARLIKASSSEEPMNTIESS

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
156 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
157 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
168 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
169 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
174 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
175 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
176 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
177 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
178 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
179 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
180 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
246 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
247 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
248 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
249 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
250 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
251 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
252 2922554459 Rhodococcus sp. 66b Isolate Unclassified
253 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.95
Metatranscriptomes 7.97
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.03
Nodule 0
Rhizoplane 10.8
Rhizosphere 71.72
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0765398 3300039437 Bacteria 2005
2 JGI24746J21847_1000914 3300001977 Bacteria 4615
3 JGI24750J21931_1010133 3300002070 Bacteria 1224
4 JGI24745J21846_1010000 3300002073 Bacteria 1078
5 JGI24744J21845_10004278 3300002077 Bacteria 2946
6 Ga0006778J45830_1028044 3300003162 Bacteria 525
7 Ga0006759J45824_1013866 3300003163 Bacteria 558
8 Ga0007417J51691_1011318 3300003544 Bacteria 531
9 Ga0007427J51700_122532 3300003559 Bacteria 519
10 Ga0007409J51694_1063738 3300003575 Bacteria 554
11 Ga0006562J51391_1006372 3300003578 Bacteria 857
12 Ga0007429J51699_1045791 3300003579 Bacteria 559
13 Ga0007415J51800_113150 3300003613 Bacteria 526
14 Ga0055540_1003186 3300003792 Bacteria 8078
15 Ga0055540_1007662 3300003792 Bacteria 4027
16 Ga0055540_1010407 3300003792 Bacteria 3101
17 Ga0070682_100499888 3300005337 Bacteria 942
18 Ga0070660_100623100 3300005339 Bacteria 903
19 Ga0070689_100111822 3300005340 Bacteria 2173
20 Ga0070691_10119024 3300005341 Bacteria 1328
21 Ga0070692_10154877 3300005345 Bacteria 1308
22 Ga0070668_100029111 3300005347 Bacteria 4194
23 Ga0070668_101330125 3300005347 Bacteria 654
24 Ga0070669_100000837 3300005353 Bacteria 22308
25 Ga0070675_100826666 3300005354 Bacteria 847
26 Ga0070671_100003340 3300005355 Bacteria 12514
27 Ga0070674_100043754 3300005356 Bacteria 3048
28 Ga0070673_100153430 3300005364 Bacteria 1952
29 Ga0070659_100308224 3300005366 Bacteria 1322
30 Ga0070667_100000333 3300005367 Bacteria 52478
31 Ga0070667_100031883 3300005367 Bacteria 4393
32 Ga0070667_100264298 3300005367 Bacteria 1541
33 Ga0070667_100902633 3300005367 Bacteria 822
34 Ga0070701_10313258 3300005438 Bacteria 969
35 Ga0070705_100363428 3300005440 Bacteria 1059
36 Ga0070700_100043229 3300005441 Bacteria 2771
37 Ga0070694_100139535 3300005444 Bacteria 1759
38 Ga0070663_100224175 3300005455 Bacteria 1477
39 Ga0070663_100332104 3300005455 Bacteria 1226
40 Ga0070678_100136334 3300005456 Bacteria 1958
41 Ga0070662_100394223 3300005457 Bacteria 1141
42 Ga0070685_10147309 3300005466 Bacteria 1489
43 Ga0070672_100417706 3300005543 Bacteria 1152
44 Ga0070686_100599723 3300005544 Bacteria 868
45 Ga0070695_100191453 3300005545 Bacteria 1456
46 Ga0070696_100125371 3300005546 Bacteria 1863
47 Ga0070693_100599977 3300005547 Bacteria 795
48 Ga0070665_100010056 3300005548 Bacteria 9572
49 Ga0070665_100018847 3300005548 Bacteria 6919
50 Ga0070665_100025254 3300005548 Bacteria 5987
51 Ga0070704_100097577 3300005549 Bacteria 2206
52 Ga0068855_100798662 3300005563 Bacteria 1003
53 Ga0068854_100066772 3300005578 Bacteria 2618
54 Ga0068859_100002157 3300005617 Bacteria 19997
55 Ga0068859_100133998 3300005617 Bacteria 2549
56 Ga0068859_100655124 3300005617 Bacteria 1142
57 Ga0068864_100015106 3300005618 Bacteria 6420
58 Ga0068864_100465907 3300005618 Bacteria 1211
59 Ga0068864_102551331 3300005618 Bacteria 517
60 Ga0068866_10079435 3300005718 Bacteria 1758
61 Ga0068866_10144856 3300005718 Bacteria 1368
62 Ga0068861_100074755 3300005719 Bacteria 2636
63 Ga0068861_101218763 3300005719 Bacteria 728
64 Ga0068851_10035917 3300005834 Bacteria 2480
65 Ga0068870_10512094 3300005840 Bacteria 802
66 Ga0068863_100007024 3300005841 Bacteria 11033
67 Ga0068863_100181002 3300005841 Bacteria 2023
68 Ga0068858_100009502 3300005842 Bacteria 9277
69 Ga0068858_100038984 3300005842 Bacteria 4407
70 Ga0068858_100260694 3300005842 Bacteria 1647
71 Ga0068860_100000160 3300005843 Bacteria 110266
72 Ga0068862_100000131 3300005844 Bacteria 87720
73 Ga0068862_100238301 3300005844 Bacteria 1653
74 Ga0068862_100897037 3300005844 Bacteria 871
75 Ga0068862_101125242 3300005844 Bacteria 781
76 Ga0081455_10180236 3300005937 Bacteria 1600
77 Ga0081455_10413229 3300005937 Bacteria 933
78 Ga0081538_10323084 3300005981 Bacteria 562
79 Ga0075365_10101887 3300006038 Bacteria 1967
80 Ga0075365_10233352 3300006038 Bacteria 1292
81 Ga0075363_100315606 3300006048 Bacteria 909
82 Ga0075364_10001722 3300006051 Bacteria 12049
83 Ga0075364_10065944 3300006051 Bacteria 2377
84 Ga0075364_10139216 3300006051 Bacteria 1632
85 Ga0075364_10231197 3300006051 Bacteria 1256
86 Ga0070715_10103550 3300006163 Bacteria 1332
87 Ga0070715_10699095 3300006163 Bacteria 605
88 Ga0070716_100300986 3300006173 Bacteria 1115
89 Ga0070712_100695546 3300006175 Bacteria 866
90 Ga0075362_10216301 3300006177 Bacteria 936
91 Ga0075367_10367240 3300006178 Bacteria 909
92 Ga0075367_10474735 3300006178 Bacteria 793
93 Ga0075369_10015267 3300006186 Bacteria 3080
94 Ga0075369_10022213 3300006186 Bacteria 2615
95 Ga0075369_10459019 3300006186 Bacteria 604
96 Ga0075370_10002602 3300006353 Bacteria 8414
97 Ga0075370_10041898 3300006353 Bacteria 2585
98 Ga0075370_10084349 3300006353 Bacteria 1828
99 Ga0075370_10234379 3300006353 Bacteria 1086
100 Ga0075370_10810610 3300006353 Bacteria 571
101 Ga0075370_10955046 3300006353 Bacteria 525
102 Ga0075430_100157379 3300006846 Bacteria 1891
103 Ga0075431_100346178 3300006847 Unclassified 1495
104 Ga0068865_100437597 3300006881 Bacteria 1078
105 Ga0097620_100002157 3300006931 Bacteria 19997
106 Ga0097620_100134005 3300006931 Bacteria 2549
107 Ga0097620_100655031 3300006931 Bacteria 1142
108 Ga0105250_10023152 3300009092 Bacteria 2503
109 Ga0105245_10023963 3300009098 Bacteria 5356
110 Ga0105247_10000078 3300009101 Bacteria 110404
111 Ga0105247_10054573 3300009101 Bacteria 2465
112 Ga0105247_10662511 3300009101 Bacteria 781
113 Ga0114129_12138152 3300009147 Bacteria 674
114 Ga0105243_10494598 3300009148 Bacteria 1157
115 Ga0105243_10873400 3300009148 Bacteria 892
116 Ga0105241_10335120 3300009174 Bacteria 1309
117 Ga0105242_11109901 3300009176 Bacteria 805
118 Ga0105248_10000082 3300009177 Bacteria 110759
119 Ga0105237_10556935 3300009545 Bacteria 1153
120 Ga0105238_10505882 3300009551 Bacteria 1209
121 Ga0105249_10000031 3300009553 Bacteria 220006
122 Ga0105249_10211613 3300009553 Bacteria 1903
123 Ga0105239_10469459 3300010375 Bacteria 1429
124 Ga0105246_11587887 3300011119 Bacteria 618
125 Ga0154016_117972 3300013045 Bacteria 611
126 Ga0157370_10012058 3300013104 Bacteria 8997
127 Ga0157369_10136419 3300013105 Bacteria 2598
128 Ga0157374_10362616 3300013296 Bacteria 1441
129 Ga0163162_10083827 3300013306 Bacteria 3262
130 Ga0163162_10322077 3300013306 Bacteria 1678
131 Ga0163163_10101717 3300014325 Bacteria 2896
132 Ga0163163_10258063 3300014325 Bacteria 1794
133 Ga0163163_10345754 3300014325 Bacteria 1543
134 Ga0163163_10704608 3300014325 Bacteria 1073
135 Ga0157377_10004390 3300014745 Bacteria 6485
136 Ga0157379_10831532 3300014968 Bacteria 873
137 Ga0157376_10614252 3300014969 Bacteria 1083
138 Ga0163161_10212209 3300017792 Bacteria 1496
139 Ga0163161_10320255 3300017792 Bacteria 1226
140 Ga0206351_10450832 3300020077 Bacteria 561
141 Ga0206352_10115031 3300020078 Bacteria 887
142 Ga0206350_11506064 3300020080 Bacteria 567
143 Ga0206354_10468746 3300020081 Bacteria 1891
144 Ga0206353_10459947 3300020082 Bacteria 1303
145 Ga0206353_11378328 3300020082 Bacteria 3338
146 Ga0224712_10005782 3300022467 Bacteria 3478
147 Ga0224712_10039522 3300022467 Bacteria 1769
148 Ga0224712_10135047 3300022467 Bacteria 1081
149 Ga0224712_10414873 3300022467 Bacteria 643
150 Ga0209051_1000539 3300025303 Bacteria 46616
151 Ga0209051_1001750 3300025303 Bacteria 17288
152 Ga0209051_1011001 3300025303 Bacteria 4511
153 Ga0207696_1128214 3300025711 Bacteria 682
154 Ga0207642_10109497 3300025899 Bacteria 1404
155 Ga0207710_10000022 3300025900 Bacteria 335632
156 Ga0207710_10031558 3300025900 Bacteria 2317
157 Ga0207688_10002740 3300025901 Bacteria 9536
158 Ga0207699_10262205 3300025906 Bacteria 1195
159 Ga0207645_10070557 3300025907 Bacteria 2235
160 Ga0207643_10224220 3300025908 Bacteria 1151
161 Ga0207643_10249483 3300025908 Bacteria 1093
162 Ga0207671_10752427 3300025914 Bacteria 774
163 Ga0207693_10003074 3300025915 Bacteria 14395
164 Ga0207657_10264171 3300025919 Bacteria 1369
165 Ga0207681_10010273 3300025923 Bacteria 5729
166 Ga0207681_10388344 3300025923 Bacteria 1125
167 Ga0207650_10473417 3300025925 Bacteria 1044
168 Ga0207659_10154362 3300025926 Bacteria 1796
169 Ga0207687_10095648 3300025927 Bacteria 2176
170 Ga0207644_10044973 3300025931 Bacteria 3139
171 Ga0207644_10231296 3300025931 Bacteria 1469
172 Ga0207644_10318715 3300025931 Bacteria 1257
173 Ga0207690_10150669 3300025932 Bacteria 1724
174 Ga0207706_10177122 3300025933 Bacteria 1873
175 Ga0207686_10489451 3300025934 Bacteria 952
176 Ga0207709_10475225 3300025935 Bacteria 971
177 Ga0207670_10272230 3300025936 Bacteria 1317
178 Ga0207669_10027609 3300025937 Bacteria 3111
179 Ga0207665_10024671 3300025939 Bacteria 3965
180 Ga0207691_10230607 3300025940 Bacteria 1604
181 Ga0207711_10000114 3300025941 Bacteria 84146
182 Ga0207711_10427324 3300025941 Bacteria 1232
183 Ga0207651_10025787 3300025960 Bacteria 3660
184 Ga0207712_10000029 3300025961 Bacteria 220014
185 Ga0207712_10023352 3300025961 Bacteria 4080
186 Ga0207668_10037318 3300025972 Bacteria 3251
187 Ga0207640_10085212 3300025981 Bacteria 2172
188 Ga0207658_10000241 3300025986 Bacteria 57251
189 Ga0207658_10028369 3300025986 Bacteria 3942
190 Ga0207658_10077864 3300025986 Bacteria 2531
191 Ga0207703_10027825 3300026035 Bacteria 4453
192 Ga0207703_10325975 3300026035 Bacteria 1408
193 Ga0207678_10007580 3300026067 Bacteria 9592
194 Ga0207678_10259380 3300026067 Bacteria 1490
195 Ga0207708_10005315 3300026075 Bacteria 9485
196 Ga0207702_10245535 3300026078 Bacteria 1679
197 Ga0207641_10004579 3300026088 Bacteria 11949
198 Ga0207648_10017103 3300026089 Bacteria 6609
199 Ga0207676_10218147 3300026095 Bacteria 1697
200 Ga0207676_10528162 3300026095 Bacteria 1124
201 Ga0207676_12332882 3300026095 Bacteria 532
202 Ga0207674_10305317 3300026116 Bacteria 1540
203 Ga0207675_100089165 3300026118 Bacteria 2898
204 Ga0207675_100473073 3300026118 Bacteria 1244
205 Ga0207683_10082194 3300026121 Bacteria 2861
206 Ga0207698_10456426 3300026142 Bacteria 1235
207 Ga0207428_10298121 3300027907 Bacteria 1193
208 Ga0268266_10018188 3300028379 Bacteria 5993
209 Ga0268266_10021626 3300028379 Bacteria 5480
210 Ga0268265_10000040 3300028380 Bacteria 194156
211 Ga0268265_10239063 3300028380 Bacteria 1601
212 Ga0268265_11336461 3300028380 Bacteria 717
213 Ga0268264_10000017 3300028381 Bacteria 498037
214 Ga0268264_10114297 3300028381 Bacteria 2369
215 Ga0265763_1010273 3300030763 Unclassified 863
216 Ga0316575_10002307 3300031665 Bacteria 6390
217 Ga0316576_10003593 3300031727 Bacteria 9141
218 Ga0316578_10059209 3300031728 Bacteria 2252
219 Ga0316577_10040227 3300031733 Bacteria 2614
220 Ga0307410_11669184 3300031852 Bacteria 564
221 Ga0307409_101001832 3300031995 Bacteria 853
222 Ga0307416_101180208 3300032002 Bacteria 871
223 Ga0307415_102559107 3300032126 Bacteria 503
224 Ga0316583_10052834 3300032133 Bacteria 1429
225 Ga0316585_10004296 3300032137 Bacteria 3958
226 Ga0316580_10003608 3300032139 Bacteria 4412
227 Ga0316593_10063841 3300032168 Bacteria 1263
228 Ga0316592_1032386 3300033524 Bacteria 1141
229 Ga0316586_1059044 3300033527 Bacteria 695
230 Ga0316588_1070288 3300033528 Bacteria 859
231 Ga0316587_1031698 3300033529 Bacteria 935
232 Ga0316596_1040173 3300033541 Bacteria 1228
233 Ga0373929_0238107 3300035085 Bacteria 524
234 Ga0373946_0271479 3300035171 Bacteria 832
235 Ga0316574_0052488 3300035398 Bacteria 2542
236 Ga0265778_016077 3300036457 Bacteria 895
237 Ga0265778_018088 3300036457 Bacteria 854
238 Ga0265778_047768 3300036457 Unclassified 581
239 Ga0316582_0309120 3300036647 Bacteria 1086
240 Ga0316581_0005393 3300037588 Bacteria 3327
241 Ga0451789_0975287 3300041443 Bacteria 1338
242 Ga0451797_0189020 3300041453 Bacteria 777
243 Ga0451795_0342559 3300041456 Bacteria 989
244 Ga0451802_1724703 3300041460 Bacteria 593
245 Ga0451806_190840 3300041462 Bacteria 683
246 Ga0451807_0761182 3300041486 Bacteria 560
247 Ga0451833_0290044 3300041491 Bacteria 4509
248 Ga0451837_1388856 3300041494 Bacteria 2196
249 Ga0451841_0222569 3300041498 Bacteria 815
250 Ga0451841_1085098 3300041498 Bacteria 754
251 Ga0451851_1116187 3300041507 Bacteria 584
252 Ga0450918_089338 3300042531 Bacteria 594
253 Ga0466978_0572408 3300044671 Bacteria 563
254 Ga0466966_0596946 3300044684 Bacteria 665
255 Ga0466961_0005410 3300044693 Bacteria 8042
256 Ga0466961_0058073 3300044693 Bacteria 2462
257 Ga0466961_0069575 3300044693 Bacteria 2234
258 Ga0466961_0076992 3300044693 Bacteria 2113
259 Ga0466961_0424497 3300044693 Bacteria 806
260 Ga0466963_0002819 3300044694 Bacteria 9801
261 Ga0466963_0032326 3300044694 Bacteria 3388
262 Ga0466963_0050546 3300044694 Bacteria 2751
263 Ga0466963_0086474 3300044694 Bacteria 2130
264 Ga0466963_0248755 3300044694 Bacteria 1247
265 Ga0466971_0085615 3300044719 Bacteria 1440
266 Ga0466968_0680252 3300044735 Bacteria 524
267 Ga0466970_0000040 3300044765 Bacteria 47078
268 Ga0466970_0035134 3300044765 Bacteria 2656
269 Ga0466957_0011483 3300044842 Bacteria 5112
270 Ga0466957_0241995 3300044842 Bacteria 1197
271 Ga0466957_0381780 3300044842 Bacteria 961
272 Ga0466957_1105969 3300044842 Bacteria 571
273 Ga0466960_0121440 3300044901 Archaea 1369
274 Ga0466960_0768966 3300044901 Bacteria 581
275 Ga0466959_0010028 3300045049 Bacteria 6751
276 Ga0466959_0111458 3300045049 Bacteria 1952
277 Ga0466959_0664403 3300045049 Bacteria 699
278 Ga0466958_0041745 3300045836 Bacteria 2760
279 Ga0466958_0393072 3300045836 Bacteria 895
280 Ga0466967_0003454 3300045976 Bacteria 10314
281 Ga0466967_0021986 3300045976 Bacteria 5194
282 Ga0466967_0032137 3300045976 Bacteria 4428
283 Ga0466967_0558048 3300045976 Bacteria 1128
284 Ga0466967_0877388 3300045976 Bacteria 892
285 Ga0495638_0000438 3300046460 Bacteria 50230
286 Ga0495668_0015124 3300046616 Bacteria 4512
287 Ga0495668_0206029 3300046616 Bacteria 1077
288 Ga0495624_0078513 3300046690 Bacteria 2047
289 Ga0495649_0179516 3300046694 Bacteria 1105
290 Ga0495649_0452825 3300046694 Bacteria 641
291 Ga0496100_0003144 3300048903 Bacteria 8556
292 Ga0496100_0085914 3300048903 Bacteria 2136
293 Ga0496100_0541457 3300048903 Bacteria 900
294 Ga0496101_0009787 3300048904 Bacteria 6314
295 Ga0496101_0018400 3300048904 Bacteria 4751
296 Ga0496101_0278088 3300048904 Bacteria 1308
297 Ga0496102_0005948 3300048905 Bacteria 10388
298 Ga0496102_0086671 3300048905 Bacteria 2892
299 Ga0496102_0239418 3300048905 Bacteria 1711
300 Ga0496102_0263767 3300048905 Bacteria 1624
301 Ga0496103_0000516 3300048906 Bacteria 31806
302 Ga0496103_0092492 3300048906 Bacteria 1909
303 Ga0496103_0106786 3300048906 Bacteria 1776
304 Ga0496103_0484751 3300048906 Bacteria 792
305 Ga0496105_0009311 3300048908 Bacteria 7675
306 Ga0496105_0115405 3300048908 Bacteria 2215
307 Ga0496106_0036507 3300048909 Bacteria 3676
308 Ga0496107_0031012 3300048910 Bacteria 3811
309 Ga0496107_0049845 3300048910 Bacteria 3018
310 Ga0496108_0001619 3300048911 Bacteria 17843
311 Ga0496108_0024646 3300048911 Bacteria 4955
312 Ga0496108_0902834 3300048911 Bacteria 758
313 Ga0496109_0922016 3300048912 Bacteria 811
314 Ga0496110_0013321 3300048913 Bacteria 6795
315 Ga0496110_0058207 3300048913 Bacteria 3404
316 Ga0496111_0105799 3300048914 Bacteria 2071
317 Ga0496111_0255334 3300048914 Bacteria 1301
318 Ga0496112_0032898 3300048915 Bacteria 5036
319 Ga0496112_0075403 3300048915 Bacteria 3336
320 Ga0496112_0171861 3300048915 Bacteria 2132
321 Ga0496113_0030229 3300048916 Bacteria 3920
322 Ga0496113_0160263 3300048916 Bacteria 1778
323 Ga0496114_0001589 3300048917 Bacteria 17229
324 Ga0496114_1610107 3300048917 Bacteria 537
325 Ga0496115_0032228 3300048918 Bacteria 4134
326 Ga0496115_1237765 3300048918 Bacteria 559
327 Ga0496116_0004050 3300048919 Bacteria 14170
328 Ga0496117_0001901 3300048920 Bacteria 28039
329 Ga0496118_0000448 3300048921 Bacteria 68329
330 Ga0496118_0389258 3300048921 Bacteria 728
331 Ga0496119_0002201 3300048922 Bacteria 21788
332 Ga0496121_0000015 3300048924 Bacteria 571958
333 Ga0496121_0012681 3300048924 Bacteria 9146
334 Ga0496122_0060067 3300048925 Bacteria 2802
335 Ga0496123_0000815 3300048926 Bacteria 50251
336 Ga0496124_0661326 3300048927 Bacteria 669
337 Ga0496125_0019070 3300048928 Bacteria 6488
338 Ga0496126_0002790 3300048929 Bacteria 22991
339 Ga0496126_0014962 3300048929 Bacteria 7821
340 Ga0501032_0004017 3300049569 Bacteria 11151
341 Ga0501034_0255999 3300049571 Bacteria 1694
342 Ga0501034_0767222 3300049571 Bacteria 859
343 Ga0501034_1654185 3300049571 Bacteria 513
344 Ga0501037_0359354 3300049573 Bacteria 1003
345 Ga0501038_0001921 3300049574 Bacteria 19179
346 Ga0501038_1138111 3300049574 Bacteria 569
347 Ga0501043_0027406 3300049579 Bacteria 4473
348 Ga0501046_0070477 3300049580 Bacteria 2718
349 Ga0501047_0021131 3300049581 Bacteria 6250
350 Ga0501047_1053789 3300049581 Bacteria 626
351 Ga0501048_0001498 3300049582 Bacteria 17679
352 Ga0501070_0017844 3300049586 Bacteria 5959
353 Ga0501070_0126280 3300049586 Bacteria 2114
354 Ga0501080_1220372 3300049742 Bacteria 646
355 Ga0501080_1280083 3300049742 Bacteria 628
356 Ga0501080_1418865 3300049742 Bacteria 592
357 Ga0501035_0072163 3300049822 Bacteria 3056
358 Ga0501035_0429916 3300049822 Bacteria 1095
359 Ga0501044_0065747 3300049823 Bacteria 3698
360 nmdc:mga03n38_10040_c1 3300050490 Bacteria 3468
361 nmdc:mga03n38_805447_c1 3300050490 Bacteria 547
362 nmdc:mga00v17_138886_c1 3300050491 Bacteria 1557
363 nmdc:mga00v17_197692_c1 3300050491 Bacteria 1299
364 nmdc:mga00v17_595140_c1 3300050491 Bacteria 713
365 nmdc:mga0yw44_189852_c1 3300050492 Bacteria 1355
366 nmdc:mga07m45_16787_c1 3300050496 Bacteria 3922
367 nmdc:mga07m45_332983_c1 3300050496 Bacteria 882
368 nmdc:mga07m45_83450_c1 3300050496 Bacteria 1826
369 nmdc:mga0sz30_140928_c1 3300050516 Bacteria 1064
370 nmdc:mga0sz30_163944_c1 3300050516 Bacteria 985
371 Ga0495655_0270841 3300053083 Bacteria 576
372 Ga0500556_0012851 3300053104 Bacteria 2514
373 Ga0500568_0074462 3300053139 Bacteria 1296
374 Ga0500577_0068353 3300053142 Bacteria 1387
375 Ga0587084_126714 3300059477 Bacteria 542
376 Ga0587111_0100232 3300060346 Bacteria 720
377 Ga0466962_0402710 3300061719 Bacteria 685
378 2566991527 2565956761 Bacteria 6601618
379 2566996999 2565956761 Bacteria 6601618
380 2644486843 2643221687 Bacteria 6500351
381 2739207294 2738543005 Bacteria 5278128
382 2744954392 2744054611 Bacteria 5611514
383 2753036220 2751185725 Bacteria 5740550
384 2753324092 2751185792 Bacteria 5739090
385 2904536593 2904535858 Bacteria 6308016
386 2904541051 2904535858 Bacteria 6308016
387 2922556451 2922554459 Bacteria 6683962
388 2922560693 2922554459 Bacteria 6683962
389 2939584911 2939582691 Bacteria 7088898
390 Ga0436365_0765398
391 JGI24746J21847_1000914
392 JGI24750J21931_1010133
393 JGI24745J21846_1010000
394 JGI24744J21845_10004278
395 Ga0006778J45830_1028044
396 Ga0006759J45824_1013866
397 Ga0007417J51691_1011318
398 Ga0007427J51700_122532
399 Ga0007409J51694_1063738
400 Ga0006562J51391_1006372
401 Ga0007429J51699_1045791
402 Ga0007415J51800_113150
403 Ga0055540_1003186
404 Ga0055540_1007662
405 Ga0055540_1010407
406 Ga0070682_100499888
407 Ga0070660_100623100
408 Ga0070689_100111822
409 Ga0070691_10119024
410 Ga0070692_10154877
411 Ga0070668_100029111
412 Ga0070668_101330125
413 Ga0070669_100000837
414 Ga0070675_100826666
415 Ga0070671_100003340
416 Ga0070674_100043754
417 Ga0070673_100153430
418 Ga0070659_100308224
419 Ga0070667_100000333
420 Ga0070667_100031883
421 Ga0070667_100264298
422 Ga0070667_100902633
423 Ga0070701_10313258
424 Ga0070705_100363428
425 Ga0070700_100043229
426 Ga0070694_100139535
427 Ga0070663_100224175
428 Ga0070663_100332104
429 Ga0070678_100136334
430 Ga0070662_100394223
431 Ga0070685_10147309
432 Ga0070672_100417706
433 Ga0070686_100599723
434 Ga0070695_100191453
435 Ga0070696_100125371
436 Ga0070693_100599977
437 Ga0070665_100010056
438 Ga0070665_100018847
439 Ga0070665_100025254
440 Ga0070704_100097577
441 Ga0068855_100798662
442 Ga0068854_100066772
443 Ga0068859_100002157
444 Ga0068859_100133998
445 Ga0068859_100655124
446 Ga0068864_100015106
447 Ga0068864_100465907
448 Ga0068864_102551331
449 Ga0068866_10079435
450 Ga0068866_10144856
451 Ga0068861_100074755
452 Ga0068861_101218763
453 Ga0068851_10035917
454 Ga0068870_10512094
455 Ga0068863_100007024
456 Ga0068863_100181002
457 Ga0068858_100009502
458 Ga0068858_100038984
459 Ga0068858_100260694
460 Ga0068860_100000160
461 Ga0068862_100000131
462 Ga0068862_100238301
463 Ga0068862_100897037
464 Ga0068862_101125242
465 Ga0081455_10180236
466 Ga0081455_10413229
467 Ga0081538_10323084
468 Ga0075365_10101887
469 Ga0075365_10233352
470 Ga0075363_100315606
471 Ga0075364_10001722
472 Ga0075364_10065944
473 Ga0075364_10139216
474 Ga0075364_10231197
475 Ga0070715_10103550
476 Ga0070715_10699095
477 Ga0070716_100300986
478 Ga0070712_100695546
479 Ga0075362_10216301
480 Ga0075367_10367240
481 Ga0075367_10474735
482 Ga0075369_10015267
483 Ga0075369_10022213
484 Ga0075369_10459019
485 Ga0075370_10002602
486 Ga0075370_10041898
487 Ga0075370_10084349
488 Ga0075370_10234379
489 Ga0075370_10810610
490 Ga0075370_10955046
491 Ga0075430_100157379
492 Ga0075431_100346178
493 Ga0068865_100437597
494 Ga0097620_100002157
495 Ga0097620_100134005
496 Ga0097620_100655031
497 Ga0105250_10023152
498 Ga0105245_10023963
499 Ga0105247_10000078
500 Ga0105247_10054573
501 Ga0105247_10662511
502 Ga0114129_12138152
503 Ga0105243_10494598
504 Ga0105243_10873400
505 Ga0105241_10335120
506 Ga0105242_11109901
507 Ga0105248_10000082
508 Ga0105237_10556935
509 Ga0105238_10505882
510 Ga0105249_10000031
511 Ga0105249_10211613
512 Ga0105239_10469459
513 Ga0105246_11587887
514 Ga0154016_117972
515 Ga0157370_10012058
516 Ga0157369_10136419
517 Ga0157374_10362616
518 Ga0163162_10083827
519 Ga0163162_10322077
520 Ga0163163_10101717
521 Ga0163163_10258063
522 Ga0163163_10345754
523 Ga0163163_10704608
524 Ga0157377_10004390
525 Ga0157379_10831532
526 Ga0157376_10614252
527 Ga0163161_10212209
528 Ga0163161_10320255
529 Ga0206351_10450832
530 Ga0206352_10115031
531 Ga0206350_11506064
532 Ga0206354_10468746
533 Ga0206353_10459947
534 Ga0206353_11378328
535 Ga0224712_10005782
536 Ga0224712_10039522
537 Ga0224712_10135047
538 Ga0224712_10414873
539 Ga0209051_1000539
540 Ga0209051_1001750
541 Ga0209051_1011001
542 Ga0207696_1128214
543 Ga0207642_10109497
544 Ga0207710_10000022
545 Ga0207710_10031558
546 Ga0207688_10002740
547 Ga0207699_10262205
548 Ga0207645_10070557
549 Ga0207643_10224220
550 Ga0207643_10249483
551 Ga0207671_10752427
552 Ga0207693_10003074
553 Ga0207657_10264171
554 Ga0207681_10010273
555 Ga0207681_10388344
556 Ga0207650_10473417
557 Ga0207659_10154362
558 Ga0207687_10095648
559 Ga0207644_10044973
560 Ga0207644_10231296
561 Ga0207644_10318715
562 Ga0207690_10150669
563 Ga0207706_10177122
564 Ga0207686_10489451
565 Ga0207709_10475225
566 Ga0207670_10272230
567 Ga0207669_10027609
568 Ga0207665_10024671
569 Ga0207691_10230607
570 Ga0207711_10000114
571 Ga0207711_10427324
572 Ga0207651_10025787
573 Ga0207712_10000029
574 Ga0207712_10023352
575 Ga0207668_10037318
576 Ga0207640_10085212
577 Ga0207658_10000241
578 Ga0207658_10028369
579 Ga0207658_10077864
580 Ga0207703_10027825
581 Ga0207703_10325975
582 Ga0207678_10007580
583 Ga0207678_10259380
584 Ga0207708_10005315
585 Ga0207702_10245535
586 Ga0207641_10004579
587 Ga0207648_10017103
588 Ga0207676_10218147
589 Ga0207676_10528162
590 Ga0207676_12332882
591 Ga0207674_10305317
592 Ga0207675_100089165
593 Ga0207675_100473073
594 Ga0207683_10082194
595 Ga0207698_10456426
596 Ga0207428_10298121
597 Ga0268266_10018188
598 Ga0268266_10021626
599 Ga0268265_10000040
600 Ga0268265_10239063
601 Ga0268265_11336461
602 Ga0268264_10000017
603 Ga0268264_10114297
604 Ga0265763_1010273
605 Ga0316575_10002307
606 Ga0316576_10003593
607 Ga0316578_10059209
608 Ga0316577_10040227
609 Ga0307410_11669184
610 Ga0307409_101001832
611 Ga0307416_101180208
612 Ga0307415_102559107
613 Ga0316583_10052834
614 Ga0316585_10004296
615 Ga0316580_10003608
616 Ga0316593_10063841
617 Ga0316592_1032386
618 Ga0316586_1059044
619 Ga0316588_1070288
620 Ga0316587_1031698
621 Ga0316596_1040173
622 Ga0373929_0238107
623 Ga0373946_0271479
624 Ga0316574_0052488
625 Ga0265778_016077
626 Ga0265778_018088
627 Ga0265778_047768
628 Ga0316582_0309120
629 Ga0316581_0005393
630 Ga0451789_0975287
631 Ga0451797_0189020
632 Ga0451795_0342559
633 Ga0451802_1724703
634 Ga0451806_190840
635 Ga0451807_0761182
636 Ga0451833_0290044
637 Ga0451837_1388856
638 Ga0451841_0222569
639 Ga0451841_1085098
640 Ga0451851_1116187
641 Ga0450918_089338
642 Ga0466978_0572408
643 Ga0466966_0596946
644 Ga0466961_0005410
645 Ga0466961_0058073
646 Ga0466961_0069575
647 Ga0466961_0076992
648 Ga0466961_0424497
649 Ga0466963_0002819
650 Ga0466963_0032326
651 Ga0466963_0050546
652 Ga0466963_0086474
653 Ga0466963_0248755
654 Ga0466971_0085615
655 Ga0466968_0680252
656 Ga0466970_0000040
657 Ga0466970_0035134
658 Ga0466957_0011483
659 Ga0466957_0241995
660 Ga0466957_0381780
661 Ga0466957_1105969
662 Ga0466960_0121440
663 Ga0466960_0768966
664 Ga0466959_0010028
665 Ga0466959_0111458
666 Ga0466959_0664403
667 Ga0466958_0041745
668 Ga0466958_0393072
669 Ga0466967_0003454
670 Ga0466967_0021986
671 Ga0466967_0032137
672 Ga0466967_0558048
673 Ga0466967_0877388
674 Ga0495638_0000438
675 Ga0495668_0015124
676 Ga0495668_0206029
677 Ga0495624_0078513
678 Ga0495649_0179516
679 Ga0495649_0452825
680 Ga0496100_0003144
681 Ga0496100_0085914
682 Ga0496100_0541457
683 Ga0496101_0009787
684 Ga0496101_0018400
685 Ga0496101_0278088
686 Ga0496102_0005948
687 Ga0496102_0086671
688 Ga0496102_0239418
689 Ga0496102_0263767
690 Ga0496103_0000516
691 Ga0496103_0092492
692 Ga0496103_0106786
693 Ga0496103_0484751
694 Ga0496105_0009311
695 Ga0496105_0115405
696 Ga0496106_0036507
697 Ga0496107_0031012
698 Ga0496107_0049845
699 Ga0496108_0001619
700 Ga0496108_0024646
701 Ga0496108_0902834
702 Ga0496109_0922016
703 Ga0496110_0013321
704 Ga0496110_0058207
705 Ga0496111_0105799
706 Ga0496111_0255334
707 Ga0496112_0032898
708 Ga0496112_0075403
709 Ga0496112_0171861
710 Ga0496113_0030229
711 Ga0496113_0160263
712 Ga0496114_0001589
713 Ga0496114_1610107
714 Ga0496115_0032228
715 Ga0496115_1237765
716 Ga0496116_0004050
717 Ga0496117_0001901
718 Ga0496118_0000448
719 Ga0496118_0389258
720 Ga0496119_0002201
721 Ga0496121_0000015
722 Ga0496121_0012681
723 Ga0496122_0060067
724 Ga0496123_0000815
725 Ga0496124_0661326
726 Ga0496125_0019070
727 Ga0496126_0002790
728 Ga0496126_0014962
729 Ga0501032_0004017
730 Ga0501034_0255999
731 Ga0501034_0767222
732 Ga0501034_1654185
733 Ga0501037_0359354
734 Ga0501038_0001921
735 Ga0501038_1138111
736 Ga0501043_0027406
737 Ga0501046_0070477
738 Ga0501047_0021131
739 Ga0501047_1053789
740 Ga0501048_0001498
741 Ga0501070_0017844
742 Ga0501070_0126280
743 Ga0501080_1220372
744 Ga0501080_1280083
745 Ga0501080_1418865
746 Ga0501035_0072163
747 Ga0501035_0429916
748 Ga0501044_0065747
749 nmdc:mga03n38_10040_c1
750 nmdc:mga03n38_805447_c1
751 nmdc:mga00v17_138886_c1
752 nmdc:mga00v17_197692_c1
753 nmdc:mga00v17_595140_c1
754 nmdc:mga0yw44_189852_c1
755 nmdc:mga07m45_16787_c1
756 nmdc:mga07m45_332983_c1
757 nmdc:mga07m45_83450_c1
758 nmdc:mga0sz30_140928_c1
759 nmdc:mga0sz30_163944_c1
760 Ga0495655_0270841
761 Ga0500556_0012851
762 Ga0500568_0074462
763 Ga0500577_0068353
764 Ga0587084_126714
765 Ga0587111_0100232
766 Ga0466962_0402710
767 2566991527
768 2566996999
769 2644486843
770 2739207294
771 2744954392
772 2753036220
773 2753324092
774 2904536593
775 2904541051
776 2922556451
777 2922560693
778 2939584911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

39

120

0.97

PF00011

HSP20

Hsp20/alpha crystallin family

34

134

0.93

Map