F431265

General Info

Members Datasets Scaffolds Average Seq Length
388 195 776 117

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0122091|Ga0495619_0122091_1227_1562
Length 111
Sequence MASYSVNEAGFEFARELIAKRQYVLDSEWGAVQPKAAEETAYLGLTDGANDHTKARYAFVFGDFRRIHRSGIIACHYRAAEWRHKEIELAAHELLQLIDEVAPRRPRKRNR

Samples

Sample ID Description Type Environment
1 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
92 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
93 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
94 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
95 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
98 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
99 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
100 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
103 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
104 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
105 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
106 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
107 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
108 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
174 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
175 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
191 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
195 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0.26
Rhizoplane 6.19
Rhizosphere 89.18
Stem 0
Stem Tuber 0
Unclassified 11.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495619_0122091 3300053085 Bacteria 1786
2 JGI25407J50210_10007941 3300003373 Bacteria 2667
3 Ga0070690_100213549 3300005330 Bacteria 1348
4 Ga0070668_100108173 3300005347 Bacteria 2211
5 Ga0070675_101580650 3300005354 Bacteria 605
6 Ga0070713_100095369 3300005436 Bacteria 2566
7 Ga0070713_100576378 3300005436 Bacteria 1067
8 Ga0070708_100189646 3300005445 Bacteria 1923
9 Ga0070663_101773639 3300005455 Bacteria 553
10 Ga0070706_100151774 3300005467 Bacteria 2162
11 Ga0070707_100357528 3300005468 Bacteria 1418
12 Ga0070698_100000308 3300005471 Bacteria 49751
13 Ga0070698_100052464 3300005471 Bacteria 4148
14 Ga0070698_100162391 3300005471 Bacteria 2177
15 Ga0070699_101768836 3300005518 Bacteria 566
16 Ga0070699_102051386 3300005518 Bacteria 523
17 Ga0070679_101256379 3300005530 Bacteria 686
18 Ga0070697_101161774 3300005536 Bacteria 688
19 Ga0070686_100208288 3300005544 Bacteria 1406
20 Ga0070696_100266099 3300005546 Bacteria 1302
21 Ga0070665_100009904 3300005548 Bacteria 9639
22 Ga0070665_100590942 3300005548 Bacteria 1123
23 Ga0070704_100770610 3300005549 Bacteria 858
24 Ga0068854_100752183 3300005578 Bacteria 846
25 Ga0068864_100536957 3300005618 Bacteria 1129
26 Ga0081455_10003888 3300005937 Bacteria 17011
27 Ga0081455_10061658 3300005937 Bacteria 3155
28 Ga0081455_10070762 3300005937 Bacteria 2895
29 Ga0081455_10121148 3300005937 Bacteria 2061
30 Ga0081455_10159499 3300005937 Bacteria 1730
31 Ga0081455_10220763 3300005937 Bacteria 1405
32 Ga0081455_10277980 3300005937 Bacteria 1211
33 Ga0081455_10354870 3300005937 Bacteria 1033
34 Ga0081538_10000191 3300005981 Bacteria 67563
35 Ga0081538_10000334 3300005981 Bacteria 53496
36 Ga0081538_10000466 3300005981 Bacteria 45388
37 Ga0081538_10005338 3300005981 Bacteria 11565
38 Ga0081538_10017851 3300005981 Bacteria 5361
39 Ga0081538_10051036 3300005981 Bacteria 2489
40 Ga0081538_10090789 3300005981 Bacteria 1580
41 Ga0081538_10117790 3300005981 Bacteria 1285
42 Ga0081539_10017137 3300005985 Bacteria 5107
43 Ga0081539_10142153 3300005985 Bacteria 1165
44 Ga0070717_10198928 3300006028 Bacteria 1754
45 Ga0070717_10303130 3300006028 Bacteria 1420
46 Ga0075365_10121883 3300006038 Bacteria 1799
47 Ga0075365_10263809 3300006038 Bacteria 1211
48 Ga0075363_100260681 3300006048 Bacteria 1000
49 Ga0075364_10304029 3300006051 Bacteria 1086
50 Ga0070716_100113467 3300006173 Bacteria 1683
51 Ga0070716_101477306 3300006173 Bacteria 555
52 Ga0070712_100139781 3300006175 Bacteria 1846
53 Ga0075362_10590797 3300006177 Bacteria 573
54 Ga0068871_100790908 3300006358 Bacteria 874
55 Ga0075428_102160650 3300006844 Bacteria 575
56 Ga0075431_100435444 3300006847 Bacteria 1309
57 Ga0075431_100919695 3300006847 Bacteria 844
58 Ga0075434_100859174 3300006871 Bacteria 923
59 Ga0075429_100253766 3300006880 Bacteria 1540
60 Ga0075436_100469719 3300006914 Bacteria 918
61 Ga0075436_101367443 3300006914 Bacteria 536
62 Ga0075435_100348921 3300007076 Bacteria 1268
63 Ga0111539_10032458 3300009094 Bacteria 6340
64 Ga0111539_10052257 3300009094 Bacteria 4865
65 Ga0111539_10401407 3300009094 Bacteria 1597
66 Ga0111539_10468711 3300009094 Bacteria 1466
67 Ga0111539_11105678 3300009094 Unclassified 921
68 Ga0114129_10066148 3300009147 Bacteria 5042
69 Ga0114129_10072069 3300009147 Bacteria 4817
70 Ga0114129_10569491 3300009147 Unclassified 1471
71 Ga0114129_11348794 3300009147 Bacteria 882
72 Ga0105243_10346404 3300009148 Bacteria 1363
73 Ga0105249_10981640 3300009553 Bacteria 913
74 Ga0105249_11710973 3300009553 Bacteria 701
75 Ga0105239_10336284 3300010375 Unclassified 1704
76 Ga0105239_11306860 3300010375 Unclassified 837
77 Ga0105246_10670690 3300011119 Bacteria 905
78 Ga0157369_11812081 3300013105 Bacteria 620
79 Ga0157378_10034403 3300013297 Bacteria 4481
80 Ga0157378_10342740 3300013297 Bacteria 1458
81 Ga0163162_10993964 3300013306 Bacteria 948
82 Ga0157372_10214686 3300013307 Bacteria 2230
83 Ga0157372_12727987 3300013307 Bacteria 567
84 Ga0157375_12973926 3300013308 Bacteria 566
85 Ga0163163_10164087 3300014325 Bacteria 2267
86 Ga0163163_10275233 3300014325 Bacteria 1734
87 Ga0163163_11145584 3300014325 Bacteria 840
88 Ga0157380_10193919 3300014326 Bacteria 1796
89 Ga0157380_11043958 3300014326 Bacteria 853
90 Ga0157376_10436066 3300014969 Bacteria 1275
91 Ga0157376_12321674 3300014969 Bacteria 576
92 Ga0163161_10188442 3300017792 Bacteria 1585
93 Ga0163161_11038741 3300017792 Bacteria 701
94 Ga0207672_1003814 3300025223 Bacteria 858
95 Ga0207699_10018041 3300025906 Bacteria 3731
96 Ga0207684_10013739 3300025910 Bacteria 6994
97 Ga0207684_10803117 3300025910 Bacteria 795
98 Ga0207652_10417276 3300025921 Bacteria 1211
99 Ga0207652_11309713 3300025921 Bacteria 627
100 Ga0207646_10014248 3300025922 Bacteria 7559
101 Ga0207687_10157587 3300025927 Bacteria 1739
102 Ga0207700_10529051 3300025928 Bacteria 1045
103 Ga0207706_10055711 3300025933 Bacteria 3486
104 Ga0207706_10224856 3300025933 Bacteria 1643
105 Ga0207709_10168332 3300025935 Bacteria 1535
106 Ga0207665_10004225 3300025939 Bacteria 9558
107 Ga0207689_10224269 3300025942 Bacteria 1553
108 Ga0207668_10424821 3300025972 Bacteria 1129
109 Ga0207658_11068842 3300025986 Bacteria 737
110 Ga0207677_10636121 3300026023 Bacteria 940
111 Ga0207677_11535775 3300026023 Bacteria 615
112 Ga0207678_10765804 3300026067 Unclassified 851
113 Ga0207708_10797471 3300026075 Bacteria 813
114 Ga0207702_12376433 3300026078 Bacteria 517
115 Ga0207676_10643096 3300026095 Bacteria 1023
116 Ga0207676_10849343 3300026095 Bacteria 893
117 Ga0207428_10108347 3300027907 Bacteria 2140
118 Ga0268266_10027792 3300028379 Bacteria 4809
119 Ga0268266_11204215 3300028379 Unclassified 732
120 Ga0307408_100268261 3300031548 Unclassified 1416
121 Ga0307408_100642666 3300031548 Bacteria 948
122 Ga0307405_11202990 3300031731 Bacteria 655
123 Ga0307410_10316333 3300031852 Bacteria 1237
124 Ga0307410_10725261 3300031852 Bacteria 840
125 Ga0307406_10011855 3300031901 Bacteria 4954
126 Ga0307406_10713032 3300031901 Unclassified 839
127 Ga0307407_10112710 3300031903 Bacteria 1710
128 Ga0307407_10199067 3300031903 Bacteria 1341
129 Ga0307407_10252322 3300031903 Bacteria 1209
130 Ga0307407_10308677 3300031903 Bacteria 1106
131 Ga0307412_10294994 3300031911 Bacteria 1279
132 Ga0307412_10458342 3300031911 Bacteria 1052
133 Ga0307412_10738063 3300031911 Bacteria 849
134 Ga0307409_100070096 3300031995 Bacteria 2781
135 Ga0307409_100085033 3300031995 Bacteria 2570
136 Ga0307409_100346485 3300031995 Bacteria 1400
137 Ga0307409_100576774 3300031995 Bacteria 1108
138 Ga0307416_100001212 3300032002 Bacteria 13896
139 Ga0307416_100059533 3300032002 Bacteria 3104
140 Ga0307416_100374284 3300032002 Bacteria 1451
141 Ga0307416_101063661 3300032002 Bacteria 913
142 Ga0307414_10285526 3300032004 Bacteria 1389
143 Ga0307411_10210074 3300032005 Bacteria 1502
144 Ga0307415_100082779 3300032126 Bacteria 2297
145 Ga0307415_100175773 3300032126 Bacteria 1675
146 Ga0307415_100200456 3300032126 Bacteria 1583
147 Ga0307415_100937787 3300032126 Bacteria 800
148 Ga0373938_0186016 3300034957 Bacteria 569
149 Ga0373935_1222471 3300035692 Bacteria 560
150 Ga0395899_0157084 3300037312 Bacteria 1609
151 Ga0395899_0587630 3300037312 Bacteria 711
152 Ga0395900_0140509 3300037418 Bacteria 2473
153 Ga0395900_0457903 3300037418 Unclassified 1231
154 Ga0395900_0503378 3300037418 Bacteria 1161
155 Ga0395900_0661987 3300037418 Bacteria 980
156 Ga0395898_0203470 3300037466 Bacteria 1890
157 Ga0395898_0205716 3300037466 Bacteria 1878
158 Ga0395898_0310452 3300037466 Bacteria 1504
159 Ga0395898_1459252 3300037466 Archaea 611
160 Ga0436364_1105028 3300037853 Bacteria 1371
161 Ga0395901_0244558 3300038443 Bacteria 1870
162 Ga0395901_0325231 3300038443 Bacteria 1590
163 Ga0395901_1069110 3300038443 Unclassified 779
164 Ga0439461_0186749 3300041410 Bacteria 551
165 Ga0439466_0226579 3300041411 Bacteria 567
166 Ga0439465_0284577 3300041413 Bacteria 616
167 Ga0451837_0461387 3300041494 Unclassified 588
168 Ga0451855_1592581 3300041511 Bacteria 683
169 Ga0451853_1515634 3300041512 Bacteria 651
170 Ga0439431_0003727 3300041997 Bacteria 3368
171 Ga0439442_002880 3300042002 Bacteria 3388
172 Ga0439445_0023124 3300042004 Bacteria 1572
173 Ga0439448_0024970 3300042005 Bacteria 1872
174 Ga0439448_0031497 3300042005 Bacteria 1685
175 Ga0439450_054143 3300042008 Unclassified 959
176 Ga0439450_096935 3300042008 Unclassified 745
177 Ga0439457_017933 3300042014 Bacteria 1571
178 Ga0439463_043543 3300042016 Unclassified 1143
179 Ga0450920_021670 3300042122 Bacteria 1243
180 Ga0450888_022298 3300042126 Bacteria 812
181 Ga0450906_072856 3300042145 Bacteria 616
182 Ga0439446_0067676 3300042156 Bacteria 1088
183 Ga0439458_0035333 3300042157 Bacteria 1201
184 Ga0439434_0008361 3300042435 Bacteria 3033
185 Ga0439464_0318492 3300042439 Unclassified 510
186 Ga0451577_0682134 3300042876 Unclassified 931
187 Ga0466960_0083587 3300044901 Bacteria 1614
188 Ga0451576_1832795 3300045051 Bacteria 627
189 Ga0466967_0041752 3300045976 Bacteria 3958
190 Ga0495664_0011808 3300046477 Bacteria 4933
191 Ga0495664_0953914 3300046477 Bacteria 500
192 Ga0495584_0045267 3300046491 Bacteria 2220
193 Ga0495607_0120143 3300046501 Bacteria 1381
194 Ga0495631_0378824 3300046518 Unclassified 602
195 Ga0495631_0417033 3300046518 Bacteria 572
196 Ga0495637_0018685 3300046520 Bacteria 3212
197 Ga0495652_0740575 3300046529 Bacteria 658
198 Ga0495586_0631198 3300046535 Bacteria 619
199 Ga0495609_0082240 3300046538 Unclassified 1407
200 Ga0495645_0023665 3300046543 Bacteria 4450
201 Ga0495656_0292410 3300046615 Bacteria 833
202 Ga0495656_0337891 3300046615 Unclassified 778
203 Ga0495668_0361810 3300046616 Bacteria 797
204 Ga0495670_0085739 3300046691 Bacteria 1608
205 Ga0495671_0267094 3300046692 Bacteria 825
206 Ga0495589_0070025 3300046794 Bacteria 1715
207 Ga0496100_0242904 3300048903 Bacteria 1329
208 Ga0496101_0050500 3300048904 Bacteria 2994
209 Ga0496101_0654173 3300048904 Bacteria 830
210 Ga0496102_0014513 3300048905 Bacteria 6845
211 Ga0496102_0046479 3300048905 Bacteria 3943
212 Ga0496103_0007486 3300048906 Bacteria 6506
213 Ga0496104_0264629 3300048907 Bacteria 1632
214 Ga0496104_0317143 3300048907 Bacteria 1472
215 Ga0496106_0288984 3300048909 Bacteria 1314
216 Ga0496107_0018981 3300048910 Bacteria 4848
217 Ga0496107_0333960 3300048910 Bacteria 1128
218 Ga0496107_0418607 3300048910 Bacteria 996
219 Ga0496109_0028533 3300048912 Bacteria 4992
220 Ga0496109_0184571 3300048912 Bacteria 1960
221 Ga0496110_0017236 3300048913 Bacteria 6041
222 Ga0496111_0568306 3300048914 Unclassified 832
223 Ga0496112_0301943 3300048915 Bacteria 1546
224 Ga0496113_0031047 3300048916 Bacteria 3874
225 Ga0496113_0094793 3300048916 Bacteria 2306
226 Ga0496113_0380305 3300048916 Bacteria 1133
227 Ga0496114_0020306 3300048917 Bacteria 5391
228 Ga0496114_0401082 3300048917 Bacteria 1214
229 Ga0496115_0423688 3300048918 Bacteria 1078
230 Ga0496115_1210490 3300048918 Unclassified 567
231 Ga0501031_0015043 3300049568 Bacteria 5026
232 Ga0501031_0204628 3300049568 Bacteria 1287
233 Ga0501031_0300116 3300049568 Unclassified 1041
234 Ga0501031_0354331 3300049568 Bacteria 950
235 Ga0501031_0511299 3300049568 Bacteria 774
236 Ga0501031_0730248 3300049568 Unclassified 635
237 Ga0501032_0570214 3300049569 Bacteria 721
238 Ga0501033_1108949 3300049570 Bacteria 526
239 Ga0501033_1151735 3300049570 Bacteria 515
240 Ga0501034_0565927 3300049571 Bacteria 1045
241 Ga0501036_0002812 3300049572 Bacteria 13790
242 Ga0501036_0274875 3300049572 Unclassified 1410
243 Ga0501036_0350542 3300049572 Unclassified 1233
244 Ga0501036_0786600 3300049572 Bacteria 784
245 Ga0501037_0028209 3300049573 Bacteria 4147
246 Ga0501038_0011086 3300049574 Bacteria 8232
247 Ga0501038_0041058 3300049574 Bacteria 4036
248 Ga0501038_0814298 3300049574 Bacteria 693
249 Ga0501039_0004165 3300049575 Bacteria 10883
250 Ga0501039_0178435 3300049575 Bacteria 1670
251 Ga0501040_0000066 3300049576 Bacteria 50854
252 Ga0501040_0058578 3300049576 Bacteria 2645
253 Ga0501040_0121538 3300049576 Bacteria 1832
254 Ga0501040_0658950 3300049576 Bacteria 757
255 Ga0501040_0759118 3300049576 Bacteria 702
256 Ga0501040_0838954 3300049576 Unclassified 665
257 Ga0501041_0000152 3300049577 Bacteria 30395
258 Ga0501041_0042467 3300049577 Bacteria 2763
259 Ga0501041_0093224 3300049577 Bacteria 1860
260 Ga0501042_0000037 3300049578 Bacteria 43512
261 Ga0501042_0139519 3300049578 Bacteria 1747
262 Ga0501042_0390520 3300049578 Bacteria 1008
263 Ga0501042_0452539 3300049578 Bacteria 931
264 Ga0501042_0523870 3300049578 Bacteria 861
265 Ga0501043_0007030 3300049579 Bacteria 8958
266 Ga0501043_0623314 3300049579 Unclassified 795
267 Ga0501046_0000639 3300049580 Bacteria 34274
268 Ga0501046_0711790 3300049580 Bacteria 707
269 Ga0501046_1092724 3300049580 Unclassified 551
270 Ga0501048_0001382 3300049582 Bacteria 18381
271 Ga0501048_0106212 3300049582 Bacteria 1982
272 Ga0501048_0334481 3300049582 Bacteria 1079
273 Ga0501048_0758066 3300049582 Bacteria 697
274 Ga0501048_0994870 3300049582 Bacteria 603
275 Ga0501067_0012491 3300049583 Bacteria 4710
276 Ga0501067_0529674 3300049583 Bacteria 659
277 Ga0501068_0013385 3300049584 Bacteria 4667
278 Ga0501068_0044151 3300049584 Bacteria 2683
279 Ga0501069_0030212 3300049585 Bacteria 2975
280 Ga0501069_0043792 3300049585 Bacteria 2478
281 Ga0501069_0104490 3300049585 Bacteria 1610
282 Ga0501070_0232568 3300049586 Bacteria 1510
283 Ga0501070_0389436 3300049586 Bacteria 1128
284 Ga0501071_0035904 3300049587 Bacteria 3533
285 Ga0501071_0050545 3300049587 Bacteria 2994
286 Ga0501071_0290135 3300049587 Bacteria 1239
287 Ga0501071_0367967 3300049587 Bacteria 1095
288 Ga0501071_0501853 3300049587 Bacteria 931
289 Ga0501071_0521933 3300049587 Bacteria 911
290 Ga0501071_0538390 3300049587 Bacteria 896
291 Ga0501072_0003233 3300049588 Bacteria 12228
292 Ga0501072_0049926 3300049588 Bacteria 3294
293 Ga0501072_0691764 3300049588 Unclassified 802
294 Ga0501073_0377703 3300049589 Bacteria 979
295 Ga0501074_0000293 3300049590 Bacteria 28811
296 Ga0501074_0674491 3300049590 Unclassified 730
297 Ga0501074_0775914 3300049590 Bacteria 676
298 Ga0501075_0002571 3300049591 Bacteria 12100
299 Ga0501075_0022265 3300049591 Bacteria 4627
300 Ga0501075_0104368 3300049591 Bacteria 2154
301 Ga0501075_0531524 3300049591 Unclassified 897
302 Ga0501075_0964481 3300049591 Bacteria 648
303 Ga0501075_0973592 3300049591 Bacteria 645
304 Ga0501075_1160350 3300049591 Unclassified 586
305 Ga0501076_0003168 3300049592 Bacteria 11472
306 Ga0501076_0023012 3300049592 Bacteria 4796
307 Ga0501076_0035584 3300049592 Bacteria 3896
308 Ga0501076_0137061 3300049592 Bacteria 1987
309 Ga0501076_0398029 3300049592 Bacteria 1132
310 Ga0501076_0463329 3300049592 Unclassified 1044
311 Ga0501076_0810401 3300049592 Bacteria 772
312 Ga0501077_0006052 3300049593 Bacteria 7385
313 Ga0501201_038665 3300049651 Unclassified 567
314 Ga0501079_0000903 3300049741 Bacteria 20342
315 Ga0501079_0091924 3300049741 Bacteria 2351
316 Ga0501079_0189157 3300049741 Bacteria 1606
317 Ga0501079_0192687 3300049741 Bacteria 1591
318 Ga0501079_0311512 3300049741 Bacteria 1232
319 Ga0501079_1119415 3300049741 Bacteria 620
320 Ga0501080_0453700 3300049742 Bacteria 1149
321 Ga0501080_0566103 3300049742 Bacteria 1011
322 Ga0501080_0860990 3300049742 Bacteria 792
323 Ga0501081_0023519 3300049743 Bacteria 4130
324 Ga0501081_0266065 3300049743 Bacteria 1253
325 Ga0501081_0323244 3300049743 Bacteria 1134
326 Ga0501081_0372051 3300049743 Bacteria 1055
327 Ga0501081_0835828 3300049743 Bacteria 693
328 Ga0501083_0227382 3300049744 Bacteria 1215
329 Ga0501083_0285924 3300049744 Bacteria 1072
330 Ga0501083_1047082 3300049744 Unclassified 531
331 Ga0501232_099855 3300049757 Unclassified 505
332 Ga0501266_062100 3300049763 Unclassified 600
333 Ga0501279_053683 3300049775 Unclassified 645
334 Ga0501035_0037087 3300049822 Bacteria 4416
335 Ga0501035_0274564 3300049822 Bacteria 1426
336 Ga0501044_0219993 3300049823 Bacteria 1850
337 Ga0501045_0000790 3300049824 Bacteria 20394
338 Ga0501045_0041483 3300049824 Bacteria 3349
339 Ga0501045_0162991 3300049824 Bacteria 1660
340 Ga0501045_0196255 3300049824 Bacteria 1504
341 Ga0501045_0285383 3300049824 Bacteria 1229
342 Ga0501045_0321254 3300049824 Unclassified 1152
343 Ga0501045_1275031 3300049824 Unclassified 535
344 nmdc:mga03n38_493626_c1 3300050490 Bacteria 686
345 nmdc:mga03n38_510082_c1 3300050490 Bacteria 676
346 nmdc:mga00v17_350728_c1 3300050491 Bacteria 959
347 nmdc:mga0yw44_178445_c1 3300050492 Bacteria 1397
348 nmdc:mga0yw44_211734_c1 3300050492 Bacteria 1282
349 nmdc:mga05p37_44729_c1 3300050507 Bacteria 5447
350 nmdc:mga05p37_98442_c1 3300050507 Bacteria 3602
351 nmdc:mga09592_250841_c1 3300050508 Bacteria 1534
352 nmdc:mga0qj67_349796_c1 3300050509 Bacteria 1195
353 nmdc:mga06r32_1228269_c1 3300050510 Bacteria 695
354 nmdc:mga06r32_852985_c1 3300050510 Bacteria 869
355 nmdc:mga08y16_421118_c1 3300050511 Bacteria 1365
356 nmdc:mga08y16_573799_c1 3300050511 Unclassified 1140
357 nmdc:mga08y16_634030_c1 3300050511 Bacteria 1074
358 nmdc:mga08y16_881553_c1 3300050511 Bacteria 882
359 nmdc:mga08x19_212825_c1 3300050514 Bacteria 1327
360 Ga0495655_0041086 3300053083 Bacteria 1181
361 Ga0500643_159169 3300053087 Bacteria 606
362 Ga0500655_034640 3300053133 Bacteria 980
363 Ga0500573_0042231 3300053140 Bacteria 2633
364 Ga0501084_0001131 3300054114 Bacteria 20802
365 Ga0501084_0034784 3300054114 Bacteria 4213
366 Ga0501084_0060790 3300054114 Bacteria 3163
367 Ga0501084_0408978 3300054114 Bacteria 1147
368 Ga0501084_0582768 3300054114 Bacteria 945
369 Ga0501084_0761838 3300054114 Bacteria 815
370 Ga0501084_0809553 3300054114 Unclassified 789
371 Ga0501084_0939280 3300054114 Unclassified 727
372 Ga0501084_1697010 3300054114 Bacteria 528
373 Ga0501082_0001036 3300060353 Bacteria 24575
374 Ga0501082_0024509 3300060353 Bacteria 5201
375 Ga0501082_0062954 3300060353 Bacteria 3194
376 Ga0501082_0767334 3300060353 Unclassified 844
377 Ga0501082_0857631 3300060353 Bacteria 794
378 Ga0501082_1779381 3300060353 Bacteria 537
379 Ga0530510_0003732 3300061734 Bacteria 10483
380 Ga0530510_0007350 3300061734 Bacteria 7669
381 Ga0530510_0018813 3300061734 Bacteria 4898
382 Ga0530510_0027515 3300061734 Bacteria 4073
383 Ga0530510_0221568 3300061734 Bacteria 1406
384 Ga0530510_0260796 3300061734 Bacteria 1292
385 Ga0530510_0743263 3300061734 Unclassified 748
386 Ga0530510_0766212 3300061734 Bacteria 736
387 Ga0530510_1377306 3300061734 Bacteria 541
388 8054611148 8054609563 Bacteria 5170090
389 Ga0495619_0122091
390 JGI25407J50210_10007941
391 Ga0070690_100213549
392 Ga0070668_100108173
393 Ga0070675_101580650
394 Ga0070713_100095369
395 Ga0070713_100576378
396 Ga0070708_100189646
397 Ga0070663_101773639
398 Ga0070706_100151774
399 Ga0070707_100357528
400 Ga0070698_100000308
401 Ga0070698_100052464
402 Ga0070698_100162391
403 Ga0070699_101768836
404 Ga0070699_102051386
405 Ga0070679_101256379
406 Ga0070697_101161774
407 Ga0070686_100208288
408 Ga0070696_100266099
409 Ga0070665_100009904
410 Ga0070665_100590942
411 Ga0070704_100770610
412 Ga0068854_100752183
413 Ga0068864_100536957
414 Ga0081455_10003888
415 Ga0081455_10061658
416 Ga0081455_10070762
417 Ga0081455_10121148
418 Ga0081455_10159499
419 Ga0081455_10220763
420 Ga0081455_10277980
421 Ga0081455_10354870
422 Ga0081538_10000191
423 Ga0081538_10000334
424 Ga0081538_10000466
425 Ga0081538_10005338
426 Ga0081538_10017851
427 Ga0081538_10051036
428 Ga0081538_10090789
429 Ga0081538_10117790
430 Ga0081539_10017137
431 Ga0081539_10142153
432 Ga0070717_10198928
433 Ga0070717_10303130
434 Ga0075365_10121883
435 Ga0075365_10263809
436 Ga0075363_100260681
437 Ga0075364_10304029
438 Ga0070716_100113467
439 Ga0070716_101477306
440 Ga0070712_100139781
441 Ga0075362_10590797
442 Ga0068871_100790908
443 Ga0075428_102160650
444 Ga0075431_100435444
445 Ga0075431_100919695
446 Ga0075434_100859174
447 Ga0075429_100253766
448 Ga0075436_100469719
449 Ga0075436_101367443
450 Ga0075435_100348921
451 Ga0111539_10032458
452 Ga0111539_10052257
453 Ga0111539_10401407
454 Ga0111539_10468711
455 Ga0111539_11105678
456 Ga0114129_10066148
457 Ga0114129_10072069
458 Ga0114129_10569491
459 Ga0114129_11348794
460 Ga0105243_10346404
461 Ga0105249_10981640
462 Ga0105249_11710973
463 Ga0105239_10336284
464 Ga0105239_11306860
465 Ga0105246_10670690
466 Ga0157369_11812081
467 Ga0157378_10034403
468 Ga0157378_10342740
469 Ga0163162_10993964
470 Ga0157372_10214686
471 Ga0157372_12727987
472 Ga0157375_12973926
473 Ga0163163_10164087
474 Ga0163163_10275233
475 Ga0163163_11145584
476 Ga0157380_10193919
477 Ga0157380_11043958
478 Ga0157376_10436066
479 Ga0157376_12321674
480 Ga0163161_10188442
481 Ga0163161_11038741
482 Ga0207672_1003814
483 Ga0207699_10018041
484 Ga0207684_10013739
485 Ga0207684_10803117
486 Ga0207652_10417276
487 Ga0207652_11309713
488 Ga0207646_10014248
489 Ga0207687_10157587
490 Ga0207700_10529051
491 Ga0207706_10055711
492 Ga0207706_10224856
493 Ga0207709_10168332
494 Ga0207665_10004225
495 Ga0207689_10224269
496 Ga0207668_10424821
497 Ga0207658_11068842
498 Ga0207677_10636121
499 Ga0207677_11535775
500 Ga0207678_10765804
501 Ga0207708_10797471
502 Ga0207702_12376433
503 Ga0207676_10643096
504 Ga0207676_10849343
505 Ga0207428_10108347
506 Ga0268266_10027792
507 Ga0268266_11204215
508 Ga0307408_100268261
509 Ga0307408_100642666
510 Ga0307405_11202990
511 Ga0307410_10316333
512 Ga0307410_10725261
513 Ga0307406_10011855
514 Ga0307406_10713032
515 Ga0307407_10112710
516 Ga0307407_10199067
517 Ga0307407_10252322
518 Ga0307407_10308677
519 Ga0307412_10294994
520 Ga0307412_10458342
521 Ga0307412_10738063
522 Ga0307409_100070096
523 Ga0307409_100085033
524 Ga0307409_100346485
525 Ga0307409_100576774
526 Ga0307416_100001212
527 Ga0307416_100059533
528 Ga0307416_100374284
529 Ga0307416_101063661
530 Ga0307414_10285526
531 Ga0307411_10210074
532 Ga0307415_100082779
533 Ga0307415_100175773
534 Ga0307415_100200456
535 Ga0307415_100937787
536 Ga0373938_0186016
537 Ga0373935_1222471
538 Ga0395899_0157084
539 Ga0395899_0587630
540 Ga0395900_0140509
541 Ga0395900_0457903
542 Ga0395900_0503378
543 Ga0395900_0661987
544 Ga0395898_0203470
545 Ga0395898_0205716
546 Ga0395898_0310452
547 Ga0395898_1459252
548 Ga0436364_1105028
549 Ga0395901_0244558
550 Ga0395901_0325231
551 Ga0395901_1069110
552 Ga0439461_0186749
553 Ga0439466_0226579
554 Ga0439465_0284577
555 Ga0451837_0461387
556 Ga0451855_1592581
557 Ga0451853_1515634
558 Ga0439431_0003727
559 Ga0439442_002880
560 Ga0439445_0023124
561 Ga0439448_0024970
562 Ga0439448_0031497
563 Ga0439450_054143
564 Ga0439450_096935
565 Ga0439457_017933
566 Ga0439463_043543
567 Ga0450920_021670
568 Ga0450888_022298
569 Ga0450906_072856
570 Ga0439446_0067676
571 Ga0439458_0035333
572 Ga0439434_0008361
573 Ga0439464_0318492
574 Ga0451577_0682134
575 Ga0466960_0083587
576 Ga0451576_1832795
577 Ga0466967_0041752
578 Ga0495664_0011808
579 Ga0495664_0953914
580 Ga0495584_0045267
581 Ga0495607_0120143
582 Ga0495631_0378824
583 Ga0495631_0417033
584 Ga0495637_0018685
585 Ga0495652_0740575
586 Ga0495586_0631198
587 Ga0495609_0082240
588 Ga0495645_0023665
589 Ga0495656_0292410
590 Ga0495656_0337891
591 Ga0495668_0361810
592 Ga0495670_0085739
593 Ga0495671_0267094
594 Ga0495589_0070025
595 Ga0496100_0242904
596 Ga0496101_0050500
597 Ga0496101_0654173
598 Ga0496102_0014513
599 Ga0496102_0046479
600 Ga0496103_0007486
601 Ga0496104_0264629
602 Ga0496104_0317143
603 Ga0496106_0288984
604 Ga0496107_0018981
605 Ga0496107_0333960
606 Ga0496107_0418607
607 Ga0496109_0028533
608 Ga0496109_0184571
609 Ga0496110_0017236
610 Ga0496111_0568306
611 Ga0496112_0301943
612 Ga0496113_0031047
613 Ga0496113_0094793
614 Ga0496113_0380305
615 Ga0496114_0020306
616 Ga0496114_0401082
617 Ga0496115_0423688
618 Ga0496115_1210490
619 Ga0501031_0015043
620 Ga0501031_0204628
621 Ga0501031_0300116
622 Ga0501031_0354331
623 Ga0501031_0511299
624 Ga0501031_0730248
625 Ga0501032_0570214
626 Ga0501033_1108949
627 Ga0501033_1151735
628 Ga0501034_0565927
629 Ga0501036_0002812
630 Ga0501036_0274875
631 Ga0501036_0350542
632 Ga0501036_0786600
633 Ga0501037_0028209
634 Ga0501038_0011086
635 Ga0501038_0041058
636 Ga0501038_0814298
637 Ga0501039_0004165
638 Ga0501039_0178435
639 Ga0501040_0000066
640 Ga0501040_0058578
641 Ga0501040_0121538
642 Ga0501040_0658950
643 Ga0501040_0759118
644 Ga0501040_0838954
645 Ga0501041_0000152
646 Ga0501041_0042467
647 Ga0501041_0093224
648 Ga0501042_0000037
649 Ga0501042_0139519
650 Ga0501042_0390520
651 Ga0501042_0452539
652 Ga0501042_0523870
653 Ga0501043_0007030
654 Ga0501043_0623314
655 Ga0501046_0000639
656 Ga0501046_0711790
657 Ga0501046_1092724
658 Ga0501048_0001382
659 Ga0501048_0106212
660 Ga0501048_0334481
661 Ga0501048_0758066
662 Ga0501048_0994870
663 Ga0501067_0012491
664 Ga0501067_0529674
665 Ga0501068_0013385
666 Ga0501068_0044151
667 Ga0501069_0030212
668 Ga0501069_0043792
669 Ga0501069_0104490
670 Ga0501070_0232568
671 Ga0501070_0389436
672 Ga0501071_0035904
673 Ga0501071_0050545
674 Ga0501071_0290135
675 Ga0501071_0367967
676 Ga0501071_0501853
677 Ga0501071_0521933
678 Ga0501071_0538390
679 Ga0501072_0003233
680 Ga0501072_0049926
681 Ga0501072_0691764
682 Ga0501073_0377703
683 Ga0501074_0000293
684 Ga0501074_0674491
685 Ga0501074_0775914
686 Ga0501075_0002571
687 Ga0501075_0022265
688 Ga0501075_0104368
689 Ga0501075_0531524
690 Ga0501075_0964481
691 Ga0501075_0973592
692 Ga0501075_1160350
693 Ga0501076_0003168
694 Ga0501076_0023012
695 Ga0501076_0035584
696 Ga0501076_0137061
697 Ga0501076_0398029
698 Ga0501076_0463329
699 Ga0501076_0810401
700 Ga0501077_0006052
701 Ga0501201_038665
702 Ga0501079_0000903
703 Ga0501079_0091924
704 Ga0501079_0189157
705 Ga0501079_0192687
706 Ga0501079_0311512
707 Ga0501079_1119415
708 Ga0501080_0453700
709 Ga0501080_0566103
710 Ga0501080_0860990
711 Ga0501081_0023519
712 Ga0501081_0266065
713 Ga0501081_0323244
714 Ga0501081_0372051
715 Ga0501081_0835828
716 Ga0501083_0227382
717 Ga0501083_0285924
718 Ga0501083_1047082
719 Ga0501232_099855
720 Ga0501266_062100
721 Ga0501279_053683
722 Ga0501035_0037087
723 Ga0501035_0274564
724 Ga0501044_0219993
725 Ga0501045_0000790
726 Ga0501045_0041483
727 Ga0501045_0162991
728 Ga0501045_0196255
729 Ga0501045_0285383
730 Ga0501045_0321254
731 Ga0501045_1275031
732 nmdc:mga03n38_493626_c1
733 nmdc:mga03n38_510082_c1
734 nmdc:mga00v17_350728_c1
735 nmdc:mga0yw44_178445_c1
736 nmdc:mga0yw44_211734_c1
737 nmdc:mga05p37_44729_c1
738 nmdc:mga05p37_98442_c1
739 nmdc:mga09592_250841_c1
740 nmdc:mga0qj67_349796_c1
741 nmdc:mga06r32_1228269_c1
742 nmdc:mga06r32_852985_c1
743 nmdc:mga08y16_421118_c1
744 nmdc:mga08y16_573799_c1
745 nmdc:mga08y16_634030_c1
746 nmdc:mga08y16_881553_c1
747 nmdc:mga08x19_212825_c1
748 Ga0495655_0041086
749 Ga0500643_159169
750 Ga0500655_034640
751 Ga0500573_0042231
752 Ga0501084_0001131
753 Ga0501084_0034784
754 Ga0501084_0060790
755 Ga0501084_0408978
756 Ga0501084_0582768
757 Ga0501084_0761838
758 Ga0501084_0809553
759 Ga0501084_0939280
760 Ga0501084_1697010
761 Ga0501082_0001036
762 Ga0501082_0024509
763 Ga0501082_0062954
764 Ga0501082_0767334
765 Ga0501082_0857631
766 Ga0501082_1779381
767 Ga0530510_0003732
768 Ga0530510_0007350
769 Ga0530510_0018813
770 Ga0530510_0027515
771 Ga0530510_0221568
772 Ga0530510_0260796
773 Ga0530510_0743263
774 Ga0530510_0766212
775 Ga0530510_1377306
776 8054611148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uhs-assembly1.cif.gz_B structure of a semisweet d57a mutant 0.9585 82 114
4rng-assembly4.cif.gz_C-2 crystal structure of a bacterial homologue of sweet transporters 0.9397 82 111
4rng-assembly2.cif.gz_D crystal structure of a bacterial homologue of sweet transporters 0.9378 82 111
1f4n-assembly1.cif.gz_A c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9319 82 114
1f4m-assembly1.cif.gz_A p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9151 82 114
ID Description Score Start End Superfamily
af_A0A0P0XZW1_99_244_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.9914 85 114 1.25.40.180
af_Q9UTL6_144_225_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.9831 82 113 1.20.1280.20
5jajA03 Mainly Alpha;Up-down Bundle;phosphoenolpyruvate carboxylase, domain 3; 0.9713 82 114 1.20.1320.30
5uhsB00 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9585 82 114 1.20.1280.290
af_A0A1D6HL30_276_425_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9502 82 111 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A7V8Z5C6-F1-model_v4 Uncharacterized protein 0.9983 1 99
AF-A0A6V8KPL8-F1-model_v4 Uncharacterized protein 0.997 1 116
AF-A0A4Q7UT68-F1-model_v4 Uncharacterized protein 0.997 1 113
AF-A0A370CQB0-F1-model_v4 deleted 0.9968 1 115
AF-A0A7Y6A751-F1-model_v4 DUF3806 domain-containing protein 0.9957 1 116

Map