F431494

General Info

Members Datasets Scaffolds Average Seq Length
389 236 778 341

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0046511|Ga0395900_0046511_2883_3983
Length 366
Sequence VKNRLPVVLIHPLALNGLMKALYKSGPQPGFELVERPEPKPGPADVKIQVLATGICGTDLHIQSWDATAQSMMAVPLIPGHEFYGEVVEVGDEVRDVRPGDRVSGEGHIVCGICRNCRAGRRQMCIHVQSVGVQRDGAFAEFVVIPETNVWVHHDPSITPELGAIFDPFGNATHTALSFPLVGEDVLITGAGPIGLMAISVARHAGARKIAITDVSQRRLELARKMGADLAVDVSAMTVAEAQRELGLVEGFDVGFEMSGRPAALQGMIENMNHGGRIALLGLPAQAAEIDWEKVVTHMLTLKGIYGREMFETWYAMSAMLSSNSVLRRNVAAVVTDVLPAALWEEGFAVARSGSGGKVVLDWSGI

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
94 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
103 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
104 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
105 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
106 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
112 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
113 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
114 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
115 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
116 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
117 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
203 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
204 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
205 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
206 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
207 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
208 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
209 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
210 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
211 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
212 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
213 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
214 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
215 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
216 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
217 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
218 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
219 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
220 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
221 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
222 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
223 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
224 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
225 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
226 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
227 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
228 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
229 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
230 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
231 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
232 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
233 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
234 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
235 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
236 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.46
Metatranscriptomes 0.77
Isolates 9.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 9.77
Rhizosphere 85.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0046511 3300037418 Bacteria 4468
2 Ga0070658_10065333 3300005327 Bacteria 2969
3 Ga0070658_10170526 3300005327 Bacteria 1828
4 Ga0070690_100022733 3300005330 Bacteria 3839
5 Ga0070666_10003076 3300005335 Bacteria 10126
6 Ga0068868_100148027 3300005338 Bacteria 1932
7 Ga0070668_100005507 3300005347 Bacteria 9388
8 Ga0070675_100007446 3300005354 Bacteria 8455
9 Ga0070674_100067216 3300005356 Bacteria 2520
10 Ga0070674_100163020 3300005356 Bacteria 1693
11 Ga0070714_100000056 3300005435 Bacteria 103178
12 Ga0070694_100302205 3300005444 Bacteria 1226
13 Ga0070708_100171286 3300005445 Bacteria 2027
14 Ga0070707_100032053 3300005468 Bacteria 5006
15 Ga0070698_100082826 3300005471 Bacteria 3199
16 Ga0070698_100311291 3300005471 Bacteria 1505
17 Ga0070679_100155746 3300005530 Bacteria 2260
18 Ga0070697_100009549 3300005536 Bacteria 7575
19 Ga0070697_100296805 3300005536 Bacteria 1389
20 Ga0070696_100087390 3300005546 Bacteria 2214
21 Ga0070693_100056747 3300005547 Bacteria 2261
22 Ga0070665_100000757 3300005548 Bacteria 42748
23 Ga0068854_100160690 3300005578 Bacteria 1740
24 Ga0068856_100344293 3300005614 Bacteria 1509
25 Ga0068864_100137803 3300005618 Bacteria 2199
26 Ga0068863_100000677 3300005841 Bacteria 34450
27 Ga0068858_100012386 3300005842 Bacteria 8041
28 Ga0068860_100000214 3300005843 Bacteria 90752
29 Ga0081455_10074361 3300005937 Bacteria 2807
30 Ga0081538_10124172 3300005981 Bacteria 1232
31 Ga0075432_10005557 3300006058 Bacteria 4293
32 Ga0075432_10028115 3300006058 Bacteria 1939
33 Ga0075433_10122015 3300006852 Bacteria 2314
34 Ga0075434_100088520 3300006871 Bacteria 3097
35 Ga0075435_100238849 3300007076 Bacteria 1545
36 Ga0105244_10005361 3300009036 Bacteria 8534
37 Ga0105240_10508462 3300009093 Bacteria 1339
38 Ga0105245_10000874 3300009098 Bacteria 27313
39 Ga0105245_10010619 3300009098 Bacteria 8012
40 Ga0105245_10166188 3300009098 Bacteria 2098
41 Ga0105243_10077149 3300009148 Bacteria 2709
42 Ga0105243_10304121 3300009148 Bacteria 1447
43 Ga0105243_10369754 3300009148 Bacteria 1322
44 Ga0105238_10047989 3300009551 Bacteria 4304
45 Ga0105249_10125107 3300009553 Bacteria 2447
46 Ga0105239_10141213 3300010375 Bacteria 2684
47 Ga0105246_10275905 3300011119 Bacteria 1346
48 Ga0157373_10036695 3300013100 Bacteria 3516
49 Ga0157370_10066266 3300013104 Bacteria 3415
50 Ga0157369_10056866 3300013105 Bacteria 4221
51 Ga0157374_10363282 3300013296 Bacteria 1440
52 Ga0157374_10469968 3300013296 Bacteria 1260
53 Ga0163162_10125822 3300013306 Bacteria 2669
54 Ga0163162_10507786 3300013306 Bacteria 1336
55 Ga0157372_10000044 3300013307 Bacteria 152637
56 Ga0157375_10034979 3300013308 Bacteria 4791
57 Ga0163163_10014831 3300014325 Bacteria 7177
58 Ga0157380_10247393 3300014326 Bacteria 1612
59 Ga0157377_10062322 3300014745 Bacteria 2134
60 Ga0157379_10008079 3300014968 Bacteria 9141
61 Ga0197907_10989712 3300020069 Bacteria 2692
62 Ga0206353_11051388 3300020082 Bacteria 1480
63 Ga0206353_11283943 3300020082 Bacteria 2039
64 Ga0209129_1000079 3300025258 Bacteria 187308
65 Ga0209025_1002178 3300025294 Bacteria 21751
66 Ga0209051_1002224 3300025303 Bacteria 14318
67 Ga0207697_10014121 3300025315 Bacteria 3320
68 Ga0207655_1013544 3300025728 Bacteria 4675
69 Ga0207713_1085892 3300025735 Bacteria 1119
70 Ga0207688_10153060 3300025901 Bacteria 1363
71 Ga0207680_10051715 3300025903 Bacteria 2458
72 Ga0207645_10020846 3300025907 Bacteria 4282
73 Ga0207705_10023387 3300025909 Bacteria 4409
74 Ga0207684_10103720 3300025910 Bacteria 2432
75 Ga0207652_10023373 3300025921 Bacteria 5120
76 Ga0207646_10130948 3300025922 Bacteria 2257
77 Ga0207681_10141694 3300025923 Bacteria 1791
78 Ga0207694_10193047 3300025924 Bacteria 1655
79 Ga0207659_10246159 3300025926 Bacteria 1449
80 Ga0207687_10062343 3300025927 Bacteria 2636
81 Ga0207687_10102982 3300025927 Bacteria 2104
82 Ga0207687_10223248 3300025927 Bacteria 1485
83 Ga0207664_10000074 3300025929 Bacteria 102862
84 Ga0207706_10210545 3300025933 Bacteria 1704
85 Ga0207709_10186836 3300025935 Bacteria 1468
86 Ga0207691_10005146 3300025940 Bacteria 12627
87 Ga0207679_10104122 3300025945 Bacteria 2226
88 Ga0207712_10200869 3300025961 Bacteria 1581
89 Ga0207703_10033295 3300026035 Bacteria 4084
90 Ga0207708_10249172 3300026075 Bacteria 1431
91 Ga0207641_10003001 3300026088 Bacteria 15240
92 Ga0207675_100087362 3300026118 Bacteria 2928
93 Ga0207428_10037527 3300027907 Bacteria 3942
94 Ga0207428_10124665 3300027907 Bacteria 1973
95 Ga0268266_10024367 3300028379 Bacteria 5146
96 Ga0268264_10000027 3300028381 Bacteria 440852
97 Ga0307408_100013119 3300031548 Bacteria 5501
98 Ga0307408_100030184 3300031548 Bacteria 3763
99 Ga0307408_100030285 3300031548 Bacteria 3756
100 Ga0307408_100034587 3300031548 Bacteria 3540
101 Ga0307408_100045324 3300031548 Bacteria 3140
102 Ga0307408_100062176 3300031548 Bacteria 2728
103 Ga0307408_100067472 3300031548 Bacteria 2631
104 Ga0307408_100088296 3300031548 Bacteria 2334
105 Ga0307408_100090464 3300031548 Bacteria 2309
106 Ga0307405_10002543 3300031731 Bacteria 8084
107 Ga0307405_10009825 3300031731 Bacteria 4922
108 Ga0307405_10021294 3300031731 Bacteria 3641
109 Ga0307405_10081679 3300031731 Bacteria 2113
110 Ga0307405_10096285 3300031731 Bacteria 1973
111 Ga0307413_10004666 3300031824 Bacteria 6004
112 Ga0307413_10023152 3300031824 Bacteria 3362
113 Ga0307413_10082484 3300031824 Bacteria 2066
114 Ga0307413_10112814 3300031824 Bacteria 1823
115 Ga0307413_10141178 3300031824 Bacteria 1665
116 Ga0307413_10189638 3300031824 Bacteria 1475
117 Ga0307410_10005249 3300031852 Bacteria 6828
118 Ga0307410_10015390 3300031852 Bacteria 4535
119 Ga0307410_10035490 3300031852 Bacteria 3239
120 Ga0307410_10074361 3300031852 Bacteria 2366
121 Ga0307410_10085725 3300031852 Bacteria 2223
122 Ga0307410_10089659 3300031852 Bacteria 2179
123 Ga0307410_10167885 3300031852 Bacteria 1650
124 Ga0307406_10142546 3300031901 Bacteria 1698
125 Ga0307407_10092995 3300031903 Bacteria 1853
126 Ga0307407_10114667 3300031903 Bacteria 1698
127 Ga0307412_10002784 3300031911 Bacteria 9715
128 Ga0307412_10017313 3300031911 Bacteria 4312
129 Ga0307412_10029516 3300031911 Bacteria 3442
130 Ga0307412_10036986 3300031911 Bacteria 3132
131 Ga0307412_10090734 3300031911 Bacteria 2137
132 Ga0307409_100004028 3300031995 Bacteria 8158
133 Ga0307409_100066406 3300031995 Bacteria 2844
134 Ga0307409_100280520 3300031995 Bacteria 1540
135 Ga0307416_100006982 3300032002 Bacteria 7119
136 Ga0307416_100030101 3300032002 Bacteria 4069
137 Ga0307416_100037601 3300032002 Bacteria 3726
138 Ga0307416_100174178 3300032002 Bacteria 2007
139 Ga0307416_100221054 3300032002 Bacteria 1816
140 Ga0307416_100271127 3300032002 Bacteria 1666
141 Ga0307416_100460353 3300032002 Bacteria 1327
142 Ga0307414_10190083 3300032004 Bacteria 1660
143 Ga0307415_100316112 3300032126 Bacteria 1300
144 Ga0373951_0014547 3300035091 Bacteria 1770
145 Ga0373962_0014581 3300035242 Bacteria 2005
146 Ga0373947_0139907 3300035725 Bacteria 1552
147 Ga0373937_0204913 3300036401 Bacteria 1855
148 Ga0373937_0337992 3300036401 Bacteria 1426
149 Ga0395899_0006005 3300037312 Bacteria 9426
150 Ga0395899_0025090 3300037312 Bacteria 4501
151 Ga0395899_0072788 3300037312 Bacteria 2514
152 Ga0395900_0008761 3300037418 Bacteria 10394
153 Ga0395900_0015686 3300037418 Bacteria 7723
154 Ga0395900_0040143 3300037418 Bacteria 4823
155 Ga0395900_0045354 3300037418 Bacteria 4528
156 Ga0395898_0001428 3300037466 Bacteria 33863
157 Ga0395898_0002175 3300037466 Bacteria 24008
158 Ga0395898_0014636 3300037466 Bacteria 8056
159 Ga0395898_0024942 3300037466 Bacteria 6028
160 Ga0395898_0056701 3300037466 Bacteria 3818
161 Ga0395898_0174692 3300037466 Bacteria 2053
162 Ga0395898_0201370 3300037466 Bacteria 1901
163 Ga0395905_0010933 3300037471 Bacteria 8784
164 Ga0395901_0023108 3300038443 Bacteria 6373
165 Ga0395901_0025857 3300038443 Bacteria 6028
166 Ga0395901_0060871 3300038443 Bacteria 3929
167 Ga0395901_0110886 3300038443 Bacteria 2881
168 Ga0395901_0278899 3300038443 Bacteria 1737
169 Ga0436365_0482652 3300039437 Bacteria 3165
170 Ga0436365_0514148 3300039437 Bacteria 1725
171 Ga0439436_0001234 3300041404 Bacteria 7294
172 Ga0439438_005661 3300041405 Bacteria 4553
173 Ga0439466_0008016 3300041411 Bacteria 3983
174 Ga0439466_0009118 3300041411 Bacteria 3719
175 Ga0439466_0026979 3300041411 Bacteria 1992
176 Ga0439433_0005954 3300041999 Bacteria 2619
177 Ga0439433_0012878 3300041999 Bacteria 1835
178 Ga0439433_0019854 3300041999 Bacteria 1498
179 Ga0439442_000195 3300042002 Bacteria 15453
180 Ga0439442_000423 3300042002 Bacteria 9742
181 Ga0439442_002509 3300042002 Bacteria 3604
182 Ga0439432_001112 3300042006 Bacteria 10220
183 Ga0439432_029546 3300042006 Bacteria 1781
184 Ga0439449_0001321 3300042007 Bacteria 9702
185 Ga0439449_0002881 3300042007 Bacteria 6691
186 Ga0439449_0039613 3300042007 Bacteria 1752
187 Ga0439449_0079302 3300042007 Bacteria 1210
188 Ga0439452_008959 3300042010 Bacteria 2979
189 Ga0439457_000519 3300042014 Bacteria 11170
190 Ga0439457_025633 3300042014 Bacteria 1304
191 Ga0439462_0002829 3300042015 Bacteria 4096
192 Ga0450919_001521 3300042121 Bacteria 3024
193 Ga0450920_000421 3300042122 Bacteria 6629
194 Ga0450907_000166 3300042146 Bacteria 24177
195 Ga0450909_002654 3300042185 Bacteria 2537
196 Ga0439434_0000902 3300042435 Bacteria 8545
197 Ga0450916_014141 3300042530 Bacteria 1036
198 Ga0466972_0011142 3300044658 Bacteria 4512
199 Ga0466966_0008867 3300044684 Bacteria 6662
200 Ga0466966_0094041 3300044684 Bacteria 1858
201 Ga0466966_0200445 3300044684 Bacteria 1208
202 Ga0466963_0031310 3300044694 Bacteria 3438
203 Ga0466963_0063121 3300044694 Bacteria 2479
204 Ga0466963_0192287 3300044694 Bacteria 1426
205 Ga0466964_0001026 3300044706 Bacteria 9308
206 Ga0466971_0023127 3300044719 Bacteria 2770
207 Ga0466970_0077663 3300044765 Bacteria 1790
208 Ga0466960_0020984 3300044901 Bacteria 2902
209 Ga0466959_0059495 3300045049 Bacteria 2782
210 Ga0466967_0052912 3300045976 Bacteria 3567
211 Ga0466967_0173764 3300045976 Bacteria 2028
212 Ga0466967_0306482 3300045976 Bacteria 1529
213 Ga0495629_0018571 3300046459 Bacteria 4973
214 Ga0495651_0037992 3300046462 Bacteria 3749
215 Ga0495653_0006819 3300046463 Bacteria 9379
216 Ga0495580_0019032 3300046472 Bacteria 5105
217 Ga0495639_0007775 3300046475 Bacteria 4610
218 Ga0495662_0023212 3300046476 Bacteria 2996
219 Ga0495664_0003979 3300046477 Bacteria 8068
220 Ga0495665_0000213 3300046531 Bacteria 29388
221 Ga0495665_0030671 3300046531 Bacteria 2878
222 Ga0495586_0000799 3300046535 Bacteria 18101
223 Ga0495586_0007016 3300046535 Bacteria 6004
224 Ga0495587_0001081 3300046536 Bacteria 17885
225 Ga0495645_0003954 3300046543 Bacteria 10111
226 Ga0495667_0007044 3300046559 Bacteria 7630
227 Ga0495634_0176313 3300046642 Bacteria 1341
228 Ga0495659_0012937 3300046664 Bacteria 2711
229 Ga0495588_0010622 3300046674 Bacteria 4289
230 Ga0495623_0021193 3300046679 Bacteria 4199
231 Ga0495600_0019728 3300046809 Bacteria 4308
232 Ga0495600_0071121 3300046809 Bacteria 2273
233 Ga0495581_0104059 3300047315 Bacteria 1649
234 Ga0495680_0042202 3300047322 Bacteria 3621
235 Ga0495675_0001025 3300047444 Bacteria 16974
236 Ga0495684_0057541 3300047471 Bacteria 2963
237 Ga0495593_0039360 3300047673 Bacteria 2549
238 Ga0496100_0006676 3300048903 Bacteria 6312
239 Ga0496100_0043611 3300048903 Bacteria 2870
240 Ga0496101_0028744 3300048904 Bacteria 3884
241 Ga0496101_0385481 3300048904 Bacteria 1103
242 Ga0496102_0003563 3300048905 Bacteria 13193
243 Ga0496102_0052109 3300048905 Bacteria 3728
244 Ga0496102_0135768 3300048905 Bacteria 2305
245 Ga0496102_0138501 3300048905 Bacteria 2281
246 Ga0496102_0281825 3300048905 Bacteria 1566
247 Ga0496102_0318657 3300048905 Bacteria 1465
248 Ga0496103_0013579 3300048906 Bacteria 4831
249 Ga0496103_0053687 3300048906 Bacteria 2498
250 Ga0496103_0062477 3300048906 Bacteria 2318
251 Ga0496103_0094712 3300048906 Bacteria 1886
252 Ga0496104_0058799 3300048907 Bacteria 3639
253 Ga0496104_0063011 3300048907 Bacteria 3516
254 Ga0496104_0071213 3300048907 Bacteria 3305
255 Ga0496104_0246115 3300048907 Bacteria 1701
256 Ga0496104_0279957 3300048907 Bacteria 1581
257 Ga0496105_0085881 3300048908 Bacteria 2600
258 Ga0496105_0408010 3300048908 Bacteria 1077
259 Ga0496106_0107935 3300048909 Bacteria 2165
260 Ga0496107_0008006 3300048910 Bacteria 7297
261 Ga0496107_0044167 3300048910 Bacteria 3203
262 Ga0496108_0023984 3300048911 Bacteria 5022
263 Ga0496108_0229216 3300048911 Bacteria 1615
264 Ga0496108_0347376 3300048911 Bacteria 1294
265 Ga0496109_0056859 3300048912 Bacteria 3569
266 Ga0496109_0071271 3300048912 Bacteria 3190
267 Ga0496109_0194054 3300048912 Bacteria 1908
268 Ga0496110_0012603 3300048913 Bacteria 6954
269 Ga0496110_0164661 3300048913 Bacteria 2010
270 Ga0496111_0079803 3300048914 Bacteria 2387
271 Ga0496112_0011558 3300048915 Bacteria 8067
272 Ga0496112_0223060 3300048915 Bacteria 1840
273 Ga0496113_0116654 3300048916 Bacteria 2084
274 Ga0496114_0076490 3300048917 Bacteria 2820
275 Ga0496114_0490360 3300048917 Bacteria 1087
276 Ga0501031_0008798 3300049568 Bacteria 6567
277 Ga0501031_0025807 3300049568 Bacteria 3834
278 Ga0501031_0059949 3300049568 Bacteria 2480
279 Ga0501032_0001361 3300049569 Bacteria 19395
280 Ga0501032_0001962 3300049569 Bacteria 16186
281 Ga0501033_0039078 3300049570 Bacteria 3545
282 Ga0501033_0133980 3300049570 Bacteria 1793
283 Ga0501034_0002103 3300049571 Bacteria 24858
284 Ga0501036_0027103 3300049572 Bacteria 4841
285 Ga0501036_0068054 3300049572 Bacteria 3013
286 Ga0501036_0232888 3300049572 Bacteria 1545
287 Ga0501037_0014696 3300049573 Bacteria 5759
288 Ga0501037_0041797 3300049573 Bacteria 3370
289 Ga0501038_0000729 3300049574 Bacteria 29347
290 Ga0501038_0038452 3300049574 Bacteria 4190
291 Ga0501038_0117240 3300049574 Bacteria 2199
292 Ga0501038_0180219 3300049574 Bacteria 1705
293 Ga0501039_0057659 3300049575 Bacteria 3007
294 Ga0501040_0047282 3300049576 Bacteria 2939
295 Ga0501041_0033111 3300049577 Bacteria 3125
296 Ga0501041_0035942 3300049577 Bacteria 3002
297 Ga0501041_0186510 3300049577 Bacteria 1299
298 Ga0501042_0059761 3300049578 Bacteria 2722
299 Ga0501043_0009011 3300049579 Bacteria 7852
300 Ga0501043_0025246 3300049579 Bacteria 4661
301 Ga0501043_0103919 3300049579 Bacteria 2232
302 Ga0501047_0029495 3300049581 Bacteria 5288
303 Ga0501048_0000046 3300049582 Bacteria 60199
304 Ga0501048_0016592 3300049582 Bacteria 5430
305 Ga0501068_0100941 3300049584 Bacteria 1788
306 Ga0501069_0021726 3300049585 Bacteria 3486
307 Ga0501070_0020594 3300049586 Bacteria 5531
308 Ga0501070_0028109 3300049586 Bacteria 4716
309 Ga0501071_0009465 3300049587 Bacteria 6490
310 Ga0501071_0011220 3300049587 Bacteria 6028
311 Ga0501071_0050403 3300049587 Bacteria 2999
312 Ga0501072_0002617 3300049588 Bacteria 13481
313 Ga0501072_0124202 3300049588 Bacteria 2056
314 Ga0501074_0257741 3300049590 Bacteria 1240
315 Ga0501075_0019281 3300049591 Bacteria 4946
316 Ga0501075_0046354 3300049591 Bacteria 3265
317 Ga0501076_0005778 3300049592 Bacteria 8923
318 Ga0501076_0030106 3300049592 Bacteria 4227
319 Ga0501076_0053604 3300049592 Bacteria 3196
320 Ga0501076_0109564 3300049592 Bacteria 2232
321 Ga0501077_0018899 3300049593 Bacteria 4361
322 Ga0501077_0054578 3300049593 Bacteria 2537
323 Ga0501225_0047498 3300049705 Bacteria 1191
324 Ga0501079_0015269 3300049741 Bacteria 5857
325 Ga0501079_0039679 3300049741 Bacteria 3631
326 Ga0501079_0195154 3300049741 Bacteria 1580
327 Ga0501080_0011309 3300049742 Bacteria 8170
328 Ga0501080_0048072 3300049742 Bacteria 3971
329 Ga0501081_0029093 3300049743 Bacteria 3732
330 Ga0501081_0181063 3300049743 Bacteria 1524
331 Ga0501083_0021876 3300049744 Bacteria 4441
332 Ga0501035_0111111 3300049822 Bacteria 2402
333 Ga0501035_0269228 3300049822 Bacteria 1442
334 Ga0501044_0042241 3300049823 Bacteria 4743
335 Ga0501044_0081239 3300049823 Bacteria 3282
336 Ga0501045_0011839 3300049824 Bacteria 6129
337 Ga0501045_0043945 3300049824 Bacteria 3254
338 Ga0501045_0143092 3300049824 Bacteria 1778
339 nmdc:mga08y16_316315_c1 3300050511 Bacteria 1608
340 nmdc:mga0n895_32425_c1 3300050512 Bacteria 5015
341 nmdc:mga0a205_16079_c1 3300050515 Bacteria 7004
342 Ga0495601_0092191 3300053077 Bacteria 1951
343 Ga0501084_0023634 3300054114 Bacteria 5126
344 Ga0501084_0024249 3300054114 Bacteria 5058
345 Ga0501084_0024533 3300054114 Bacteria 5031
346 Ga0501084_0149229 3300054114 Bacteria 1970
347 Ga0466962_0035655 3300061719 Bacteria 2380
348 Ga0530510_0027603 3300061734 Bacteria 4067
349 Ga0530510_0037940 3300061734 Bacteria 3476
350 Ga0530510_0116634 3300061734 Bacteria 1958
351 Ga0530510_0175452 3300061734 Bacteria 1588
352 2537899429 2537561592 Bacteria 4348607
353 2691513335 2690315906 Bacteria 4517044
354 2731905993 2731639228 Bacteria 4187555
355 2775656305 2775506735 Bacteria 4556596
356 2799182852 2799112218 Bacteria 4315149
357 2808830581 2808606357 Bacteria 4466944
358 2808851773 2808606360 Bacteria 4404006
359 2808879917 2808606366 Bacteria 4415912
360 2808894842 2808606370 Bacteria 4942454
361 2808895789 2808606371 Bacteria 4251511
362 2810363388 2808606700 Bacteria 3482157
363 2812319355 2811994871 Bacteria 4497550
364 2812321866 2811994871 Bacteria 4497550
365 2844844767 2844841374 Bacteria 3917147
366 2844852139 2844849076 Bacteria 4091819
367 2857744686 2857740372 Bacteria 4782044
368 2870803117 2870801768 Bacteria 2710986
369 2904778610 2904776348 Bacteria 4658726
370 2905927516 2905926851 Bacteria 4423176
371 2905928975 2905926851 Bacteria 4423176
372 2905930125 2905926851 Bacteria 4423176
373 2919053340 2919051321 Bacteria 4210889
374 2919060681 2919059106 Bacteria 4991624
375 2933418999 2933418574 Bacteria 4476724
376 2939599897 2939598168 Bacteria 4687164
377 2939648049 2939647034 Bacteria 4681660
378 2945919735 2945916053 Bacteria 4555517
379 2945924363 2945920336 Bacteria 4501603
380 2945943916 2945941187 Bacteria 4682474
381 2945957902 2945956166 Bacteria 5110334
382 2946003914 2946003308 Bacteria 3857229
383 2946025110 2946024296 Bacteria 3508095
384 2946039872 2946037020 Bacteria 4900426
385 2946063459 2946059875 Bacteria 4386623
386 2954001100 2953998280 Bacteria 4812144
387 2974303367 2974302888 Bacteria 4369871
388 8004024011 8004021418 Bacteria 4313954
389 8004029179 8004025490 Bacteria 4327753
390 Ga0395900_0046511
391 Ga0070658_10065333
392 Ga0070658_10170526
393 Ga0070690_100022733
394 Ga0070666_10003076
395 Ga0068868_100148027
396 Ga0070668_100005507
397 Ga0070675_100007446
398 Ga0070674_100067216
399 Ga0070674_100163020
400 Ga0070714_100000056
401 Ga0070694_100302205
402 Ga0070708_100171286
403 Ga0070707_100032053
404 Ga0070698_100082826
405 Ga0070698_100311291
406 Ga0070679_100155746
407 Ga0070697_100009549
408 Ga0070697_100296805
409 Ga0070696_100087390
410 Ga0070693_100056747
411 Ga0070665_100000757
412 Ga0068854_100160690
413 Ga0068856_100344293
414 Ga0068864_100137803
415 Ga0068863_100000677
416 Ga0068858_100012386
417 Ga0068860_100000214
418 Ga0081455_10074361
419 Ga0081538_10124172
420 Ga0075432_10005557
421 Ga0075432_10028115
422 Ga0075433_10122015
423 Ga0075434_100088520
424 Ga0075435_100238849
425 Ga0105244_10005361
426 Ga0105240_10508462
427 Ga0105245_10000874
428 Ga0105245_10010619
429 Ga0105245_10166188
430 Ga0105243_10077149
431 Ga0105243_10304121
432 Ga0105243_10369754
433 Ga0105238_10047989
434 Ga0105249_10125107
435 Ga0105239_10141213
436 Ga0105246_10275905
437 Ga0157373_10036695
438 Ga0157370_10066266
439 Ga0157369_10056866
440 Ga0157374_10363282
441 Ga0157374_10469968
442 Ga0163162_10125822
443 Ga0163162_10507786
444 Ga0157372_10000044
445 Ga0157375_10034979
446 Ga0163163_10014831
447 Ga0157380_10247393
448 Ga0157377_10062322
449 Ga0157379_10008079
450 Ga0197907_10989712
451 Ga0206353_11051388
452 Ga0206353_11283943
453 Ga0209129_1000079
454 Ga0209025_1002178
455 Ga0209051_1002224
456 Ga0207697_10014121
457 Ga0207655_1013544
458 Ga0207713_1085892
459 Ga0207688_10153060
460 Ga0207680_10051715
461 Ga0207645_10020846
462 Ga0207705_10023387
463 Ga0207684_10103720
464 Ga0207652_10023373
465 Ga0207646_10130948
466 Ga0207681_10141694
467 Ga0207694_10193047
468 Ga0207659_10246159
469 Ga0207687_10062343
470 Ga0207687_10102982
471 Ga0207687_10223248
472 Ga0207664_10000074
473 Ga0207706_10210545
474 Ga0207709_10186836
475 Ga0207691_10005146
476 Ga0207679_10104122
477 Ga0207712_10200869
478 Ga0207703_10033295
479 Ga0207708_10249172
480 Ga0207641_10003001
481 Ga0207675_100087362
482 Ga0207428_10037527
483 Ga0207428_10124665
484 Ga0268266_10024367
485 Ga0268264_10000027
486 Ga0307408_100013119
487 Ga0307408_100030184
488 Ga0307408_100030285
489 Ga0307408_100034587
490 Ga0307408_100045324
491 Ga0307408_100062176
492 Ga0307408_100067472
493 Ga0307408_100088296
494 Ga0307408_100090464
495 Ga0307405_10002543
496 Ga0307405_10009825
497 Ga0307405_10021294
498 Ga0307405_10081679
499 Ga0307405_10096285
500 Ga0307413_10004666
501 Ga0307413_10023152
502 Ga0307413_10082484
503 Ga0307413_10112814
504 Ga0307413_10141178
505 Ga0307413_10189638
506 Ga0307410_10005249
507 Ga0307410_10015390
508 Ga0307410_10035490
509 Ga0307410_10074361
510 Ga0307410_10085725
511 Ga0307410_10089659
512 Ga0307410_10167885
513 Ga0307406_10142546
514 Ga0307407_10092995
515 Ga0307407_10114667
516 Ga0307412_10002784
517 Ga0307412_10017313
518 Ga0307412_10029516
519 Ga0307412_10036986
520 Ga0307412_10090734
521 Ga0307409_100004028
522 Ga0307409_100066406
523 Ga0307409_100280520
524 Ga0307416_100006982
525 Ga0307416_100030101
526 Ga0307416_100037601
527 Ga0307416_100174178
528 Ga0307416_100221054
529 Ga0307416_100271127
530 Ga0307416_100460353
531 Ga0307414_10190083
532 Ga0307415_100316112
533 Ga0373951_0014547
534 Ga0373962_0014581
535 Ga0373947_0139907
536 Ga0373937_0204913
537 Ga0373937_0337992
538 Ga0395899_0006005
539 Ga0395899_0025090
540 Ga0395899_0072788
541 Ga0395900_0008761
542 Ga0395900_0015686
543 Ga0395900_0040143
544 Ga0395900_0045354
545 Ga0395898_0001428
546 Ga0395898_0002175
547 Ga0395898_0014636
548 Ga0395898_0024942
549 Ga0395898_0056701
550 Ga0395898_0174692
551 Ga0395898_0201370
552 Ga0395905_0010933
553 Ga0395901_0023108
554 Ga0395901_0025857
555 Ga0395901_0060871
556 Ga0395901_0110886
557 Ga0395901_0278899
558 Ga0436365_0482652
559 Ga0436365_0514148
560 Ga0439436_0001234
561 Ga0439438_005661
562 Ga0439466_0008016
563 Ga0439466_0009118
564 Ga0439466_0026979
565 Ga0439433_0005954
566 Ga0439433_0012878
567 Ga0439433_0019854
568 Ga0439442_000195
569 Ga0439442_000423
570 Ga0439442_002509
571 Ga0439432_001112
572 Ga0439432_029546
573 Ga0439449_0001321
574 Ga0439449_0002881
575 Ga0439449_0039613
576 Ga0439449_0079302
577 Ga0439452_008959
578 Ga0439457_000519
579 Ga0439457_025633
580 Ga0439462_0002829
581 Ga0450919_001521
582 Ga0450920_000421
583 Ga0450907_000166
584 Ga0450909_002654
585 Ga0439434_0000902
586 Ga0450916_014141
587 Ga0466972_0011142
588 Ga0466966_0008867
589 Ga0466966_0094041
590 Ga0466966_0200445
591 Ga0466963_0031310
592 Ga0466963_0063121
593 Ga0466963_0192287
594 Ga0466964_0001026
595 Ga0466971_0023127
596 Ga0466970_0077663
597 Ga0466960_0020984
598 Ga0466959_0059495
599 Ga0466967_0052912
600 Ga0466967_0173764
601 Ga0466967_0306482
602 Ga0495629_0018571
603 Ga0495651_0037992
604 Ga0495653_0006819
605 Ga0495580_0019032
606 Ga0495639_0007775
607 Ga0495662_0023212
608 Ga0495664_0003979
609 Ga0495665_0000213
610 Ga0495665_0030671
611 Ga0495586_0000799
612 Ga0495586_0007016
613 Ga0495587_0001081
614 Ga0495645_0003954
615 Ga0495667_0007044
616 Ga0495634_0176313
617 Ga0495659_0012937
618 Ga0495588_0010622
619 Ga0495623_0021193
620 Ga0495600_0019728
621 Ga0495600_0071121
622 Ga0495581_0104059
623 Ga0495680_0042202
624 Ga0495675_0001025
625 Ga0495684_0057541
626 Ga0495593_0039360
627 Ga0496100_0006676
628 Ga0496100_0043611
629 Ga0496101_0028744
630 Ga0496101_0385481
631 Ga0496102_0003563
632 Ga0496102_0052109
633 Ga0496102_0135768
634 Ga0496102_0138501
635 Ga0496102_0281825
636 Ga0496102_0318657
637 Ga0496103_0013579
638 Ga0496103_0053687
639 Ga0496103_0062477
640 Ga0496103_0094712
641 Ga0496104_0058799
642 Ga0496104_0063011
643 Ga0496104_0071213
644 Ga0496104_0246115
645 Ga0496104_0279957
646 Ga0496105_0085881
647 Ga0496105_0408010
648 Ga0496106_0107935
649 Ga0496107_0008006
650 Ga0496107_0044167
651 Ga0496108_0023984
652 Ga0496108_0229216
653 Ga0496108_0347376
654 Ga0496109_0056859
655 Ga0496109_0071271
656 Ga0496109_0194054
657 Ga0496110_0012603
658 Ga0496110_0164661
659 Ga0496111_0079803
660 Ga0496112_0011558
661 Ga0496112_0223060
662 Ga0496113_0116654
663 Ga0496114_0076490
664 Ga0496114_0490360
665 Ga0501031_0008798
666 Ga0501031_0025807
667 Ga0501031_0059949
668 Ga0501032_0001361
669 Ga0501032_0001962
670 Ga0501033_0039078
671 Ga0501033_0133980
672 Ga0501034_0002103
673 Ga0501036_0027103
674 Ga0501036_0068054
675 Ga0501036_0232888
676 Ga0501037_0014696
677 Ga0501037_0041797
678 Ga0501038_0000729
679 Ga0501038_0038452
680 Ga0501038_0117240
681 Ga0501038_0180219
682 Ga0501039_0057659
683 Ga0501040_0047282
684 Ga0501041_0033111
685 Ga0501041_0035942
686 Ga0501041_0186510
687 Ga0501042_0059761
688 Ga0501043_0009011
689 Ga0501043_0025246
690 Ga0501043_0103919
691 Ga0501047_0029495
692 Ga0501048_0000046
693 Ga0501048_0016592
694 Ga0501068_0100941
695 Ga0501069_0021726
696 Ga0501070_0020594
697 Ga0501070_0028109
698 Ga0501071_0009465
699 Ga0501071_0011220
700 Ga0501071_0050403
701 Ga0501072_0002617
702 Ga0501072_0124202
703 Ga0501074_0257741
704 Ga0501075_0019281
705 Ga0501075_0046354
706 Ga0501076_0005778
707 Ga0501076_0030106
708 Ga0501076_0053604
709 Ga0501076_0109564
710 Ga0501077_0018899
711 Ga0501077_0054578
712 Ga0501225_0047498
713 Ga0501079_0015269
714 Ga0501079_0039679
715 Ga0501079_0195154
716 Ga0501080_0011309
717 Ga0501080_0048072
718 Ga0501081_0029093
719 Ga0501081_0181063
720 Ga0501083_0021876
721 Ga0501035_0111111
722 Ga0501035_0269228
723 Ga0501044_0042241
724 Ga0501044_0081239
725 Ga0501045_0011839
726 Ga0501045_0043945
727 Ga0501045_0143092
728 nmdc:mga08y16_316315_c1
729 nmdc:mga0n895_32425_c1
730 nmdc:mga0a205_16079_c1
731 Ga0495601_0092191
732 Ga0501084_0023634
733 Ga0501084_0024249
734 Ga0501084_0024533
735 Ga0501084_0149229
736 Ga0466962_0035655
737 Ga0530510_0027603
738 Ga0530510_0037940
739 Ga0530510_0116634
740 Ga0530510_0175452
741 2537899429
742 2691513335
743 2731905993
744 2775656305
745 2799182852
746 2808830581
747 2808851773
748 2808879917
749 2808894842
750 2808895789
751 2810363388
752 2812319355
753 2812321866
754 2844844767
755 2844852139
756 2857744686
757 2870803117
758 2904778610
759 2905927516
760 2905928975
761 2905930125
762 2919053340
763 2919060681
764 2933418999
765 2939599897
766 2939648049
767 2945919735
768 2945924363
769 2945943916
770 2945957902
771 2946003914
772 2946025110
773 2946039872
774 2946063459
775 2954001100
776 2974303367
777 8004024011
778 8004029179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

193

323

0.97

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

42

155

0.93

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

169

361

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kbw-assembly1.cif.gz_B crystal structure of tmm from myroides profundi d25 0.9542 162 194
2dfv-assembly3.cif.gz_C hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii 0.9329 2 325
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.9288 1 328
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.9233 1 328
2dfv-assembly3.cif.gz_C hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii 0.9167 2 325
ID Description Score Start End Superfamily
af_P07913_2_151_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9679 3 150 3.90.180.10
5kiaA01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9498 1 326 3.90.180.10
af_P07913_2_151_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9492 3 150 3.90.180.10
5kiaA01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9364 1 326 3.90.180.10
af_A0A0R4IGI3_166_529_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.929 161 198 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4Q3IHJ8-F1-model_v4 L-threonine 3-dehydrogenase (EC 1.1.1.103) 0.9723 1 220 GO:0008270
GO:0008743
AF-A0A7X8MNF8-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9685 1 133 GO:0008270
GO:0016491
AF-T1BX74-F1-model_v4 L-threonine 3-dehydrogenase 0.9673 1 157 GO:0008270
GO:0016491
AF-A0A3D1R0P5-F1-model_v4 L-threonine 3-dehydrogenase (EC 1.1.1.103) 0.9655 1 169 GO:0008270
GO:0008743
AF-A0A3N6GBZ0-F1-model_v4 L-threonine 3-dehydrogenase (TDH) (EC 1.1.1.103) 0.963 2 328 GO:0005737
GO:0008270
GO:0008743
GO:0019518

Map