F431358

General Info

Members Datasets Scaffolds Average Seq Length
389 201 778 119

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100784653|Ga0070664_1007846532
Length 134
Sequence MAVDEKAISYSGGANGMTPERVYALIFASVYPHYVKKAETKGRTKEELDEVIRWLTGYSKAGLEKVIADKVDLGTFFEKAPKINPNTSLIKGVVCGIRVEDIEDPLMQKIRYMDKLIDELAKGKAMEKILRSPV

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
72 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
152 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
153 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
184 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
200 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
201 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 2.57
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100784653 3300005564 Bacteria 890
2 SwRhRL2b_contig_699088 2162886007 Bacteria 815
3 Ga0065714_10361263 3300005288 Bacteria 623
4 Ga0065704_10456705 3300005289 Bacteria 687
5 Ga0065715_10393925 3300005293 Bacteria 890
6 Ga0065707_10291965 3300005295 Bacteria 1016
7 Ga0070676_10421175 3300005328 Bacteria 933
8 Ga0070676_10949284 3300005328 Bacteria 643
9 Ga0070670_100371390 3300005331 Bacteria 1259
10 Ga0070670_100915061 3300005331 Bacteria 795
11 Ga0068869_100796331 3300005334 Bacteria 812
12 Ga0068869_100998371 3300005334 Bacteria 729
13 Ga0070666_10295217 3300005335 Bacteria 1154
14 Ga0070666_10371879 3300005335 Bacteria 1025
15 Ga0070666_10382824 3300005335 Bacteria 1010
16 Ga0070666_10613051 3300005335 Bacteria 795
17 Ga0070682_100721412 3300005337 Bacteria 801
18 Ga0070682_101473912 3300005337 Bacteria 584
19 Ga0070689_100358494 3300005340 Bacteria 1225
20 Ga0070689_100973579 3300005340 Bacteria 753
21 Ga0070687_100359865 3300005343 Bacteria 942
22 Ga0070669_100108835 3300005353 Bacteria 2101
23 Ga0070669_101480730 3300005353 Bacteria 590
24 Ga0070675_100358769 3300005354 Unclassified 1294
25 Ga0070675_100555491 3300005354 Bacteria 1039
26 Ga0070671_100270682 3300005355 Bacteria 1444
27 Ga0070671_100583763 3300005355 Bacteria 965
28 Ga0070673_100131218 3300005364 Bacteria 2102
29 Ga0070688_100156424 3300005365 Bacteria 1562
30 Ga0070688_100309907 3300005365 Bacteria 1144
31 Ga0070688_100620197 3300005365 Bacteria 830
32 Ga0070667_100085324 3300005367 Bacteria 2708
33 Ga0070701_10035939 3300005438 Bacteria 2493
34 Ga0070701_10721240 3300005438 Bacteria 673
35 Ga0070700_100010437 3300005441 Bacteria 5129
36 Ga0070700_100112579 3300005441 Bacteria 1812
37 Ga0070694_100206240 3300005444 Bacteria 1468
38 Ga0070708_101461632 3300005445 Bacteria 637
39 Ga0070663_100103872 3300005455 Bacteria 2124
40 Ga0070678_100240378 3300005456 Bacteria 1514
41 Ga0070662_100819313 3300005457 Bacteria 792
42 Ga0070662_101595209 3300005457 Bacteria 563
43 Ga0068867_100015231 3300005459 Bacteria 5452
44 Ga0068867_100779611 3300005459 Bacteria 851
45 Ga0068867_101029210 3300005459 Bacteria 748
46 Ga0068867_102358789 3300005459 Bacteria 506
47 Ga0070685_10233899 3300005466 Bacteria 1210
48 Ga0070685_10461891 3300005466 Bacteria 891
49 Ga0070698_100131362 3300005471 Bacteria 2459
50 Ga0070698_100230316 3300005471 Bacteria 1786
51 Ga0070698_100277467 3300005471 Bacteria 1608
52 Ga0074259_10034453 3300005507 Bacteria 511
53 Ga0068853_100483216 3300005539 Bacteria 1168
54 Ga0070672_100096372 3300005543 Bacteria 2394
55 Ga0070672_100882489 3300005543 Bacteria 789
56 Ga0070672_102038000 3300005543 Bacteria 517
57 Ga0070686_100020322 3300005544 Bacteria 3928
58 Ga0070686_100084530 3300005544 Bacteria 2109
59 Ga0070665_100079756 3300005548 Bacteria 3279
60 Ga0070704_100086815 3300005549 Bacteria 2320
61 Ga0070704_100508871 3300005549 Bacteria 1046
62 Ga0070704_101275182 3300005549 Bacteria 672
63 Ga0068855_100109732 3300005563 Bacteria 3168
64 Ga0068855_100233929 3300005563 Bacteria 2056
65 Ga0070664_100314501 3300005564 Bacteria 1418
66 Ga0070664_100587955 3300005564 Bacteria 1032
67 Ga0068854_101377263 3300005578 Bacteria 637
68 Ga0068859_100211550 3300005617 Bacteria 2025
69 Ga0068859_100657881 3300005617 Bacteria 1139
70 Ga0068859_101027223 3300005617 Bacteria 906
71 Ga0068859_102081543 3300005617 Bacteria 626
72 Ga0068859_102088334 3300005617 Bacteria 625
73 Ga0068864_100066913 3300005618 Bacteria 3119
74 Ga0068864_100069465 3300005618 Bacteria 3063
75 Ga0068864_100274862 3300005618 Bacteria 1571
76 Ga0068864_101766938 3300005618 Bacteria 623
77 Ga0068866_10045347 3300005718 Bacteria 2204
78 Ga0068861_100730022 3300005719 Bacteria 923
79 Ga0068861_101665786 3300005719 Bacteria 630
80 Ga0068870_10072132 3300005840 Bacteria 1886
81 Ga0068870_10312643 3300005840 Bacteria 995
82 Ga0068870_10734373 3300005840 Bacteria 684
83 Ga0068863_100133445 3300005841 Bacteria 2371
84 Ga0068863_100335329 3300005841 Bacteria 1470
85 Ga0068863_101091307 3300005841 Bacteria 802
86 Ga0068858_100034737 3300005842 Bacteria 4676
87 Ga0068858_100350386 3300005842 Bacteria 1414
88 Ga0068858_101619247 3300005842 Bacteria 639
89 Ga0068860_100043624 3300005843 Bacteria 4277
90 Ga0068860_100230984 3300005843 Bacteria 1798
91 Ga0068860_100335250 3300005843 Bacteria 1486
92 Ga0068860_100829845 3300005843 Bacteria 938
93 Ga0068862_100123296 3300005844 Bacteria 2286
94 Ga0068862_100180416 3300005844 Bacteria 1894
95 Ga0068862_102184826 3300005844 Bacteria 565
96 Ga0081455_10000293 3300005937 Bacteria 66278
97 Ga0081538_10312316 3300005981 Bacteria 575
98 Ga0075367_10816400 3300006178 Bacteria 594
99 Ga0097621_100122581 3300006237 Bacteria 2206
100 Ga0097621_100140221 3300006237 Bacteria 2065
101 Ga0097621_100305219 3300006237 Bacteria 1407
102 Ga0097621_100381839 3300006237 Bacteria 1258
103 Ga0068871_100026431 3300006358 Bacteria 4529
104 Ga0075428_100447483 3300006844 Bacteria 1384
105 Ga0075428_101308352 3300006844 Bacteria 762
106 Ga0075430_100284902 3300006846 Bacteria 1367
107 Ga0075430_100297580 3300006846 Bacteria 1335
108 Ga0075430_101343909 3300006846 Bacteria 588
109 Ga0075431_100691091 3300006847 Bacteria 998
110 Ga0075431_100812690 3300006847 Bacteria 908
111 Ga0075433_10560927 3300006852 Bacteria 1003
112 Ga0075429_100128999 3300006880 Bacteria 2212
113 Ga0068865_100012536 3300006881 Bacteria 5339
114 Ga0068865_100032425 3300006881 Bacteria 3489
115 Ga0075436_101172493 3300006914 Bacteria 579
116 Ga0097620_100211550 3300006931 Bacteria 2025
117 Ga0097620_100657866 3300006931 Bacteria 1139
118 Ga0097620_101027200 3300006931 Bacteria 906
119 Ga0097620_102081541 3300006931 Bacteria 626
120 Ga0097620_102088332 3300006931 Bacteria 625
121 Ga0105251_10067177 3300009011 Bacteria 1675
122 Ga0105250_10220175 3300009092 Bacteria 805
123 Ga0111539_10207456 3300009094 Bacteria 2284
124 Ga0111539_12588220 3300009094 Bacteria 588
125 Ga0105245_13048057 3300009098 Bacteria 519
126 Ga0105247_10024908 3300009101 Bacteria 3608
127 Ga0105247_10303812 3300009101 Bacteria 1108
128 Ga0105247_10403041 3300009101 Bacteria 975
129 Ga0114129_10854456 3300009147 Bacteria 1157
130 Ga0114129_10918642 3300009147 Bacteria 1108
131 Ga0105243_10119552 3300009148 Bacteria 2219
132 Ga0105243_10432615 3300009148 Bacteria 1230
133 Ga0105243_10460326 3300009148 Bacteria 1196
134 Ga0105243_10749900 3300009148 Bacteria 957
135 Ga0105243_11224189 3300009148 Bacteria 765
136 Ga0105241_10522004 3300009174 Bacteria 1062
137 Ga0105242_10072409 3300009176 Bacteria 2862
138 Ga0105242_10343452 3300009176 Bacteria 1376
139 Ga0105242_11672955 3300009176 Bacteria 672
140 Ga0105242_12133963 3300009176 Bacteria 605
141 Ga0105248_10238653 3300009177 Bacteria 2046
142 Ga0105248_10315381 3300009177 Bacteria 1761
143 Ga0105248_10657771 3300009177 Bacteria 1182
144 Ga0105248_12037313 3300009177 Bacteria 652
145 Ga0105249_10000015 3300009553 Bacteria 282138
146 Ga0105249_10077654 3300009553 Bacteria 3080
147 Ga0105249_10122210 3300009553 Bacteria 2476
148 Ga0105249_10160994 3300009553 Bacteria 2169
149 Ga0105029_104915 3300009984 Bacteria 930
150 Ga0105028_101633 3300009993 Bacteria 2346
151 Ga0105028_137793 3300009993 Bacteria 543
152 Ga0105239_10737412 3300010375 Bacteria 1127
153 Ga0105246_12137083 3300011119 Bacteria 543
154 Ga0157371_11047946 3300013102 Bacteria 624
155 Ga0157370_10980585 3300013104 Bacteria 765
156 Ga0157374_10212031 3300013296 Bacteria 1899
157 Ga0157378_10020401 3300013297 Bacteria 5829
158 Ga0157378_11506183 3300013297 Bacteria 717
159 Ga0163162_10040913 3300013306 Bacteria 4636
160 Ga0163162_10074471 3300013306 Bacteria 3454
161 Ga0163162_10217625 3300013306 Bacteria 2040
162 Ga0163162_10544293 3300013306 Bacteria 1289
163 Ga0163162_11624892 3300013306 Bacteria 737
164 Ga0157375_10017608 3300013308 Bacteria 6451
165 Ga0157375_10038209 3300013308 Bacteria 4608
166 Ga0157375_11090404 3300013308 Bacteria 934
167 Ga0157375_11128615 3300013308 Bacteria 918
168 Ga0157375_11983314 3300013308 Bacteria 692
169 Ga0157375_13195455 3300013308 Bacteria 546
170 Ga0163163_10204118 3300014325 Bacteria 2025
171 Ga0157380_10393789 3300014326 Bacteria 1312
172 Ga0157380_11107579 3300014326 Bacteria 831
173 Ga0182008_10483799 3300014497 Bacteria 678
174 Ga0157377_10075437 3300014745 Bacteria 1958
175 Ga0157377_11231375 3300014745 Bacteria 581
176 Ga0157377_11401711 3300014745 Bacteria 551
177 Ga0157379_10018379 3300014968 Bacteria 6163
178 Ga0157379_10038580 3300014968 Bacteria 4262
179 Ga0157379_10222636 3300014968 Bacteria 1710
180 Ga0157376_11085978 3300014969 Bacteria 825
181 Ga0157376_12129302 3300014969 Bacteria 599
182 Ga0163161_10094310 3300017792 Bacteria 2219
183 Ga0163161_10400057 3300017792 Unclassified 1101
184 Ga0163161_11884433 3300017792 Bacteria 532
185 Ga0207697_10203210 3300025315 Bacteria 872
186 Ga0207682_10021588 3300025893 Bacteria 2534
187 Ga0207710_10229998 3300025900 Bacteria 922
188 Ga0207710_10358459 3300025900 Bacteria 744
189 Ga0207680_10029242 3300025903 Bacteria 3093
190 Ga0207680_10510085 3300025903 Bacteria 857
191 Ga0207685_10394255 3300025905 Bacteria 708
192 Ga0207643_10076840 3300025908 Bacteria 1929
193 Ga0207662_10181146 3300025918 Bacteria 1356
194 Ga0207646_10418412 3300025922 Bacteria 1210
195 Ga0207650_10059417 3300025925 Bacteria 2849
196 Ga0207650_10188359 3300025925 Bacteria 1647
197 Ga0207650_10852345 3300025925 Unclassified 773
198 Ga0207650_10962754 3300025925 Bacteria 725
199 Ga0207659_10049714 3300025926 Bacteria 2975
200 Ga0207659_10080403 3300025926 Bacteria 2407
201 Ga0207659_10171903 3300025926 Unclassified 1710
202 Ga0207659_10266632 3300025926 Bacteria 1395
203 Ga0207644_10026878 3300025931 Bacteria 3972
204 Ga0207644_10212079 3300025931 Unclassified 1532
205 Ga0207706_10741697 3300025933 Bacteria 837
206 Ga0207706_10930706 3300025933 Bacteria 733
207 Ga0207706_11343873 3300025933 Bacteria 589
208 Ga0207686_10116865 3300025934 Bacteria 1809
209 Ga0207686_10282692 3300025934 Bacteria 1225
210 Ga0207686_10896861 3300025934 Bacteria 715
211 Ga0207670_10219755 3300025936 Bacteria 1454
212 Ga0207670_10316929 3300025936 Bacteria 1226
213 Ga0207670_10942493 3300025936 Bacteria 724
214 Ga0207669_10148887 3300025937 Bacteria 1637
215 Ga0207669_11144030 3300025937 Bacteria 658
216 Ga0207704_10052028 3300025938 Bacteria 2481
217 Ga0207691_10024221 3300025940 Bacteria 5708
218 Ga0207691_10144172 3300025940 Bacteria 2097
219 Ga0207691_10370831 3300025940 Bacteria 1223
220 Ga0207691_10714274 3300025940 Bacteria 845
221 Ga0207691_11019028 3300025940 Bacteria 690
222 Ga0207711_10088750 3300025941 Bacteria 2715
223 Ga0207689_11014856 3300025942 Bacteria 700
224 Ga0207689_11026219 3300025942 Bacteria 696
225 Ga0207679_10682979 3300025945 Bacteria 931
226 Ga0207667_10047061 3300025949 Bacteria 4566
227 Ga0207667_10415175 3300025949 Bacteria 1370
228 Ga0207651_10081412 3300025960 Bacteria 2334
229 Ga0207651_10135337 3300025960 Bacteria 1894
230 Ga0207651_10270419 3300025960 Bacteria 1399
231 Ga0207651_10928280 3300025960 Bacteria 776
232 Ga0207712_10000023 3300025961 Bacteria 282081
233 Ga0207712_10144682 3300025961 Bacteria 1829
234 Ga0207712_10171326 3300025961 Bacteria 1697
235 Ga0207712_10849961 3300025961 Bacteria 804
236 Ga0207668_10359858 3300025972 Bacteria 1219
237 Ga0207668_10523032 3300025972 Bacteria 1024
238 Ga0207640_10293500 3300025981 Bacteria 1283
239 Ga0207640_10767738 3300025981 Bacteria 832
240 Ga0207658_10011392 3300025986 Bacteria 6053
241 Ga0207658_10017502 3300025986 Bacteria 4940
242 Ga0207658_10228228 3300025986 Unclassified 1570
243 Ga0207658_10286878 3300025986 Bacteria 1413
244 Ga0207677_10828859 3300026023 Bacteria 830
245 Ga0207703_11323024 3300026035 Bacteria 693
246 Ga0207703_11664398 3300026035 Bacteria 614
247 Ga0207639_10084103 3300026041 Bacteria 2527
248 Ga0207708_10011409 3300026075 Bacteria 6616
249 Ga0207708_11004179 3300026075 Bacteria 725
250 Ga0207641_10020923 3300026088 Bacteria 5377
251 Ga0207641_10029410 3300026088 Bacteria 4543
252 Ga0207641_10048696 3300026088 Bacteria 3578
253 Ga0207648_10033613 3300026089 Bacteria 4523
254 Ga0207648_10081224 3300026089 Bacteria 2828
255 Ga0207648_10722608 3300026089 Bacteria 924
256 Ga0207648_10885692 3300026089 Bacteria 833
257 Ga0207676_10064274 3300026095 Bacteria 2917
258 Ga0207676_10338532 3300026095 Bacteria 1387
259 Ga0207676_11298072 3300026095 Bacteria 723
260 Ga0207674_10339637 3300026116 Bacteria 1452
261 Ga0207675_100739056 3300026118 Bacteria 995
262 Ga0207683_10021976 3300026121 Bacteria 5473
263 Ga0207683_10197103 3300026121 Bacteria 1830
264 Ga0207683_10898211 3300026121 Bacteria 823
265 Ga0210000_1076940 3300027462 Bacteria 546
266 Ga0209999_1042603 3300027543 Bacteria 852
267 Ga0207428_10222230 3300027907 Bacteria 1415
268 Ga0207428_10772720 3300027907 Bacteria 684
269 Ga0268266_10085058 3300028379 Bacteria 2763
270 Ga0268266_10567699 3300028379 Bacteria 1088
271 Ga0268266_10600910 3300028379 Bacteria 1057
272 Ga0268266_11039339 3300028379 Bacteria 793
273 Ga0268265_10118988 3300028380 Bacteria 2173
274 Ga0268265_10133483 3300028380 Bacteria 2067
275 Ga0268265_10421815 3300028380 Bacteria 1239
276 Ga0268265_10619521 3300028380 Bacteria 1037
277 Ga0268265_10974775 3300028380 Bacteria 836
278 Ga0268265_11949806 3300028380 Bacteria 594
279 Ga0268265_12287657 3300028380 Bacteria 547
280 Ga0268264_10101043 3300028381 Bacteria 2506
281 Ga0268264_11492774 3300028381 Bacteria 687
282 Ga0307515_10494091 3300028794 Bacteria 835
283 Ga0265338_10551879 3300028800 Bacteria 806
284 Ga0307408_100030383 3300031548 Bacteria 3752
285 Ga0307405_10047215 3300031731 Bacteria 2650
286 Ga0307405_10233028 3300031731 Bacteria 1359
287 Ga0307405_11913577 3300031731 Bacteria 529
288 Ga0307413_10059391 3300031824 Bacteria 2349
289 Ga0307413_10187355 3300031824 Bacteria 1482
290 Ga0307410_10009091 3300031852 Bacteria 5553
291 Ga0307410_10012783 3300031852 Bacteria 4870
292 Ga0307410_10250084 3300031852 Bacteria 1378
293 Ga0307410_10269666 3300031852 Bacteria 1331
294 Ga0307410_10511946 3300031852 Bacteria 989
295 Ga0307406_10007933 3300031901 Bacteria 5912
296 Ga0307406_10008348 3300031901 Bacteria 5772
297 Ga0307406_10088675 3300031901 Bacteria 2076
298 Ga0307406_10097140 3300031901 Bacteria 1997
299 Ga0307406_10255272 3300031901 Bacteria 1323
300 Ga0307407_10021168 3300031903 Bacteria 3348
301 Ga0307407_10036131 3300031903 Bacteria 2720
302 Ga0307412_10012498 3300031911 Bacteria 4953
303 Ga0307412_10014519 3300031911 Bacteria 4646
304 Ga0307412_11139476 3300031911 Bacteria 696
305 Ga0307409_100013288 3300031995 Bacteria 5290
306 Ga0307409_100280304 3300031995 Bacteria 1540
307 Ga0307416_100004428 3300032002 Bacteria 8465
308 Ga0307416_100024487 3300032002 Bacteria 4408
309 Ga0307416_100044376 3300032002 Bacteria 3490
310 Ga0307416_100141486 3300032002 Bacteria 2187
311 Ga0307416_100438839 3300032002 Bacteria 1355
312 Ga0307414_10115197 3300032004 Bacteria 2055
313 Ga0307414_10450871 3300032004 Bacteria 1128
314 Ga0307414_11659935 3300032004 Bacteria 596
315 Ga0307411_10011672 3300032005 Bacteria 4754
316 Ga0307411_10229702 3300032005 Bacteria 1445
317 Ga0307411_10631787 3300032005 Bacteria 925
318 Ga0307411_10867494 3300032005 Bacteria 800
319 Ga0307411_10878247 3300032005 Unclassified 795
320 Ga0307411_11731319 3300032005 Bacteria 579
321 Ga0307415_100013093 3300032126 Bacteria 4826
322 Ga0307415_100022580 3300032126 Bacteria 3886
323 Ga0395900_1120963 3300037418 Bacteria 704
324 Ga0439436_0160501 3300041404 Bacteria 636
325 Ga0439439_0241061 3300041406 Bacteria 534
326 Ga0439461_0029308 3300041410 Bacteria 1139
327 Ga0451791_0707147 3300041451 Bacteria 695
328 Ga0451791_1927931 3300041451 Bacteria 702
329 Ga0451804_0298187 3300041463 Bacteria 762
330 Ga0451807_1105730 3300041486 Bacteria 569
331 Ga0439431_0016435 3300041997 Bacteria 1732
332 Ga0439454_118472 3300042011 Bacteria 511
333 Ga0450898_150167 3300042134 Bacteria 510
334 Ga0439446_0069808 3300042156 Bacteria 1073
335 Ga0439458_0165326 3300042157 Bacteria 597
336 Ga0439435_0238095 3300042436 Bacteria 610
337 Ga0439459_0249931 3300042438 Bacteria 501
338 Ga0451577_0024371 3300042876 Bacteria 5505
339 Ga0453684_0958150 3300044712 Bacteria 913
340 Ga0495629_0186399 3300046459 Bacteria 1437
341 Ga0495606_0002435 3300046507 Bacteria 21634
342 Ga0495599_0484063 3300046678 Bacteria 730
343 Ga0495672_0035349 3300047320 Unclassified 3078
344 Ga0495686_0000025 3300047472 Bacteria 388098
345 Ga0496102_0668435 3300048905 Bacteria 962
346 Ga0496106_0969495 3300048909 Bacteria 670
347 Ga0496108_0510273 3300048911 Bacteria 1050
348 Ga0496108_0587333 3300048911 Bacteria 971
349 Ga0496110_0399924 3300048913 Bacteria 1252
350 Ga0496111_1048044 3300048914 Bacteria 583
351 Ga0501031_0469296 3300049568 Bacteria 813
352 Ga0501031_0791968 3300049568 Bacteria 608
353 Ga0501036_0091982 3300049572 Bacteria 2562
354 Ga0501036_0574737 3300049572 Bacteria 936
355 Ga0501037_0564184 3300049573 Bacteria 767
356 Ga0501038_0074964 3300049574 Bacteria 2861
357 Ga0501038_0567280 3300049574 Bacteria 862
358 Ga0501040_0526327 3300049576 Bacteria 853
359 Ga0501042_1331406 3300049578 Bacteria 524
360 Ga0501046_0491366 3300049580 Bacteria 880
361 Ga0501047_0000030 3300049581 Bacteria 217207
362 Ga0501072_0969260 3300049588 Bacteria 663
363 Ga0501073_0158078 3300049589 Bacteria 1570
364 Ga0501075_1151279 3300049591 Bacteria 589
365 Ga0501076_0300556 3300049592 Bacteria 1316
366 Ga0501233_078059 3300049668 Bacteria 849
367 Ga0501235_194268 3300049669 Bacteria 547
368 Ga0501242_083263 3300049674 Bacteria 516
369 Ga0501083_0043896 3300049744 Bacteria 3027
370 Ga0501083_0984477 3300049744 Bacteria 549
371 Ga0501268_083966 3300049765 Bacteria 662
372 Ga0501044_0019666 3300049823 Bacteria 7218
373 Ga0501045_0742411 3300049824 Bacteria 724
374 nmdc:mga05p37_1938813_c1 3300050507 Bacteria 560
375 nmdc:mga09592_792054_c1 3300050508 Bacteria 802
376 nmdc:mga0qj67_1235417_c1 3300050509 Bacteria 580
377 nmdc:mga06r32_455946_c1 3300050510 Bacteria 1258
378 nmdc:mga06r32_614859_c1 3300050510 Bacteria 1057
379 nmdc:mga08y16_247214_c1 3300050511 Bacteria 1843
380 nmdc:mga0a205_418493_c1 3300050515 Bacteria 1202
381 Ga0495601_0625860 3300053077 Bacteria 689
382 Ga0500616_0001207 3300053153 Bacteria 26194
383 Ga0500616_0013178 3300053153 Bacteria 4812
384 Ga0590071_088420 3300059421 Bacteria 774
385 Ga0590071_109267 3300059421 Bacteria 701
386 Ga0501082_0010919 3300060353 Bacteria 7816
387 2852678800 2852677369 Bacteria 3768884
388 8002870542 8002869464 Bacteria 3588529
389 8007377189 8007375930 Bacteria 4080554
390 Ga0070664_100784653
391 SwRhRL2b_contig_699088
392 Ga0065714_10361263
393 Ga0065704_10456705
394 Ga0065715_10393925
395 Ga0065707_10291965
396 Ga0070676_10421175
397 Ga0070676_10949284
398 Ga0070670_100371390
399 Ga0070670_100915061
400 Ga0068869_100796331
401 Ga0068869_100998371
402 Ga0070666_10295217
403 Ga0070666_10371879
404 Ga0070666_10382824
405 Ga0070666_10613051
406 Ga0070682_100721412
407 Ga0070682_101473912
408 Ga0070689_100358494
409 Ga0070689_100973579
410 Ga0070687_100359865
411 Ga0070669_100108835
412 Ga0070669_101480730
413 Ga0070675_100358769
414 Ga0070675_100555491
415 Ga0070671_100270682
416 Ga0070671_100583763
417 Ga0070673_100131218
418 Ga0070688_100156424
419 Ga0070688_100309907
420 Ga0070688_100620197
421 Ga0070667_100085324
422 Ga0070701_10035939
423 Ga0070701_10721240
424 Ga0070700_100010437
425 Ga0070700_100112579
426 Ga0070694_100206240
427 Ga0070708_101461632
428 Ga0070663_100103872
429 Ga0070678_100240378
430 Ga0070662_100819313
431 Ga0070662_101595209
432 Ga0068867_100015231
433 Ga0068867_100779611
434 Ga0068867_101029210
435 Ga0068867_102358789
436 Ga0070685_10233899
437 Ga0070685_10461891
438 Ga0070698_100131362
439 Ga0070698_100230316
440 Ga0070698_100277467
441 Ga0074259_10034453
442 Ga0068853_100483216
443 Ga0070672_100096372
444 Ga0070672_100882489
445 Ga0070672_102038000
446 Ga0070686_100020322
447 Ga0070686_100084530
448 Ga0070665_100079756
449 Ga0070704_100086815
450 Ga0070704_100508871
451 Ga0070704_101275182
452 Ga0068855_100109732
453 Ga0068855_100233929
454 Ga0070664_100314501
455 Ga0070664_100587955
456 Ga0068854_101377263
457 Ga0068859_100211550
458 Ga0068859_100657881
459 Ga0068859_101027223
460 Ga0068859_102081543
461 Ga0068859_102088334
462 Ga0068864_100066913
463 Ga0068864_100069465
464 Ga0068864_100274862
465 Ga0068864_101766938
466 Ga0068866_10045347
467 Ga0068861_100730022
468 Ga0068861_101665786
469 Ga0068870_10072132
470 Ga0068870_10312643
471 Ga0068870_10734373
472 Ga0068863_100133445
473 Ga0068863_100335329
474 Ga0068863_101091307
475 Ga0068858_100034737
476 Ga0068858_100350386
477 Ga0068858_101619247
478 Ga0068860_100043624
479 Ga0068860_100230984
480 Ga0068860_100335250
481 Ga0068860_100829845
482 Ga0068862_100123296
483 Ga0068862_100180416
484 Ga0068862_102184826
485 Ga0081455_10000293
486 Ga0081538_10312316
487 Ga0075367_10816400
488 Ga0097621_100122581
489 Ga0097621_100140221
490 Ga0097621_100305219
491 Ga0097621_100381839
492 Ga0068871_100026431
493 Ga0075428_100447483
494 Ga0075428_101308352
495 Ga0075430_100284902
496 Ga0075430_100297580
497 Ga0075430_101343909
498 Ga0075431_100691091
499 Ga0075431_100812690
500 Ga0075433_10560927
501 Ga0075429_100128999
502 Ga0068865_100012536
503 Ga0068865_100032425
504 Ga0075436_101172493
505 Ga0097620_100211550
506 Ga0097620_100657866
507 Ga0097620_101027200
508 Ga0097620_102081541
509 Ga0097620_102088332
510 Ga0105251_10067177
511 Ga0105250_10220175
512 Ga0111539_10207456
513 Ga0111539_12588220
514 Ga0105245_13048057
515 Ga0105247_10024908
516 Ga0105247_10303812
517 Ga0105247_10403041
518 Ga0114129_10854456
519 Ga0114129_10918642
520 Ga0105243_10119552
521 Ga0105243_10432615
522 Ga0105243_10460326
523 Ga0105243_10749900
524 Ga0105243_11224189
525 Ga0105241_10522004
526 Ga0105242_10072409
527 Ga0105242_10343452
528 Ga0105242_11672955
529 Ga0105242_12133963
530 Ga0105248_10238653
531 Ga0105248_10315381
532 Ga0105248_10657771
533 Ga0105248_12037313
534 Ga0105249_10000015
535 Ga0105249_10077654
536 Ga0105249_10122210
537 Ga0105249_10160994
538 Ga0105029_104915
539 Ga0105028_101633
540 Ga0105028_137793
541 Ga0105239_10737412
542 Ga0105246_12137083
543 Ga0157371_11047946
544 Ga0157370_10980585
545 Ga0157374_10212031
546 Ga0157378_10020401
547 Ga0157378_11506183
548 Ga0163162_10040913
549 Ga0163162_10074471
550 Ga0163162_10217625
551 Ga0163162_10544293
552 Ga0163162_11624892
553 Ga0157375_10017608
554 Ga0157375_10038209
555 Ga0157375_11090404
556 Ga0157375_11128615
557 Ga0157375_11983314
558 Ga0157375_13195455
559 Ga0163163_10204118
560 Ga0157380_10393789
561 Ga0157380_11107579
562 Ga0182008_10483799
563 Ga0157377_10075437
564 Ga0157377_11231375
565 Ga0157377_11401711
566 Ga0157379_10018379
567 Ga0157379_10038580
568 Ga0157379_10222636
569 Ga0157376_11085978
570 Ga0157376_12129302
571 Ga0163161_10094310
572 Ga0163161_10400057
573 Ga0163161_11884433
574 Ga0207697_10203210
575 Ga0207682_10021588
576 Ga0207710_10229998
577 Ga0207710_10358459
578 Ga0207680_10029242
579 Ga0207680_10510085
580 Ga0207685_10394255
581 Ga0207643_10076840
582 Ga0207662_10181146
583 Ga0207646_10418412
584 Ga0207650_10059417
585 Ga0207650_10188359
586 Ga0207650_10852345
587 Ga0207650_10962754
588 Ga0207659_10049714
589 Ga0207659_10080403
590 Ga0207659_10171903
591 Ga0207659_10266632
592 Ga0207644_10026878
593 Ga0207644_10212079
594 Ga0207706_10741697
595 Ga0207706_10930706
596 Ga0207706_11343873
597 Ga0207686_10116865
598 Ga0207686_10282692
599 Ga0207686_10896861
600 Ga0207670_10219755
601 Ga0207670_10316929
602 Ga0207670_10942493
603 Ga0207669_10148887
604 Ga0207669_11144030
605 Ga0207704_10052028
606 Ga0207691_10024221
607 Ga0207691_10144172
608 Ga0207691_10370831
609 Ga0207691_10714274
610 Ga0207691_11019028
611 Ga0207711_10088750
612 Ga0207689_11014856
613 Ga0207689_11026219
614 Ga0207679_10682979
615 Ga0207667_10047061
616 Ga0207667_10415175
617 Ga0207651_10081412
618 Ga0207651_10135337
619 Ga0207651_10270419
620 Ga0207651_10928280
621 Ga0207712_10000023
622 Ga0207712_10144682
623 Ga0207712_10171326
624 Ga0207712_10849961
625 Ga0207668_10359858
626 Ga0207668_10523032
627 Ga0207640_10293500
628 Ga0207640_10767738
629 Ga0207658_10011392
630 Ga0207658_10017502
631 Ga0207658_10228228
632 Ga0207658_10286878
633 Ga0207677_10828859
634 Ga0207703_11323024
635 Ga0207703_11664398
636 Ga0207639_10084103
637 Ga0207708_10011409
638 Ga0207708_11004179
639 Ga0207641_10020923
640 Ga0207641_10029410
641 Ga0207641_10048696
642 Ga0207648_10033613
643 Ga0207648_10081224
644 Ga0207648_10722608
645 Ga0207648_10885692
646 Ga0207676_10064274
647 Ga0207676_10338532
648 Ga0207676_11298072
649 Ga0207674_10339637
650 Ga0207675_100739056
651 Ga0207683_10021976
652 Ga0207683_10197103
653 Ga0207683_10898211
654 Ga0210000_1076940
655 Ga0209999_1042603
656 Ga0207428_10222230
657 Ga0207428_10772720
658 Ga0268266_10085058
659 Ga0268266_10567699
660 Ga0268266_10600910
661 Ga0268266_11039339
662 Ga0268265_10118988
663 Ga0268265_10133483
664 Ga0268265_10421815
665 Ga0268265_10619521
666 Ga0268265_10974775
667 Ga0268265_11949806
668 Ga0268265_12287657
669 Ga0268264_10101043
670 Ga0268264_11492774
671 Ga0307515_10494091
672 Ga0265338_10551879
673 Ga0307408_100030383
674 Ga0307405_10047215
675 Ga0307405_10233028
676 Ga0307405_11913577
677 Ga0307413_10059391
678 Ga0307413_10187355
679 Ga0307410_10009091
680 Ga0307410_10012783
681 Ga0307410_10250084
682 Ga0307410_10269666
683 Ga0307410_10511946
684 Ga0307406_10007933
685 Ga0307406_10008348
686 Ga0307406_10088675
687 Ga0307406_10097140
688 Ga0307406_10255272
689 Ga0307407_10021168
690 Ga0307407_10036131
691 Ga0307412_10012498
692 Ga0307412_10014519
693 Ga0307412_11139476
694 Ga0307409_100013288
695 Ga0307409_100280304
696 Ga0307416_100004428
697 Ga0307416_100024487
698 Ga0307416_100044376
699 Ga0307416_100141486
700 Ga0307416_100438839
701 Ga0307414_10115197
702 Ga0307414_10450871
703 Ga0307414_11659935
704 Ga0307411_10011672
705 Ga0307411_10229702
706 Ga0307411_10631787
707 Ga0307411_10867494
708 Ga0307411_10878247
709 Ga0307411_11731319
710 Ga0307415_100013093
711 Ga0307415_100022580
712 Ga0395900_1120963
713 Ga0439436_0160501
714 Ga0439439_0241061
715 Ga0439461_0029308
716 Ga0451791_0707147
717 Ga0451791_1927931
718 Ga0451804_0298187
719 Ga0451807_1105730
720 Ga0439431_0016435
721 Ga0439454_118472
722 Ga0450898_150167
723 Ga0439446_0069808
724 Ga0439458_0165326
725 Ga0439435_0238095
726 Ga0439459_0249931
727 Ga0451577_0024371
728 Ga0453684_0958150
729 Ga0495629_0186399
730 Ga0495606_0002435
731 Ga0495599_0484063
732 Ga0495672_0035349
733 Ga0495686_0000025
734 Ga0496102_0668435
735 Ga0496106_0969495
736 Ga0496108_0510273
737 Ga0496108_0587333
738 Ga0496110_0399924
739 Ga0496111_1048044
740 Ga0501031_0469296
741 Ga0501031_0791968
742 Ga0501036_0091982
743 Ga0501036_0574737
744 Ga0501037_0564184
745 Ga0501038_0074964
746 Ga0501038_0567280
747 Ga0501040_0526327
748 Ga0501042_1331406
749 Ga0501046_0491366
750 Ga0501047_0000030
751 Ga0501072_0969260
752 Ga0501073_0158078
753 Ga0501075_1151279
754 Ga0501076_0300556
755 Ga0501233_078059
756 Ga0501235_194268
757 Ga0501242_083263
758 Ga0501083_0043896
759 Ga0501083_0984477
760 Ga0501268_083966
761 Ga0501044_0019666
762 Ga0501045_0742411
763 nmdc:mga05p37_1938813_c1
764 nmdc:mga09592_792054_c1
765 nmdc:mga0qj67_1235417_c1
766 nmdc:mga06r32_455946_c1
767 nmdc:mga06r32_614859_c1
768 nmdc:mga08y16_247214_c1
769 nmdc:mga0a205_418493_c1
770 Ga0495601_0625860
771 Ga0500616_0001207
772 Ga0500616_0013178
773 Ga0590071_088420
774 Ga0590071_109267
775 Ga0501082_0010919
776 2852678800
777 8002870542
778 8007377189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

21

131

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9464 6 114
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.8845 6 114
2pjq-assembly2.cif.gz_A-2 crystal structure of q88u62_lacpl from lactobacillus plantarum. northeast structural genomics target lpr71 0.2921 3 103
2pjq-assembly2.cif.gz_A-2 crystal structure of q88u62_lacpl from lactobacillus plantarum. northeast structural genomics target lpr71 0.259 3 103
7jjj-assembly1.cif.gz_D structure of sars-cov-2 3q-2p full-length dimers of spike trimers 0.2314 15 114
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.921 1 114 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8835 1 114 1.10.8.290
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.8048 9 114 1.10.8.10
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7935 9 114 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7307 9 116 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A420VH45-F1-model_v4 DUF2200 domain-containing protein 1.003 1 115
AF-G4REE1-F1-model_v4 DUF2200 domain-containing protein 1.003 1 115
AF-A0A1H0EDN8-F1-model_v4 DUF2200 domain-containing protein 1.003 1 95
AF-A0A6B3C8S0-F1-model_v4 DUF2200 domain-containing protein 1.002 1 105
AF-A0A7C4VR17-F1-model_v4 DUF2200 domain-containing protein 1.001 1 116

Map