F431411

General Info

Members Datasets Scaffolds Average Seq Length
389 285 778 397

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10112174|Ga0105237_101121742
Length 462
Sequence MIEPMRSHLKTMAKLMISRLVWRPFAGAAMQARSWTNTQRSTILRAPARGIPCPMADVLAAPQQAEKKADSDIRTLTLISVAHWVSHFHLLVLPMLFPFLKEQLGVGYIELGFALTVFAVISGLTQTPIGYIVDHIGARIILLLGLTIGGLSLXXXXLHVSYPFLIASAVLLGIANSVYHPSDYAILAEHMNSERMGRAFSIHTFAGFLGGAVAPAIMAGFVTWFGGHGALIAAGGIAGIPDAGGKHKSAGAAGAPKQSIITPALIMLTIFFTLLGLSNAGINNFGVVALMSGYGTSFSAANIALTVYLGASAVGVLAGGYLADRTQHHGQVAAVCFGINTVLILIVAMMALPAPVLITVMTIAGFLYGVIAPSRDMLVRDAAPPGAAGRAFGIVSTGFNFSGIASPLLFGWIMDRNMPHAVFLISAAFMALTVILAFFTERKSKVLPAREADAFLSPNAGG

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
39 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
54 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
55 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
56 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
93 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
94 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
195 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
198 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
199 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
200 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
201 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
202 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
210 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
211 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
214 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
215 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
216 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
217 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
218 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
219 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
220 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
221 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
222 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
223 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
224 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
225 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
226 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
227 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
228 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
229 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
230 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
231 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
232 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
233 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
234 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
235 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
236 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
237 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
238 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
239 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
240 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
241 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
242 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
243 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
244 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
245 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
246 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
247 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
248 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
249 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
250 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
251 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
252 2922368715
253 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
254 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
255 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
256 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
257 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
258 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
259 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
260 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
261 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
262 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
263 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
264 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
265 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
266 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
267 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
268 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
269 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
270 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
271 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
272 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
273 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
274 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
275 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
276 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
277 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
278 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
279 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
280 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
281 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
282 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
283 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
284 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
285 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.44
Metatranscriptomes 0
Isolates 18.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.14
Nodule 13.37
Rhizoplane 4.63
Rhizosphere 53.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10112174 3300009545 Bacteria 2719
2 JGI25153J46596_10010184 3300003215 Bacteria 4276
3 JGI25160J50197_1002555 3300003354 Bacteria 8422
4 JGI25160J50197_1008329 3300003354 Bacteria 3957
5 Ga0055529_1009597 3300003763 Bacteria 1267
6 Ga0065165_1001210 3300005262 Bacteria 29773
7 Ga0070658_10093477 3300005327 Bacteria 2481
8 Ga0070658_10226137 3300005327 Bacteria 1583
9 Ga0070683_100011699 3300005329 Bacteria 7598
10 Ga0070683_100117940 3300005329 Bacteria 2506
11 Ga0070680_100015397 3300005336 Bacteria 5994
12 Ga0070680_100088678 3300005336 Bacteria 2559
13 Ga0070660_100037403 3300005339 Bacteria 3679
14 Ga0070691_10039222 3300005341 Bacteria 2237
15 Ga0070661_100137096 3300005344 Bacteria 1842
16 Ga0070675_100146220 3300005354 Bacteria 2024
17 Ga0070709_10014103 3300005434 Bacteria 4513
18 Ga0070709_10033340 3300005434 Bacteria 3113
19 Ga0070709_10089634 3300005434 Bacteria 2025
20 Ga0070714_100001031 3300005435 Bacteria 19841
21 Ga0070713_100000447 3300005436 Bacteria 26301
22 Ga0070713_100007516 3300005436 Bacteria 7657
23 Ga0070713_100039496 3300005436 Bacteria 3831
24 Ga0070713_100192422 3300005436 Bacteria 1839
25 Ga0070713_100198888 3300005436 Bacteria 1809
26 Ga0070713_100264826 3300005436 Bacteria 1572
27 Ga0070710_10000834 3300005437 Bacteria 14840
28 Ga0070710_10045745 3300005437 Bacteria 2434
29 Ga0070663_100005884 3300005455 Bacteria 7334
30 Ga0070662_100311383 3300005457 Bacteria 1282
31 Ga0070681_10009298 3300005458 Bacteria 9666
32 Ga0070681_10057097 3300005458 Bacteria 3884
33 Ga0070681_10172147 3300005458 Bacteria 2087
34 Ga0070679_100106869 3300005530 Bacteria 2784
35 Ga0070679_100116321 3300005530 Bacteria 2659
36 Ga0070679_100128688 3300005530 Bacteria 2513
37 Ga0070684_100012012 3300005535 Bacteria 6920
38 Ga0070684_100023649 3300005535 Bacteria 5144
39 Ga0070684_100121647 3300005535 Bacteria 2348
40 Ga0068853_100014402 3300005539 Bacteria 6474
41 Ga0068853_100080967 3300005539 Bacteria 2842
42 Ga0068853_100170831 3300005539 Bacteria 1967
43 Ga0070665_100128933 3300005548 Bacteria 2532
44 Ga0068855_100012487 3300005563 Bacteria 10252
45 Ga0068855_100322571 3300005563 Bacteria 1707
46 Ga0068852_100046890 3300005616 Bacteria 3684
47 Ga0068851_10002177 3300005834 Bacteria 8618
48 Ga0068862_100206385 3300005844 Bacteria 1774
49 Ga0081455_10015618 3300005937 Bacteria 7367
50 Ga0081455_10140530 3300005937 Bacteria 1876
51 Ga0070717_10011148 3300006028 Bacteria 6813
52 Ga0070717_10064456 3300006028 Bacteria 3043
53 Ga0075368_10058796 3300006042 Bacteria 1537
54 Ga0075368_10070108 3300006042 Bacteria 1414
55 Ga0075364_10060811 3300006051 Bacteria 2477
56 Ga0070715_10008375 3300006163 Bacteria 3600
57 Ga0070712_100001393 3300006175 Bacteria 14686
58 Ga0070712_100008227 3300006175 Bacteria 6552
59 Ga0097621_100165676 3300006237 Bacteria 1903
60 Ga0075430_100041813 3300006846 Bacteria 3877
61 Ga0075431_100076533 3300006847 Bacteria 3453
62 Ga0075431_100109218 3300006847 Bacteria 2855
63 Ga0075434_100006792 3300006871 Bacteria 10523
64 Ga0075434_100017182 3300006871 Bacteria 6965
65 Ga0099825_1025749 3300006941 Bacteria 3230
66 Ga0099823_1022970 3300006944 Bacteria 5741
67 Ga0075435_100030580 3300007076 Bacteria 4236
68 Ga0105240_10009432 3300009093 Bacteria 13814
69 Ga0105240_10028920 3300009093 Bacteria 7230
70 Ga0105240_10133692 3300009093 Bacteria 2972
71 Ga0105240_10219009 3300009093 Bacteria 2219
72 Ga0105240_10465871 3300009093 Bacteria 1411
73 Ga0111539_10085025 3300009094 Bacteria 3719
74 Ga0105245_10056071 3300009098 Bacteria 3541
75 Ga0105241_10014323 3300009174 Bacteria 5806
76 Ga0105237_10012543 3300009545 Bacteria 8927
77 Ga0105238_10005359 3300009551 Bacteria 12672
78 Ga0105238_10033741 3300009551 Bacteria 5208
79 Ga0105249_10130156 3300009553 Bacteria 2402
80 Ga0105239_10014534 3300010375 Bacteria 8734
81 Ga0157369_10016112 3300013105 Bacteria 8412
82 Ga0157369_10024896 3300013105 Bacteria 6650
83 Ga0157369_10191071 3300013105 Bacteria 2152
84 Ga0157369_10249099 3300013105 Bacteria 1854
85 Ga0157374_10059539 3300013296 Bacteria 3572
86 Ga0157375_10035821 3300013308 Bacteria 4741
87 Ga0163163_10005998 3300014325 Bacteria 10569
88 Ga0163163_10030407 3300014325 Bacteria 5204
89 Ga0157380_10033194 3300014326 Bacteria 3974
90 Ga0214544_1000087 3300021320 Bacteria 119600
91 Ga0214542_1000018 3300021321 Bacteria 202226
92 Ga0214545_1000009 3300021324 Bacteria 202915
93 Ga0214543_1000037 3300021327 Bacteria 182113
94 Ga0209563_101775 3300025230 Bacteria 5420
95 Ga0209677_100351 3300025253 Bacteria 28656
96 Ga0209148_1000694 3300025254 Bacteria 27288
97 Ga0209233_1001962 3300025261 Bacteria 7828
98 Ga0209455_1002928 3300025272 Bacteria 6295
99 Ga0209455_1003911 3300025272 Bacteria 5078
100 Ga0209564_1003394 3300025295 Bacteria 10967
101 Ga0209758_1000972 3300025297 Bacteria 38579
102 Ga0209758_1008915 3300025297 Bacteria 6365
103 Ga0209758_1049753 3300025297 Bacteria 1476
104 Ga0209256_1012033 3300025299 Bacteria 3374
105 Ga0207426_1000201 3300025302 Bacteria 143975
106 Ga0207426_1000617 3300025302 Bacteria 45527
107 Ga0209257_1021460 3300025304 Bacteria 2344
108 Ga0207692_10000538 3300025898 Bacteria 13413
109 Ga0207692_10038459 3300025898 Bacteria 2347
110 Ga0207692_10079290 3300025898 Bacteria 1752
111 Ga0207699_10014825 3300025906 Bacteria 4032
112 Ga0207705_10030033 3300025909 Bacteria 3876
113 Ga0207707_10002611 3300025912 Bacteria 16136
114 Ga0207707_10005017 3300025912 Bacteria 11625
115 Ga0207707_10016113 3300025912 Bacteria 6517
116 Ga0207707_10143394 3300025912 Bacteria 2088
117 Ga0207695_10123465 3300025913 Bacteria 2555
118 Ga0207695_10291336 3300025913 Bacteria 1525
119 Ga0207693_10001776 3300025915 Bacteria 18911
120 Ga0207693_10014578 3300025915 Bacteria 6317
121 Ga0207660_10012408 3300025917 Bacteria 5575
122 Ga0207660_10028321 3300025917 Bacteria 3831
123 Ga0207657_10004425 3300025919 Bacteria 14870
124 Ga0207649_10105982 3300025920 Bacteria 1869
125 Ga0207652_10015227 3300025921 Bacteria 6241
126 Ga0207652_10022596 3300025921 Bacteria 5205
127 Ga0207652_10023805 3300025921 Bacteria 5077
128 Ga0207652_10042328 3300025921 Bacteria 3876
129 Ga0207694_10018576 3300025924 Bacteria 5255
130 Ga0207694_10030365 3300025924 Bacteria 4127
131 Ga0207659_10114712 3300025926 Bacteria 2054
132 Ga0207687_10068639 3300025927 Bacteria 2526
133 Ga0207700_10069313 3300025928 Bacteria 2706
134 Ga0207664_10006879 3300025929 Bacteria 7862
135 Ga0207706_10026306 3300025933 Bacteria 5208
136 Ga0207665_10000289 3300025939 Bacteria 34924
137 Ga0207661_10000678 3300025944 Bacteria 22066
138 Ga0207661_10030712 3300025944 Bacteria 4141
139 Ga0207667_10096858 3300025949 Bacteria 3045
140 Ga0207703_10209331 3300026035 Bacteria 1738
141 Ga0207639_10026403 3300026041 Bacteria 4220
142 Ga0207639_10244183 3300026041 Bacteria 1563
143 Ga0207678_10006381 3300026067 Bacteria 10470
144 Ga0207702_10145605 3300026078 Bacteria 2149
145 Ga0207674_10041082 3300026116 Bacteria 4785
146 Ga0207674_10103457 3300026116 Bacteria 2827
147 Ga0207698_10024019 3300026142 Bacteria 4270
148 Ga0209389_1000076 3300027296 Bacteria 92447
149 Ga0209489_100416 3300027361 Bacteria 77981
150 Ga0209700_100014 3300027363 Bacteria 299349
151 Ga0209813_10027175 3300027866 Bacteria 1660
152 Ga0207428_10039246 3300027907 Bacteria 3844
153 Ga0265319_1051570 3300028563 Bacteria 1356
154 Ga0265323_10007852 3300028653 Bacteria 4414
155 Ga0265336_10000430 3300028666 Bacteria 25854
156 Ga0265338_10000024 3300028800 Bacteria 297778
157 Ga0307410_10082011 3300031852 Bacteria 2268
158 Ga0307412_10032278 3300031911 Bacteria 3316
159 Ga0373945_0009195 3300035116 Bacteria 3234
160 Ga0373956_0045970 3300035119 Bacteria 1949
161 Ga0316574_0059335 3300035398 Bacteria 2399
162 Ga0373931_0091813 3300035691 Bacteria 1693
163 Ga0373937_0021531 3300036401 Bacteria 5786
164 Ga0373925_0036844 3300037068 Bacteria 3609
165 Ga0373925_0138041 3300037068 Bacteria 1906
166 Ga0395900_0003234 3300037418 Bacteria 17637
167 Ga0395900_0005520 3300037418 Bacteria 13242
168 Ga0395900_0255275 3300037418 Bacteria 1753
169 Ga0395898_0003112 3300037466 Bacteria 18739
170 Ga0395898_0054939 3300037466 Bacteria 3885
171 Ga0395898_0111000 3300037466 Bacteria 2628
172 Ga0395905_0128654 3300037471 Bacteria 2382
173 Ga0436364_0897580 3300037853 Bacteria 3065
174 Ga0395901_0143439 3300038443 Bacteria 2510
175 Ga0436365_1132543 3300039437 Bacteria 4959
176 Ga0436365_1722400 3300039437 Bacteria 1867
177 Ga0436365_1743653 3300039437 Bacteria 3928
178 Ga0436363_0554689 3300039450 Bacteria 1144
179 Ga0466969_0015098 3300044656 Bacteria 4051
180 Ga0466972_0000103 3300044658 Bacteria 75095
181 Ga0466966_0092262 3300044684 Bacteria 1879
182 Ga0466966_0121429 3300044684 Bacteria 1604
183 Ga0466961_0000129 3300044693 Bacteria 50353
184 Ga0466963_0061364 3300044694 Bacteria 2513
185 Ga0466963_0146924 3300044694 Bacteria 1636
186 Ga0466959_0005547 3300045049 Bacteria 8659
187 Ga0466959_0006120 3300045049 Bacteria 8313
188 Ga0466967_0057273 3300045976 Bacteria 3440
189 Ga0466967_0173964 3300045976 Bacteria 2027
190 Ga0466967_0228576 3300045976 Bacteria 1770
191 Ga0495603_0136022 3300046455 Bacteria 1430
192 Ga0495638_0002281 3300046460 Bacteria 15850
193 Ga0495638_0004591 3300046460 Bacteria 10453
194 Ga0495638_0004972 3300046460 Bacteria 9985
195 Ga0495651_0010124 3300046462 Bacteria 7242
196 Ga0495653_0210844 3300046463 Bacteria 1312
197 Ga0495664_0122221 3300046477 Bacteria 1574
198 Ga0495606_0089089 3300046507 Bacteria 1901
199 Ga0495618_0059553 3300046514 Bacteria 2420
200 Ga0495628_0048136 3300046516 Bacteria 3380
201 Ga0495630_0047353 3300046517 Bacteria 3216
202 Ga0495665_0032829 3300046531 Bacteria 2777
203 Ga0495645_0064837 3300046543 Bacteria 2643
204 Ga0495645_0149271 3300046543 Bacteria 1625
205 Ga0495667_0133423 3300046559 Bacteria 1601
206 Ga0495634_0180347 3300046642 Bacteria 1322
207 Ga0495635_0085502 3300046663 Bacteria 2158
208 Ga0495657_0099251 3300046675 Bacteria 1857
209 Ga0495599_0113519 3300046678 Bacteria 1686
210 Ga0495623_0006918 3300046679 Bacteria 7372
211 Ga0495646_0046749 3300046680 Bacteria 2637
212 Ga0495647_0036981 3300046681 Bacteria 1840
213 Ga0495581_0120426 3300047315 Bacteria 1527
214 Ga0495604_0002997 3300047317 Bacteria 13512
215 Ga0495674_0146311 3300047319 Bacteria 1983
216 Ga0495680_0006823 3300047322 Bacteria 10545
217 Ga0495675_0039234 3300047444 Bacteria 3016
218 Ga0495684_0065440 3300047471 Bacteria 2763
219 Ga0495593_0021124 3300047673 Bacteria 3639
220 Ga0495602_0240261 3300048088 Bacteria 1355
221 Ga0496100_0090717 3300048903 Bacteria 2084
222 Ga0496101_0009103 3300048904 Bacteria 6514
223 Ga0496101_0103825 3300048904 Bacteria 2131
224 Ga0496104_0005304 3300048907 Bacteria 11278
225 Ga0496105_0054045 3300048908 Bacteria 3317
226 Ga0496106_0024272 3300048909 Bacteria 4506
227 Ga0496106_0120554 3300048909 Bacteria 2050
228 Ga0496106_0195199 3300048909 Bacteria 1610
229 Ga0496108_0037528 3300048911 Bacteria 4036
230 Ga0496109_0056475 3300048912 Bacteria 3582
231 Ga0496110_0059147 3300048913 Bacteria 3377
232 Ga0496110_0063821 3300048913 Bacteria 3255
233 Ga0496112_0247735 3300048915 Bacteria 1733
234 Ga0496113_0045689 3300048916 Bacteria 3249
235 Ga0496114_0003910 3300048917 Bacteria 11491
236 Ga0496115_0001711 3300048918 Bacteria 15732
237 Ga0496115_0156114 3300048918 Bacteria 1885
238 Ga0496116_0006484 3300048919 Bacteria 10605
239 Ga0496116_0053971 3300048919 Bacteria 2651
240 Ga0496117_0052196 3300048920 Bacteria 2882
241 Ga0496117_0129372 3300048920 Bacteria 1533
242 Ga0496118_0014329 3300048921 Bacteria 7430
243 Ga0496118_0033272 3300048921 Bacteria 4232
244 Ga0496118_0047207 3300048921 Bacteria 3341
245 Ga0496118_0125734 3300048921 Bacteria 1660
246 Ga0496120_0075358 3300048923 Bacteria 1842
247 Ga0496121_0007994 3300048924 Bacteria 12628
248 Ga0496121_0018322 3300048924 Bacteria 7067
249 Ga0496121_0024527 3300048924 Bacteria 5764
250 Ga0496121_0030852 3300048924 Bacteria 4914
251 Ga0496121_0068766 3300048924 Bacteria 2863
252 Ga0496122_0010250 3300048925 Bacteria 9703
253 Ga0496122_0070659 3300048925 Bacteria 2492
254 Ga0496123_0080914 3300048926 Bacteria 1977
255 Ga0496124_0072486 3300048927 Bacteria 2852
256 Ga0496125_0006629 3300048928 Bacteria 12462
257 Ga0496125_0023392 3300048928 Bacteria 5703
258 Ga0496125_0068809 3300048928 Bacteria 2782
259 Ga0496125_0157466 3300048928 Bacteria 1549
260 Ga0496126_0027327 3300048929 Bacteria 5452
261 Ga0501033_0165430 3300049570 Bacteria 1590
262 Ga0501036_0047824 3300049572 Bacteria 3622
263 Ga0501037_0107176 3300049573 Bacteria 2013
264 Ga0501046_0186970 3300049580 Bacteria 1547
265 Ga0501047_0014548 3300049581 Bacteria 7485
266 Ga0501047_0061335 3300049581 Bacteria 3628
267 Ga0501067_0024462 3300049583 Bacteria 3350
268 Ga0501070_0030844 3300049586 Bacteria 4490
269 Ga0501073_0068943 3300049589 Bacteria 2465
270 Ga0501074_0056753 3300049590 Bacteria 2822
271 Ga0501080_0265003 3300049742 Bacteria 1564
272 Ga0501044_0028580 3300049823 Bacteria 5885
273 Ga0501044_0112195 3300049823 Bacteria 2734
274 Ga0501044_0194343 3300049823 Bacteria 1990
275 nmdc:mga0yw44_13349_c1 3300050492 Bacteria 4322
276 nmdc:mga0yw44_4314_c1 3300050492 Bacteria 6493
277 nmdc:mga0yw44_44049_c1 3300050492 Bacteria 2667
278 nmdc:mga04h51_5377_c1 3300050495 Bacteria 3261
279 nmdc:mga0qj67_13692_c1 3300050509 Bacteria 6123
280 nmdc:mga0qj67_16001_c1 3300050509 Bacteria 5681
281 nmdc:mga06r32_25390_c1 3300050510 Bacteria 5513
282 nmdc:mga06r32_82908_c1 3300050510 Bacteria 3124
283 nmdc:mga08y16_74750_c1 3300050511 Bacteria 3532
284 nmdc:mga0n895_16307_c1 3300050512 Bacteria 6813
285 nmdc:mga0n895_205256_c1 3300050512 Bacteria 2001
286 nmdc:mga0n895_93403_c1 3300050512 Bacteria 3012
287 Ga0495601_0048926 3300053077 Bacteria 2664
288 Ga0500610_0084408 3300053079 Bacteria 1654
289 Ga0500635_0006785 3300053080 Bacteria 3072
290 Ga0500578_0033396 3300053086 Bacteria 3306
291 Ga0500643_000062 3300053087 Bacteria 122407
292 Ga0500581_042624 3300053089 Bacteria 2321
293 Ga0500566_0000065 3300053094 Bacteria 50325
294 Ga0500566_0001906 3300053094 Bacteria 12273
295 Ga0500566_0035804 3300053094 Bacteria 2883
296 Ga0500556_0000019 3300053104 Bacteria 186017
297 Ga0500562_034834 3300053108 Bacteria 1332
298 Ga0500569_005007 3300053109 Bacteria 2824
299 Ga0500608_038063 3300053122 Bacteria 2300
300 Ga0500608_054191 3300053122 Bacteria 1924
301 Ga0500618_006817 3300053125 Bacteria 3316
302 Ga0500642_0000048 3300053130 Bacteria 81787
303 Ga0500559_0000855 3300053136 Bacteria 19648
304 Ga0500559_0036911 3300053136 Bacteria 2116
305 Ga0500568_0000242 3300053139 Bacteria 46479
306 Ga0500604_0007503 3300053151 Bacteria 2888
307 Ga0500616_0000059 3300053153 Bacteria 259741
308 Ga0500620_004239 3300053155 Bacteria 3180
309 Ga0500622_0003876 3300053156 Bacteria 9708
310 Ga0500636_0000075 3300053177 Bacteria 48415
311 Ga0500636_0037274 3300053177 Bacteria 2877
312 Ga0500636_0054040 3300053177 Bacteria 2355
313 Ga0500637_0021641 3300053178 Bacteria 3495
314 Ga0500596_000444 3300053735 Bacteria 7683
315 Ga0500601_000231 3300053737 Bacteria 11058
316 Ga0466962_0055483 3300061719 Bacteria 1893
317 2513647956 2513237095 Bacteria 8976980
318 2513715715 2513237104 Bacteria 10034502
319 2517102380 2517093001 Bacteria 9002274
320 2524435750 2524023205 Bacteria 8918781
321 2528855132 2528768022 Bacteria 10457665
322 2603861753 2602042107 Bacteria 6226103
323 2617377254 2617270741 Bacteria 8201522
324 2745079046 2744054633 Bacteria 8678936
325 2776266508 2775506901 Bacteria 9631051
326 2793063112 2791355196 Bacteria 7323613
327 2818237286 2816332527 Bacteria 8933356
328 2824683552 2824679649 Bacteria 8248951
329 2824709669 2824704595 Bacteria 9667483
330 2824736255 2824732956 Bacteria 7810675
331 2824750291 2824746037 Bacteria 7911610
332 2824757107 2824753945 Bacteria 9787441
333 2824768443 2824763712 Bacteria 9792355
334 2835316474 2835312727 Bacteria 7413381
335 2841964607 2841957949 Bacteria 8652217
336 2844321829 2844315083 Bacteria 8138177
337 2847931463 2847930680 Bacteria 9342022
338 2849082681 2849076700 Bacteria 7039503
339 2857525942 2857524615 Bacteria 6615449
340 2876766407 2876761206 Bacteria 10111113
341 2879087500 2879083081 Bacteria 8587928
342 2879107231 2879099564 Bacteria 10442239
343 2881370996 2881364244 Bacteria 7710352
344 2881665702 2881665667 Bacteria 8175609
345 2885411725 2885409591 Bacteria 9235467
346 2888379957 2888378607 Bacteria 9652610
347 2888391036 2888388044 Bacteria 7304136
348 2893067776 2893066018 Bacteria 6158120
349 2894776303 2894772417 Bacteria 5305674
350 2903727621 2903727486 Bacteria 8281579
351 2904716190 2904711408 Bacteria 9771557
352 2906602889 2906602504 Bacteria 8295279
353 2906647597 2906643746 Bacteria 8722424
354 2908775770 2908775508 Bacteria 8092255
355 2919074197 2919073203 Bacteria 6531949
356 2922378343
357 2922400792 2922393267 Bacteria 8285685
358 2929622556 2929615660 Bacteria 9193770
359 2929631226 2929624759 Bacteria 9339455
360 2932794680 2932794094 Bacteria 7915132
361 2932805509 2932801729 Bacteria 7987968
362 2933584365 2933577622 Bacteria 9116884
363 2935677954 2935675223 Bacteria 9928132
364 2935772765 2935769743 Bacteria 7878163
365 2935778098 2935777560 Bacteria 8077691
366 2935787326 2935785616 Bacteria 7962367
367 2935795886 2935793552 Bacteria 8012592
368 2935817208 2935810662 Bacteria 9401221
369 2935888894 2935883170 Bacteria 7964738
370 2935964138 2935959822 Bacteria 7869783
371 2936044004 2936037263 Bacteria 9446081
372 3005486412 3005483717 Bacteria 7877331
373 3005589027 3005587118 Bacteria 7794411
374 3005602177 3005594810 Bacteria 8716512
375 3005717934 3005710791 Bacteria 7622528
376 3005724968 3005718088 Bacteria 8283608
377 8016531676 8016530956 Bacteria 8155261
378 8016557203 8016548790 Bacteria 8155074
379 8016565555 8016557553 Bacteria 8154380
380 8016569943 8016566248 Bacteria 8158151
381 8016582524 8016575299 Bacteria 8154085
382 8016603172 8016595262 Bacteria 8149947
383 8016606089 8016603502 Bacteria 8731218
384 8016636080 8016630954 Bacteria 9217207
385 8019531497 8019530166 Bacteria 8155624
386 8019540034 8019538911 Bacteria 7872763
387 8019652871 8019648815 Bacteria 10014479
388 8055751007 8055742211 Bacteria 9226248
389 8056970922 8056967851 Bacteria 9038162
390 Ga0105237_10112174
391 JGI25153J46596_10010184
392 JGI25160J50197_1002555
393 JGI25160J50197_1008329
394 Ga0055529_1009597
395 Ga0065165_1001210
396 Ga0070658_10093477
397 Ga0070658_10226137
398 Ga0070683_100011699
399 Ga0070683_100117940
400 Ga0070680_100015397
401 Ga0070680_100088678
402 Ga0070660_100037403
403 Ga0070691_10039222
404 Ga0070661_100137096
405 Ga0070675_100146220
406 Ga0070709_10014103
407 Ga0070709_10033340
408 Ga0070709_10089634
409 Ga0070714_100001031
410 Ga0070713_100000447
411 Ga0070713_100007516
412 Ga0070713_100039496
413 Ga0070713_100192422
414 Ga0070713_100198888
415 Ga0070713_100264826
416 Ga0070710_10000834
417 Ga0070710_10045745
418 Ga0070663_100005884
419 Ga0070662_100311383
420 Ga0070681_10009298
421 Ga0070681_10057097
422 Ga0070681_10172147
423 Ga0070679_100106869
424 Ga0070679_100116321
425 Ga0070679_100128688
426 Ga0070684_100012012
427 Ga0070684_100023649
428 Ga0070684_100121647
429 Ga0068853_100014402
430 Ga0068853_100080967
431 Ga0068853_100170831
432 Ga0070665_100128933
433 Ga0068855_100012487
434 Ga0068855_100322571
435 Ga0068852_100046890
436 Ga0068851_10002177
437 Ga0068862_100206385
438 Ga0081455_10015618
439 Ga0081455_10140530
440 Ga0070717_10011148
441 Ga0070717_10064456
442 Ga0075368_10058796
443 Ga0075368_10070108
444 Ga0075364_10060811
445 Ga0070715_10008375
446 Ga0070712_100001393
447 Ga0070712_100008227
448 Ga0097621_100165676
449 Ga0075430_100041813
450 Ga0075431_100076533
451 Ga0075431_100109218
452 Ga0075434_100006792
453 Ga0075434_100017182
454 Ga0099825_1025749
455 Ga0099823_1022970
456 Ga0075435_100030580
457 Ga0105240_10009432
458 Ga0105240_10028920
459 Ga0105240_10133692
460 Ga0105240_10219009
461 Ga0105240_10465871
462 Ga0111539_10085025
463 Ga0105245_10056071
464 Ga0105241_10014323
465 Ga0105237_10012543
466 Ga0105238_10005359
467 Ga0105238_10033741
468 Ga0105249_10130156
469 Ga0105239_10014534
470 Ga0157369_10016112
471 Ga0157369_10024896
472 Ga0157369_10191071
473 Ga0157369_10249099
474 Ga0157374_10059539
475 Ga0157375_10035821
476 Ga0163163_10005998
477 Ga0163163_10030407
478 Ga0157380_10033194
479 Ga0214544_1000087
480 Ga0214542_1000018
481 Ga0214545_1000009
482 Ga0214543_1000037
483 Ga0209563_101775
484 Ga0209677_100351
485 Ga0209148_1000694
486 Ga0209233_1001962
487 Ga0209455_1002928
488 Ga0209455_1003911
489 Ga0209564_1003394
490 Ga0209758_1000972
491 Ga0209758_1008915
492 Ga0209758_1049753
493 Ga0209256_1012033
494 Ga0207426_1000201
495 Ga0207426_1000617
496 Ga0209257_1021460
497 Ga0207692_10000538
498 Ga0207692_10038459
499 Ga0207692_10079290
500 Ga0207699_10014825
501 Ga0207705_10030033
502 Ga0207707_10002611
503 Ga0207707_10005017
504 Ga0207707_10016113
505 Ga0207707_10143394
506 Ga0207695_10123465
507 Ga0207695_10291336
508 Ga0207693_10001776
509 Ga0207693_10014578
510 Ga0207660_10012408
511 Ga0207660_10028321
512 Ga0207657_10004425
513 Ga0207649_10105982
514 Ga0207652_10015227
515 Ga0207652_10022596
516 Ga0207652_10023805
517 Ga0207652_10042328
518 Ga0207694_10018576
519 Ga0207694_10030365
520 Ga0207659_10114712
521 Ga0207687_10068639
522 Ga0207700_10069313
523 Ga0207664_10006879
524 Ga0207706_10026306
525 Ga0207665_10000289
526 Ga0207661_10000678
527 Ga0207661_10030712
528 Ga0207667_10096858
529 Ga0207703_10209331
530 Ga0207639_10026403
531 Ga0207639_10244183
532 Ga0207678_10006381
533 Ga0207702_10145605
534 Ga0207674_10041082
535 Ga0207674_10103457
536 Ga0207698_10024019
537 Ga0209389_1000076
538 Ga0209489_100416
539 Ga0209700_100014
540 Ga0209813_10027175
541 Ga0207428_10039246
542 Ga0265319_1051570
543 Ga0265323_10007852
544 Ga0265336_10000430
545 Ga0265338_10000024
546 Ga0307410_10082011
547 Ga0307412_10032278
548 Ga0373945_0009195
549 Ga0373956_0045970
550 Ga0316574_0059335
551 Ga0373931_0091813
552 Ga0373937_0021531
553 Ga0373925_0036844
554 Ga0373925_0138041
555 Ga0395900_0003234
556 Ga0395900_0005520
557 Ga0395900_0255275
558 Ga0395898_0003112
559 Ga0395898_0054939
560 Ga0395898_0111000
561 Ga0395905_0128654
562 Ga0436364_0897580
563 Ga0395901_0143439
564 Ga0436365_1132543
565 Ga0436365_1722400
566 Ga0436365_1743653
567 Ga0436363_0554689
568 Ga0466969_0015098
569 Ga0466972_0000103
570 Ga0466966_0092262
571 Ga0466966_0121429
572 Ga0466961_0000129
573 Ga0466963_0061364
574 Ga0466963_0146924
575 Ga0466959_0005547
576 Ga0466959_0006120
577 Ga0466967_0057273
578 Ga0466967_0173964
579 Ga0466967_0228576
580 Ga0495603_0136022
581 Ga0495638_0002281
582 Ga0495638_0004591
583 Ga0495638_0004972
584 Ga0495651_0010124
585 Ga0495653_0210844
586 Ga0495664_0122221
587 Ga0495606_0089089
588 Ga0495618_0059553
589 Ga0495628_0048136
590 Ga0495630_0047353
591 Ga0495665_0032829
592 Ga0495645_0064837
593 Ga0495645_0149271
594 Ga0495667_0133423
595 Ga0495634_0180347
596 Ga0495635_0085502
597 Ga0495657_0099251
598 Ga0495599_0113519
599 Ga0495623_0006918
600 Ga0495646_0046749
601 Ga0495647_0036981
602 Ga0495581_0120426
603 Ga0495604_0002997
604 Ga0495674_0146311
605 Ga0495680_0006823
606 Ga0495675_0039234
607 Ga0495684_0065440
608 Ga0495593_0021124
609 Ga0495602_0240261
610 Ga0496100_0090717
611 Ga0496101_0009103
612 Ga0496101_0103825
613 Ga0496104_0005304
614 Ga0496105_0054045
615 Ga0496106_0024272
616 Ga0496106_0120554
617 Ga0496106_0195199
618 Ga0496108_0037528
619 Ga0496109_0056475
620 Ga0496110_0059147
621 Ga0496110_0063821
622 Ga0496112_0247735
623 Ga0496113_0045689
624 Ga0496114_0003910
625 Ga0496115_0001711
626 Ga0496115_0156114
627 Ga0496116_0006484
628 Ga0496116_0053971
629 Ga0496117_0052196
630 Ga0496117_0129372
631 Ga0496118_0014329
632 Ga0496118_0033272
633 Ga0496118_0047207
634 Ga0496118_0125734
635 Ga0496120_0075358
636 Ga0496121_0007994
637 Ga0496121_0018322
638 Ga0496121_0024527
639 Ga0496121_0030852
640 Ga0496121_0068766
641 Ga0496122_0010250
642 Ga0496122_0070659
643 Ga0496123_0080914
644 Ga0496124_0072486
645 Ga0496125_0006629
646 Ga0496125_0023392
647 Ga0496125_0068809
648 Ga0496125_0157466
649 Ga0496126_0027327
650 Ga0501033_0165430
651 Ga0501036_0047824
652 Ga0501037_0107176
653 Ga0501046_0186970
654 Ga0501047_0014548
655 Ga0501047_0061335
656 Ga0501067_0024462
657 Ga0501070_0030844
658 Ga0501073_0068943
659 Ga0501074_0056753
660 Ga0501080_0265003
661 Ga0501044_0028580
662 Ga0501044_0112195
663 Ga0501044_0194343
664 nmdc:mga0yw44_13349_c1
665 nmdc:mga0yw44_4314_c1
666 nmdc:mga0yw44_44049_c1
667 nmdc:mga04h51_5377_c1
668 nmdc:mga0qj67_13692_c1
669 nmdc:mga0qj67_16001_c1
670 nmdc:mga06r32_25390_c1
671 nmdc:mga06r32_82908_c1
672 nmdc:mga08y16_74750_c1
673 nmdc:mga0n895_16307_c1
674 nmdc:mga0n895_205256_c1
675 nmdc:mga0n895_93403_c1
676 Ga0495601_0048926
677 Ga0500610_0084408
678 Ga0500635_0006785
679 Ga0500578_0033396
680 Ga0500643_000062
681 Ga0500581_042624
682 Ga0500566_0000065
683 Ga0500566_0001906
684 Ga0500566_0035804
685 Ga0500556_0000019
686 Ga0500562_034834
687 Ga0500569_005007
688 Ga0500608_038063
689 Ga0500608_054191
690 Ga0500618_006817
691 Ga0500642_0000048
692 Ga0500559_0000855
693 Ga0500559_0036911
694 Ga0500568_0000242
695 Ga0500604_0007503
696 Ga0500616_0000059
697 Ga0500620_004239
698 Ga0500622_0003876
699 Ga0500636_0000075
700 Ga0500636_0037274
701 Ga0500636_0054040
702 Ga0500637_0021641
703 Ga0500596_000444
704 Ga0500601_000231
705 Ga0466962_0055483
706 2513647956
707 2513715715
708 2517102380
709 2524435750
710 2528855132
711 2603861753
712 2617377254
713 2745079046
714 2776266508
715 2793063112
716 2818237286
717 2824683552
718 2824709669
719 2824736255
720 2824750291
721 2824757107
722 2824768443
723 2835316474
724 2841964607
725 2844321829
726 2847931463
727 2849082681
728 2857525942
729 2876766407
730 2879087500
731 2879107231
732 2881370996
733 2881665702
734 2885411725
735 2888379957
736 2888391036
737 2893067776
738 2894776303
739 2903727621
740 2904716190
741 2906602889
742 2906647597
743 2908775770
744 2919074197
745 2922378343
746 2922400792
747 2929622556
748 2929631226
749 2932794680
750 2932805509
751 2933584365
752 2935677954
753 2935772765
754 2935778098
755 2935787326
756 2935795886
757 2935817208
758 2935888894
759 2935964138
760 2936044004
761 3005486412
762 3005589027
763 3005602177
764 3005717934
765 3005724968
766 8016531676
767 8016557203
768 8016565555
769 8016569943
770 8016582524
771 8016603172
772 8016606089
773 8016636080
774 8019531497
775 8019540034
776 8019652871
777 8055751007
778 8056970922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

79

240

0.92

PF07690

MFS_1

Major Facilitator Superfamily

266

459

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iky-assembly1.cif.gz_A crystal structure of peptide transporter pot (e310q mutant) in complex with sulfate 0.8718 184 362
7zc2-assembly1.cif.gz_A dipeptide and tripeptide permease c (dtpc) 0.8704 180 356
4ikz-assembly1.cif.gz_A crystal structure of peptide transporter pot (e310q mutant) in complex with alafosfalin 0.8691 184 362
8cni-assembly1.cif.gz_B pht1 in the outward facing conformation, bound to sb27 0.8577 183 361
8hnb-assembly1.cif.gz_A cryo-em structure of human oatp1b1 in apo state 0.8535 182 359
ID Description Score Start End Superfamily
af_Q5RGT2_295_489_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9132 183 360 1.20.1250.20
af_Q59X41_293_496_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9053 181 362 1.20.1250.20
af_P33026_213_392_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9004 183 360 1.20.1250.20
af_Q5NC32_214_410_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8986 183 356 1.20.1250.20
af_A4I388_258_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8982 183 359 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1V3NGS3-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9621 181 359 GO:0005886
GO:0022857
AF-A0A2M8BHY9-F1-model_v4 MFS transporter 0.9615 190 359 GO:0016020
GO:0022857
AF-A0A536SZG2-F1-model_v4 MFS transporter 0.9578 188 361 GO:0005886
GO:0022857
AF-A0A1Z9SI23-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9556 180 359 GO:0016020
GO:0022857
AF-H0SGI6-F1-model_v4 Putative permease of the Major Facilitator Superfamily possibly involved in drug resistance 0.9422 165 366 GO:0005886
GO:0022857

Map