F431214

General Info

Members Datasets Scaffolds Average Seq Length
388 213 377 224

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0033430|Ga0495606_0033430_1219_1974
Length 251
Sequence LKPSRKKAWIPACAGTSGGEGSGYDEKASPVPLPRIVKAVVFDMDGLLVDTEQVVFQAMVASARGGGREMPFDLFQRLVGLPGHVSDPIVVEHFGAGFDLARWRDGVSHHFMEIAAAGIALKTGVVELLDVLDARALPRAVATSSTRQAVDHSLGQHGLVERLGAIISRELQTHHKPHPDPFLKAAAALGIAPQDCLALEDSHNGVRAAAAAGMMTIMVPDLLDPTEEMHELAVHIALDLHEVRAMIEAQR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
4 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
5 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
6 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
7 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
8 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
119 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
197 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
200 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
209 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
210 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
211 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.4
Nodule 1.55
Rhizoplane 3.35
Rhizosphere 74.23
Stem 0
Stem Tuber 0
Unclassified 7.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10000091 3300003791 Bacteria 78039
2 Ga0055531_10002140 3300003794 Bacteria 13526
3 Ga0055531_10039072 3300003794 Bacteria 1414
4 Ga0065165_1000528 3300005262 Bacteria 58452
5 Ga0065165_1009366 3300005262 Bacteria 4403
6 Ga0070658_10429151 3300005327 Bacteria 1137
7 Ga0070683_100024542 3300005329 Bacteria 5402
8 Ga0070670_100000009 3300005331 Bacteria 291074
9 Ga0070666_10068186 3300005335 Bacteria 2417
10 Ga0070666_10146553 3300005335 Bacteria 1646
11 Ga0070666_10219285 3300005335 Bacteria 1341
12 Ga0070680_100527759 3300005336 Bacteria 1011
13 Ga0068868_100232558 3300005338 Bacteria 1547
14 Ga0070660_100241522 3300005339 Bacteria 1471
15 Ga0070660_100330679 3300005339 Bacteria 1253
16 Ga0070660_100626029 3300005339 Bacteria 901
17 Ga0070689_100314053 3300005340 Bacteria 1307
18 Ga0070691_10005232 3300005341 Bacteria 5892
19 Ga0070668_100001380 3300005347 Bacteria 17432
20 Ga0070668_100002575 3300005347 Bacteria 13336
21 Ga0070668_100006897 3300005347 Bacteria 8419
22 Ga0070668_100019876 3300005347 Bacteria 5060
23 Ga0070668_100286013 3300005347 Bacteria 1378
24 Ga0070669_100010746 3300005353 Bacteria 6498
25 Ga0070671_100002166 3300005355 Bacteria 15151
26 Ga0070671_100033878 3300005355 Bacteria 4226
27 Ga0070671_100062778 3300005355 Bacteria 3093
28 Ga0070671_100141580 3300005355 Bacteria 2029
29 Ga0070671_100261344 3300005355 Bacteria 1471
30 Ga0070671_100589742 3300005355 Bacteria 960
31 Ga0070674_100056240 3300005356 Bacteria 2728
32 Ga0070673_100118973 3300005364 Bacteria 2200
33 Ga0070688_100192264 3300005365 Bacteria 1422
34 Ga0070659_100168238 3300005366 Bacteria 1794
35 Ga0070667_100000218 3300005367 Bacteria 66273
36 Ga0070667_100026928 3300005367 Bacteria 4783
37 Ga0070667_100220295 3300005367 Bacteria 1689
38 Ga0070678_100012933 3300005456 Bacteria 5212
39 Ga0070678_100299586 3300005456 Bacteria 1366
40 Ga0070662_100232279 3300005457 Bacteria 1476
41 Ga0070681_10005944 3300005458 Bacteria 11813
42 Ga0070681_10068457 3300005458 Bacteria 3516
43 Ga0068867_100514590 3300005459 Bacteria 1031
44 Ga0070679_100017034 3300005530 Bacteria 7025
45 Ga0070679_100315684 3300005530 Bacteria 1512
46 Ga0070679_100747348 3300005530 Bacteria 921
47 Ga0070679_100801746 3300005530 Bacteria 885
48 Ga0070684_100036590 3300005535 Bacteria 4206
49 Ga0070684_100822776 3300005535 Bacteria 869
50 Ga0068853_100025114 3300005539 Bacteria 4999
51 Ga0068853_100270022 3300005539 Bacteria 1566
52 Ga0070665_100000015 3300005548 Bacteria 462744
53 Ga0070665_100001962 3300005548 Bacteria 23145
54 Ga0070665_100013543 3300005548 Bacteria 8204
55 Ga0070665_100028499 3300005548 Bacteria 5623
56 Ga0070665_100035914 3300005548 Bacteria 4986
57 Ga0070665_100063328 3300005548 Bacteria 3708
58 Ga0070665_100356229 3300005548 Bacteria 1469
59 Ga0068855_100011542 3300005563 Bacteria 10671
60 Ga0068855_100382356 3300005563 Bacteria 1545
61 Ga0068854_100282864 3300005578 Bacteria 1336
62 Ga0068856_100090336 3300005614 Bacteria 3046
63 Ga0068856_100129939 3300005614 Bacteria 2523
64 Ga0068856_100735068 3300005614 Bacteria 1007
65 Ga0068852_100326967 3300005616 Bacteria 1491
66 Ga0068859_100000093 3300005617 Bacteria 82384
67 Ga0068859_100024835 3300005617 Bacteria 6015
68 Ga0068859_100324276 3300005617 Bacteria 1634
69 Ga0068859_100332515 3300005617 Bacteria 1613
70 Ga0068864_100000151 3300005618 Bacteria 65372
71 Ga0068864_100049218 3300005618 Bacteria 3626
72 Ga0068864_100107588 3300005618 Bacteria 2480
73 Ga0068864_100420174 3300005618 Bacteria 1274
74 Ga0068863_100000470 3300005841 Bacteria 41201
75 Ga0068863_100002660 3300005841 Bacteria 17667
76 Ga0068863_100012458 3300005841 Bacteria 8210
77 Ga0068863_100246885 3300005841 Bacteria 1723
78 Ga0068858_100000240 3300005842 Bacteria 59201
79 Ga0068858_100010128 3300005842 Bacteria 8950
80 Ga0068858_100014428 3300005842 Bacteria 7449
81 Ga0068860_100000158 3300005843 Bacteria 110478
82 Ga0068860_100000184 3300005843 Bacteria 100730
83 Ga0068860_100039825 3300005843 Bacteria 4494
84 Ga0068862_100002307 3300005844 Bacteria 17033
85 Ga0068862_100011182 3300005844 Bacteria 7412
86 Ga0068862_100022254 3300005844 Bacteria 5301
87 Ga0068862_100032834 3300005844 Bacteria 4383
88 Ga0070717_10098800 3300006028 Bacteria 2475
89 Ga0075368_10007091 3300006042 Bacteria 3945
90 Ga0075363_100293029 3300006048 Bacteria 943
91 Ga0075364_10006070 3300006051 Bacteria 7074
92 Ga0075364_10186185 3300006051 Bacteria 1406
93 Ga0075367_10021345 3300006178 Bacteria 3617
94 Ga0075367_10454401 3300006178 Unclassified 812
95 Ga0075370_10006341 3300006353 Bacteria 5941
96 Ga0068865_100000734 3300006881 Bacteria 18420
97 Ga0097620_100000093 3300006931 Bacteria 82384
98 Ga0097620_100024835 3300006931 Bacteria 6015
99 Ga0097620_100324277 3300006931 Bacteria 1634
100 Ga0097620_100332515 3300006931 Bacteria 1613
101 Ga0079104_1033238 3300006946 Bacteria 1264
102 Ga0105240_10097161 3300009093 Bacteria 3589
103 Ga0105240_10120176 3300009093 Bacteria 3164
104 Ga0105240_10861232 3300009093 Bacteria 977
105 Ga0111539_10635284 3300009094 Bacteria 1243
106 Ga0105247_10091909 3300009101 Bacteria 1928
107 Ga0105247_10349001 3300009101 Bacteria 1040
108 Ga0105247_10500017 3300009101 Bacteria 886
109 Ga0105241_10386793 3300009174 Bacteria 1224
110 Ga0105242_10023187 3300009176 Bacteria 4893
111 Ga0105248_10002049 3300009177 Bacteria 22323
112 Ga0105248_10002616 3300009177 Bacteria 20039
113 Ga0105248_10017222 3300009177 Bacteria 7962
114 Ga0105248_10032644 3300009177 Bacteria 5817
115 Ga0105248_10234199 3300009177 Bacteria 2067
116 Ga0105237_10266009 3300009545 Bacteria 1718
117 Ga0105238_10008217 3300009551 Bacteria 10440
118 Ga0105238_10062694 3300009551 Bacteria 3718
119 Ga0105238_10114854 3300009551 Bacteria 2671
120 Ga0105238_10222042 3300009551 Bacteria 1866
121 Ga0105238_10557844 3300009551 Bacteria 1150
122 Ga0105249_10000789 3300009553 Bacteria 28444
123 Ga0105239_10216713 3300010375 Bacteria 2146
124 Ga0105239_10265388 3300010375 Bacteria 1930
125 Ga0105239_10439333 3300010375 Bacteria 1479
126 Ga0105239_10526914 3300010375 Bacteria 1344
127 Ga0157371_10032122 3300013102 Bacteria 3779
128 Ga0157370_10043026 3300013104 Bacteria 4349
129 Ga0157369_10312853 3300013105 Bacteria 1633
130 Ga0157374_10334726 3300013296 Bacteria 1502
131 Ga0163162_10650765 3300013306 Bacteria 1177
132 Ga0157372_10388014 3300013307 Bacteria 1627
133 Ga0157375_10511274 3300013308 Bacteria 1365
134 Ga0163163_10016918 3300014325 Bacteria 6789
135 Ga0163163_10045733 3300014325 Bacteria 4298
136 Ga0182008_10085035 3300014497 Bacteria 1558
137 Ga0157379_10000552 3300014968 Bacteria 30177
138 Ga0157379_10025768 3300014968 Bacteria 5227
139 Ga0214543_1000038 3300021327 Bacteria 182106
140 Ga0213876_10005161 3300021384 Bacteria 7200
141 Ga0213876_10081741 3300021384 Bacteria 1709
142 Ga0213875_10005057 3300021388 Bacteria 7142
143 Ga0209026_1000962 3300025250 Bacteria 14417
144 Ga0209026_1008344 3300025250 Bacteria 2174
145 Ga0209758_1002020 3300025297 Bacteria 21835
146 Ga0209050_1000029 3300025298 Bacteria 465801
147 Ga0207426_1030013 3300025302 Bacteria 1787
148 Ga0209257_1000271 3300025304 Bacteria 118632
149 Ga0209257_1009893 3300025304 Bacteria 4975
150 Ga0207710_10190475 3300025900 Bacteria 1010
151 Ga0207680_10038348 3300025903 Bacteria 2773
152 Ga0207680_10408120 3300025903 Bacteria 961
153 Ga0207705_10001898 3300025909 Bacteria 16368
154 Ga0207705_10355449 3300025909 Bacteria 1129
155 Ga0207705_10478507 3300025909 Bacteria 966
156 Ga0207707_10039141 3300025912 Bacteria 4145
157 Ga0207707_10097913 3300025912 Bacteria 2564
158 Ga0207707_10313451 3300025912 Bacteria 1355
159 Ga0207695_10001525 3300025913 Bacteria 38311
160 Ga0207695_10001672 3300025913 Bacteria 35718
161 Ga0207695_10041938 3300025913 Bacteria 4893
162 Ga0207695_10054598 3300025913 Bacteria 4170
163 Ga0207695_10268734 3300025913 Bacteria 1601
164 Ga0207695_10686381 3300025913 Bacteria 905
165 Ga0207660_10001363 3300025917 Bacteria 16372
166 Ga0207657_10008562 3300025919 Bacteria 10367
167 Ga0207657_10236619 3300025919 Bacteria 1459
168 Ga0207652_10003790 3300025921 Bacteria 12388
169 Ga0207652_10055873 3300025921 Bacteria 3397
170 Ga0207652_10361327 3300025921 Bacteria 1310
171 Ga0207681_10014347 3300025923 Bacteria 4922
172 Ga0207694_10041325 3300025924 Bacteria 3553
173 Ga0207694_10112936 3300025924 Bacteria 2163
174 Ga0207694_10384679 3300025924 Bacteria 1165
175 Ga0207650_10000014 3300025925 Bacteria 398063
176 Ga0207650_10071707 3300025925 Bacteria 2606
177 Ga0207659_10108551 3300025926 Bacteria 2105
178 Ga0207644_10006317 3300025931 Bacteria 7714
179 Ga0207644_10107009 3300025931 Bacteria 2109
180 Ga0207644_10662139 3300025931 Bacteria 869
181 Ga0207690_10020769 3300025932 Bacteria 4062
182 Ga0207690_10115666 3300025932 Bacteria 1939
183 Ga0207706_10145814 3300025933 Bacteria 2082
184 Ga0207686_10032204 3300025934 Bacteria 3119
185 Ga0207670_10270423 3300025936 Bacteria 1321
186 Ga0207669_10043829 3300025937 Bacteria 2623
187 Ga0207704_10000804 3300025938 Bacteria 13886
188 Ga0207711_10000552 3300025941 Bacteria 38214
189 Ga0207711_10001339 3300025941 Bacteria 23287
190 Ga0207711_10008691 3300025941 Bacteria 8497
191 Ga0207711_10012900 3300025941 Bacteria 6939
192 Ga0207711_10169379 3300025941 Bacteria 1981
193 Ga0207711_10301468 3300025941 Bacteria 1478
194 Ga0207711_10325696 3300025941 Bacteria 1420
195 Ga0207711_10372876 3300025941 Unclassified 1323
196 Ga0207667_10001369 3300025949 Bacteria 30569
197 Ga0207667_10124025 3300025949 Bacteria 2661
198 Ga0207667_10281764 3300025949 Bacteria 1698
199 Ga0207651_10146045 3300025960 Bacteria 1834
200 Ga0207712_10120207 3300025961 Bacteria 1986
201 Ga0207712_10512783 3300025961 Bacteria 1026
202 Ga0207668_10000033 3300025972 Bacteria 121080
203 Ga0207668_10000322 3300025972 Bacteria 31034
204 Ga0207668_10001513 3300025972 Bacteria 13589
205 Ga0207668_10446858 3300025972 Bacteria 1102
206 Ga0207658_10001187 3300025986 Bacteria 20790
207 Ga0207658_10012698 3300025986 Bacteria 5752
208 Ga0207677_10078805 3300026023 Bacteria 2354
209 Ga0207703_10000079 3300026035 Bacteria 112451
210 Ga0207703_10003197 3300026035 Bacteria 13795
211 Ga0207703_10030508 3300026035 Bacteria 4262
212 Ga0207678_10145280 3300026067 Bacteria 2024
213 Ga0207702_10300733 3300026078 Bacteria 1523
214 Ga0207702_10506832 3300026078 Bacteria 1177
215 Ga0207641_10000034 3300026088 Bacteria 217752
216 Ga0207641_10082058 3300026088 Bacteria 2800
217 Ga0207641_10224025 3300026088 Bacteria 1745
218 Ga0207641_10492559 3300026088 Bacteria 1189
219 Ga0207676_10000103 3300026095 Bacteria 76865
220 Ga0207676_10000925 3300026095 Bacteria 22719
221 Ga0207676_10014235 3300026095 Bacteria 5716
222 Ga0207676_10038282 3300026095 Bacteria 3659
223 Ga0207676_10550396 3300026095 Bacteria 1102
224 Ga0207674_10069820 3300026116 Bacteria 3532
225 Ga0207675_100240251 3300026118 Bacteria 1750
226 Ga0207683_10070460 3300026121 Bacteria 3089
227 Ga0207683_10195568 3300026121 Bacteria 1837
228 Ga0209281_1018228 3300027111 Bacteria 1408
229 Ga0209981_1001377 3300027378 Bacteria 3072
230 Ga0209999_1001394 3300027543 Bacteria 4140
231 Ga0209813_10013876 3300027866 Bacteria 2159
232 Ga0268266_10000005 3300028379 Bacteria 1448194
233 Ga0268266_10001055 3300028379 Bacteria 34552
234 Ga0268266_10019998 3300028379 Bacteria 5706
235 Ga0268266_10057779 3300028379 Bacteria 3339
236 Ga0268266_10070532 3300028379 Bacteria 3028
237 Ga0268266_10099271 3300028379 Bacteria 2563
238 Ga0268266_10404659 3300028379 Bacteria 1291
239 Ga0268266_10493587 3300028379 Bacteria 1168
240 Ga0268265_10002715 3300028380 Bacteria 13097
241 Ga0268265_10010606 3300028380 Bacteria 6223
242 Ga0268265_10064817 3300028380 Bacteria 2816
243 Ga0268265_10153002 3300028380 Bacteria 1948
244 Ga0268265_10180635 3300028380 Bacteria 1812
245 Ga0268264_10000029 3300028381 Bacteria 419246
246 Ga0268264_10000124 3300028381 Bacteria 187493
247 Ga0268264_10000170 3300028381 Bacteria 144898
248 Ga0268264_10015900 3300028381 Bacteria 6163
249 Ga0268264_10038168 3300028381 Bacteria 3962
250 Ga0307517_10007858 3300028786 Bacteria 15448
251 Ga0307517_10059074 3300028786 Bacteria 3680
252 Ga0307517_10105193 3300028786 Bacteria 2192
253 Ga0307517_10363033 3300028786 Bacteria 781
254 Ga0265338_10015526 3300028800 Bacteria 8357
255 Ga0265338_10274455 3300028800 Bacteria 1234
256 Ga0265340_10167499 3300031247 Bacteria 996
257 Ga0265327_10009789 3300031251 Bacteria 6854
258 Ga0307513_10000303 3300031456 Bacteria 70737
259 Ga0307513_10012719 3300031456 Bacteria 10365
260 Ga0307513_10069469 3300031456 Bacteria 3686
261 Ga0307408_100339932 3300031548 Bacteria 1270
262 Ga0307508_10198739 3300031616 Bacteria 1606
263 Ga0265314_10185195 3300031711 Bacteria 1244
264 Ga0307516_10000004 3300031730 Bacteria 367451
265 Ga0307516_10000257 3300031730 Bacteria 68036
266 Ga0307411_10140003 3300032005 Bacteria 1783
267 Ga0307510_10049080 3300033180 Bacteria 4494
268 Ga0373940_0042549 3300035088 Bacteria 1252
269 Ga0373944_0025198 3300035089 Bacteria 1749
270 Ga0373931_0143892 3300035691 Bacteria 1384
271 Ga0373927_0001105 3300035695 Bacteria 20513
272 Ga0373925_0000067 3300037068 Bacteria 110348
273 Ga0395900_0028120 3300037418 Bacteria 5757
274 Ga0395900_0066287 3300037418 Bacteria 3710
275 Ga0395905_0037648 3300037471 Bacteria 4540
276 Ga0395905_0143158 3300037471 Bacteria 2249
277 Ga0395905_0511726 3300037471 Bacteria 1101
278 Ga0395905_0526708 3300037471 Bacteria 1082
279 Ga0436364_0616831 3300037853 Bacteria 13323
280 Ga0395901_0006366 3300038443 Bacteria 11964
281 Ga0436365_0768429 3300039437 Bacteria 2447
282 Ga0436365_1283333 3300039437 Bacteria 6676
283 Ga0436360_0031702 3300039438 Bacteria 1666
284 Ga0466957_0316403 3300044842 Bacteria 1052
285 Ga0495606_0033430 3300046507 Bacteria 3547
286 Ga0495628_0206655 3300046516 Bacteria 1478
287 Ga0495643_0122048 3300046522 Bacteria 1315
288 Ga0495642_0007881 3300046528 Bacteria 4079
289 Ga0495642_0183973 3300046528 Bacteria 909
290 Ga0495609_0015233 3300046538 Bacteria 3601
291 Ga0495597_0011671 3300046542 Bacteria 4255
292 Ga0495645_0130551 3300046543 Bacteria 1761
293 Ga0495668_0012148 3300046616 Bacteria 5120
294 Ga0495668_0020856 3300046616 Bacteria 3763
295 Ga0495668_0220409 3300046616 Unclassified 1039
296 Ga0495668_0248233 3300046616 Bacteria 975
297 Ga0495625_0009959 3300046660 Bacteria 7906
298 Ga0495625_0241829 3300046660 Bacteria 1175
299 Ga0495625_0277963 3300046660 Bacteria 1078
300 Ga0495659_0188885 3300046664 Bacteria 841
301 Ga0495669_0000022 3300046684 Bacteria 117864
302 Ga0495669_0000427 3300046684 Bacteria 20038
303 Ga0495669_0010711 3300046684 Bacteria 3880
304 Ga0495669_0064488 3300046684 Bacteria 1662
305 Ga0495669_0225348 3300046684 Bacteria 899
306 Ga0495581_0038068 3300047315 Bacteria 2783
307 Ga0495672_0017095 3300047320 Bacteria 4859
308 Ga0495677_0022207 3300047445 Bacteria 2301
309 Ga0495677_0028601 3300047445 Bacteria 2025
310 Ga0495686_0003194 3300047472 Bacteria 14438
311 Ga0495686_0218722 3300047472 Bacteria 1085
312 Ga0495686_0321595 3300047472 Bacteria 848
313 Ga0496100_0085413 3300048903 Bacteria 2142
314 Ga0496100_0241483 3300048903 Bacteria 1333
315 Ga0496100_0322418 3300048903 Bacteria 1161
316 Ga0496102_0006240 3300048905 Bacteria 10163
317 Ga0496102_0426309 3300048905 Bacteria 1246
318 Ga0496103_0123276 3300048906 Bacteria 1652
319 Ga0496105_0316486 3300048908 Bacteria 1252
320 Ga0496108_0104337 3300048911 Bacteria 2419
321 Ga0496110_0126004 3300048913 Bacteria 2311
322 Ga0496112_0042214 3300048915 Bacteria 4462
323 Ga0496112_0128217 3300048915 Bacteria 2508
324 Ga0496115_0001826 3300048918 Bacteria 15237
325 Ga0496115_0047927 3300048918 Bacteria 3418
326 Ga0496116_0208546 3300048919 Bacteria 1015
327 Ga0496117_0031451 3300048920 Bacteria 4050
328 Ga0496119_0149112 3300048922 Bacteria 1255
329 Ga0496121_0000130 3300048924 Bacteria 168094
330 Ga0496125_0161846 3300048928 Bacteria 1519
331 Ga0501034_0001829 3300049571 Bacteria 27003
332 Ga0501034_0002576 3300049571 Bacteria 21569
333 Ga0501034_0152300 3300049571 Bacteria 2288
334 Ga0501047_0005483 3300049581 Bacteria 11937
335 Ga0501067_0021934 3300049583 Bacteria 3534
336 Ga0501068_0014591 3300049584 Bacteria 4496
337 Ga0501074_0012166 3300049590 Bacteria 6256
338 Ga0501257_001863 3300049686 Bacteria 4390
339 Ga0501080_0058542 3300049742 Bacteria 3586
340 Ga0501083_0060153 3300049744 Bacteria 2538
341 Ga0501044_0644637 3300049823 Bacteria 949
342 nmdc:mga03n38_450291_c1 3300050490 Bacteria 716
343 nmdc:mga03n38_77154_c1 3300050490 Bacteria 1556
344 nmdc:mga00v17_13668_c1 3300050491 Bacteria 4512
345 nmdc:mga0k408_39860_c1 3300050493 Bacteria 2701
346 nmdc:mga06z11_219486_c1 3300050494 Bacteria 1110
347 nmdc:mga06z11_24533_c1 3300050494 Bacteria 2846
348 nmdc:mga06z11_494092_c1 3300050494 Unclassified 741
349 nmdc:mga04h51_13418_c1 3300050495 Bacteria 2319
350 nmdc:mga07m45_15576_c1 3300050496 Bacteria 4060
351 nmdc:mga08y16_848616_c1 3300050511 Bacteria 903
352 Ga0500647_0023371 3300053091 Bacteria 2900
353 Ga0500641_0000730 3300053096 Bacteria 11911
354 Ga0500555_001248 3300053103 Bacteria 8182
355 Ga0500555_078864 3300053103 Bacteria 859
356 Ga0500556_0005692 3300053104 Bacteria 3522
357 Ga0500562_001450 3300053108 Bacteria 5842
358 Ga0500562_005937 3300053108 Bacteria 3074
359 Ga0500569_000626 3300053109 Bacteria 6014
360 Ga0500595_065008 3300053119 Bacteria 1093
361 Ga0500607_066514 3300053121 Bacteria 1870
362 Ga0500614_004475 3300053123 Bacteria 2950
363 Ga0500559_0041891 3300053136 Bacteria 1996
364 Ga0500568_0003868 3300053139 Bacteria 8157
365 Ga0500590_220296 3300053148 Bacteria 783
366 Ga0500616_0000245 3300053153 Bacteria 84999
367 Ga0500638_057706 3300053162 Bacteria 1869
368 Ga0500636_0019215 3300053177 Bacteria 4044
369 Ga0500636_0292473 3300053177 Bacteria 807
370 Ga0500625_069121 3300053729 Bacteria 1577
371 Ga0500645_003410 3300053730 Bacteria 6467
372 Ga0500645_003928 3300053730 Bacteria 5862
373 Ga0500656_016407 3300053732 Bacteria 877
374 Ga0500596_006157 3300053735 Bacteria 2052
375 Ga0500601_014287 3300053737 Bacteria 901
376 Ga0501084_0066210 3300054114 Bacteria 3022
377 Ga0501082_0112198 3300060353 Bacteria 2360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100332515 Ga0068859_1003325152 197
2 3300005844 Ga0068862_100011182 Ga0068862_1000111825 197
3 3300006931 Ga0097620_100332515 Ga0097620_1003325152 197
4 3300028380 Ga0268265_10010606 Ga0268265_100106063 197
5 3300039438 Ga0436360_0031702 Ga0436360_0031702_47_706 199
6 3300005335 Ga0070666_10219285 Ga0070666_102192852 202
7 3300025903 Ga0207680_10038348 Ga0207680_100383483 202
8 3300009551 Ga0105238_10222042 Ga0105238_102220422 205
9 3300037853 Ga0436364_0616831 Ga0436364_0616831_10999_11622 205
10 3300046664 Ga0495659_0188885 Ga0495659_0188885_200_829 205
11 3300046684 Ga0495669_0225348 Ga0495669_0225348_245_880 205
12 3300049571 Ga0501034_0001829 Ga0501034_0001829_6309_6956 205
13 3300049584 Ga0501068_0014591 Ga0501068_0014591_1863_2510 205
14 3300053139 Ga0500568_0003868 Ga0500568_0003868_5351_6055 211
15 3300053153 Ga0500616_0000245 Ga0500616_0000245_73262_73966 211
16 3300048928 Ga0496125_0161846 Ga0496125_0161846_694_1368 213
17 3300006178 Ga0075367_10454401 Ga0075367_104544011 214
18 3300050494 nmdc:mga06z11_494092_c1 nmdc:mga06z11_494092_c1_59_712 214
19 iso_pu_bacteria 2508501122 2509111343 214
20 iso_pu_bacteria 2509276019 2509376379 214
21 iso_pu_bacteria 2558860100 2558867797 214
22 iso_pu_bacteria 2643221598 2643999907 214
23 iso_pu_bacteria 2643221614 2644088339 214
24 iso_pu_bacteria 2643221661 2644343575 214
25 iso_pu_bacteria 2643221666 2644368947 214
26 iso_pu_bacteria 2850079185 2850081348 214
27 3300025932 Ga0207690_10115666 Ga0207690_101156662 215
28 3300021388 Ga0213875_10005057 Ga0213875_100050572 216
29 3300005459 Ga0068867_100514590 Ga0068867_1005145902 217
30 3300006353 Ga0075370_10006341 Ga0075370_100063414 217
31 3300032005 Ga0307411_10140003 Ga0307411_101400031 217
32 3300035088 Ga0373940_0042549 Ga0373940_0042549_193_855 217
33 3300037471 Ga0395905_0037648 Ga0395905_0037648_2927_3592 217
34 3300046616 Ga0495668_0248233 Ga0495668_0248233_169_822 217
35 3300047472 Ga0495686_0003194 Ga0495686_0003194_2375_3028 217
36 3300047472 Ga0495686_0321595 Ga0495686_0321595_87_740 217
37 3300049823 Ga0501044_0644637 Ga0501044_0644637_41_706 217
38 3300050490 nmdc:mga03n38_450291_c1 nmdc:mga03n38_450291_c1_34_699 217
39 3300050493 nmdc:mga0k408_39860_c1 nmdc:mga0k408_39860_c1_261_926 217
40 3300050496 nmdc:mga07m45_15576_c1 nmdc:mga07m45_15576_c1_937_1602 217
41 3300053103 Ga0500555_078864 Ga0500555_078864_179_832 217
42 3300053730 Ga0500645_003928 Ga0500645_003928_633_1286 217
43 3300003791 Ga0055530_10000091 Ga0055530_1000009167 218
44 3300003794 Ga0055531_10002140 Ga0055531_100021405 218
45 3300003794 Ga0055531_10039072 Ga0055531_100390721 218
46 3300005262 Ga0065165_1000528 Ga0065165_100052853 218
47 3300005262 Ga0065165_1009366 Ga0065165_10093664 218
48 3300005327 Ga0070658_10429151 Ga0070658_104291512 218
49 3300005329 Ga0070683_100024542 Ga0070683_1000245425 218
50 3300005331 Ga0070670_100000009 Ga0070670_100000009193 218
51 3300005335 Ga0070666_10068186 Ga0070666_100681862 218
52 3300005335 Ga0070666_10146553 Ga0070666_101465532 218
53 3300005336 Ga0070680_100527759 Ga0070680_1005277592 218
54 3300005338 Ga0068868_100232558 Ga0068868_1002325582 218
55 3300005339 Ga0070660_100241522 Ga0070660_1002415222 218
56 3300005339 Ga0070660_100330679 Ga0070660_1003306792 218
57 3300005339 Ga0070660_100626029 Ga0070660_1006260292 218
58 3300005340 Ga0070689_100314053 Ga0070689_1003140531 218
59 3300005341 Ga0070691_10005232 Ga0070691_100052326 218
60 3300005347 Ga0070668_100001380 Ga0070668_10000138020 218
61 3300005347 Ga0070668_100002575 Ga0070668_10000257512 218
62 3300005347 Ga0070668_100006897 Ga0070668_1000068976 218
63 3300005347 Ga0070668_100019876 Ga0070668_1000198763 218
64 3300005347 Ga0070668_100286013 Ga0070668_1002860132 218
65 3300005353 Ga0070669_100010746 Ga0070669_1000107466 218
66 3300005355 Ga0070671_100002166 Ga0070671_10000216610 218
67 3300005355 Ga0070671_100033878 Ga0070671_1000338784 218
68 3300005355 Ga0070671_100062778 Ga0070671_1000627783 218
69 3300005355 Ga0070671_100141580 Ga0070671_1001415802 218
70 3300005355 Ga0070671_100261344 Ga0070671_1002613443 218
71 3300005355 Ga0070671_100589742 Ga0070671_1005897422 218
72 3300005356 Ga0070674_100056240 Ga0070674_1000562403 218
73 3300005364 Ga0070673_100118973 Ga0070673_1001189733 218
74 3300005365 Ga0070688_100192264 Ga0070688_1001922642 218
75 3300005366 Ga0070659_100168238 Ga0070659_1001682382 218
76 3300005367 Ga0070667_100000218 Ga0070667_10000021857 218
77 3300005367 Ga0070667_100026928 Ga0070667_1000269284 218
78 3300005367 Ga0070667_100220295 Ga0070667_1002202952 218
79 3300005456 Ga0070678_100012933 Ga0070678_1000129332 218
80 3300005456 Ga0070678_100299586 Ga0070678_1002995862 218
81 3300005457 Ga0070662_100232279 Ga0070662_1002322792 218
82 3300005458 Ga0070681_10005944 Ga0070681_100059442 218
83 3300005458 Ga0070681_10068457 Ga0070681_100684574 218
84 3300005530 Ga0070679_100017034 Ga0070679_1000170344 218
85 3300005530 Ga0070679_100315684 Ga0070679_1003156842 218
86 3300005530 Ga0070679_100747348 Ga0070679_1007473482 218
87 3300005530 Ga0070679_100801746 Ga0070679_1008017461 218
88 3300005535 Ga0070684_100036590 Ga0070684_1000365902 218
89 3300005535 Ga0070684_100822776 Ga0070684_1008227762 218
90 3300005539 Ga0068853_100025114 Ga0068853_1000251142 218
91 3300005539 Ga0068853_100270022 Ga0068853_1002700223 218
92 3300005548 Ga0070665_100000015 Ga0070665_100000015328 218
93 3300005548 Ga0070665_100001962 Ga0070665_1000019624 218
94 3300005548 Ga0070665_100013543 Ga0070665_1000135435 218
95 3300005548 Ga0070665_100028499 Ga0070665_1000284996 218
96 3300005548 Ga0070665_100035914 Ga0070665_1000359143 218
97 3300005548 Ga0070665_100063328 Ga0070665_1000633283 218
98 3300005548 Ga0070665_100356229 Ga0070665_1003562292 218
99 3300005563 Ga0068855_100011542 Ga0068855_1000115424 218
100 3300005563 Ga0068855_100382356 Ga0068855_1003823562 218
101 3300005578 Ga0068854_100282864 Ga0068854_1002828642 218
102 3300005614 Ga0068856_100090336 Ga0068856_1000903362 218
103 3300005614 Ga0068856_100129939 Ga0068856_1001299393 218
104 3300005614 Ga0068856_100735068 Ga0068856_1007350682 218
105 3300005616 Ga0068852_100326967 Ga0068852_1003269672 218
106 3300005617 Ga0068859_100000093 Ga0068859_10000009310 218
107 3300005617 Ga0068859_100024835 Ga0068859_1000248353 218
108 3300005617 Ga0068859_100324276 Ga0068859_1003242762 218
109 3300005618 Ga0068864_100000151 Ga0068864_10000015132 218
110 3300005618 Ga0068864_100049218 Ga0068864_1000492182 218
111 3300005618 Ga0068864_100107588 Ga0068864_1001075882 218
112 3300005618 Ga0068864_100420174 Ga0068864_1004201742 218
113 3300005841 Ga0068863_100000470 Ga0068863_10000047017 218
114 3300005841 Ga0068863_100002660 Ga0068863_1000026607 218
115 3300005841 Ga0068863_100012458 Ga0068863_1000124584 218
116 3300005841 Ga0068863_100246885 Ga0068863_1002468852 218
117 3300005842 Ga0068858_100000240 Ga0068858_10000024041 218
118 3300005842 Ga0068858_100010128 Ga0068858_1000101287 218
119 3300005842 Ga0068858_100014428 Ga0068858_1000144283 218
120 3300005843 Ga0068860_100000158 Ga0068860_10000015894 218
121 3300005843 Ga0068860_100000184 Ga0068860_10000018466 218
122 3300005843 Ga0068860_100039825 Ga0068860_1000398252 218
123 3300005844 Ga0068862_100002307 Ga0068862_1000023074 218
124 3300005844 Ga0068862_100022254 Ga0068862_1000222542 218
125 3300005844 Ga0068862_100032834 Ga0068862_1000328343 218
126 3300006028 Ga0070717_10098800 Ga0070717_100988003 218
127 3300006042 Ga0075368_10007091 Ga0075368_100070915 218
128 3300006048 Ga0075363_100293029 Ga0075363_1002930292 218
129 3300006051 Ga0075364_10006070 Ga0075364_100060702 218
130 3300006051 Ga0075364_10186185 Ga0075364_101861852 218
131 3300006178 Ga0075367_10021345 Ga0075367_100213455 218
132 3300006881 Ga0068865_100000734 Ga0068865_1000007343 218
133 3300006931 Ga0097620_100000093 Ga0097620_10000009310 218
134 3300006931 Ga0097620_100024835 Ga0097620_1000248355 218
135 3300006931 Ga0097620_100324277 Ga0097620_1003242772 218
136 3300006946 Ga0079104_1033238 Ga0079104_10332382 218
137 3300009093 Ga0105240_10097161 Ga0105240_100971613 218
138 3300009093 Ga0105240_10120176 Ga0105240_101201763 218
139 3300009093 Ga0105240_10861232 Ga0105240_108612322 218
140 3300009094 Ga0111539_10635284 Ga0111539_106352842 218
141 3300009101 Ga0105247_10091909 Ga0105247_100919091 218
142 3300009101 Ga0105247_10349001 Ga0105247_103490012 218
143 3300009101 Ga0105247_10500017 Ga0105247_105000171 218
144 3300009174 Ga0105241_10386793 Ga0105241_103867932 218
145 3300009176 Ga0105242_10023187 Ga0105242_100231873 218
146 3300009177 Ga0105248_10002049 Ga0105248_1000204910 218
147 3300009177 Ga0105248_10002616 Ga0105248_1000261618 218
148 3300009177 Ga0105248_10017222 Ga0105248_100172226 218
149 3300009177 Ga0105248_10032644 Ga0105248_100326442 218
150 3300009177 Ga0105248_10234199 Ga0105248_102341992 218
151 3300009545 Ga0105237_10266009 Ga0105237_102660092 218
152 3300009551 Ga0105238_10008217 Ga0105238_100082172 218
153 3300009551 Ga0105238_10062694 Ga0105238_100626943 218
154 3300009551 Ga0105238_10114854 Ga0105238_101148543 218
155 3300009551 Ga0105238_10557844 Ga0105238_105578442 218
156 3300009553 Ga0105249_10000789 Ga0105249_1000078911 218
157 3300010375 Ga0105239_10216713 Ga0105239_102167132 218
158 3300010375 Ga0105239_10265388 Ga0105239_102653882 218
159 3300010375 Ga0105239_10439333 Ga0105239_104393332 218
160 3300010375 Ga0105239_10526914 Ga0105239_105269142 218
161 3300013102 Ga0157371_10032122 Ga0157371_100321223 218
162 3300013104 Ga0157370_10043026 Ga0157370_100430264 218
163 3300013105 Ga0157369_10312853 Ga0157369_103128532 218
164 3300013296 Ga0157374_10334726 Ga0157374_103347262 218
165 3300013306 Ga0163162_10650765 Ga0163162_106507652 218
166 3300013307 Ga0157372_10388014 Ga0157372_103880141 218
167 3300013308 Ga0157375_10511274 Ga0157375_105112742 218
168 3300014325 Ga0163163_10016918 Ga0163163_100169182 218
169 3300014325 Ga0163163_10045733 Ga0163163_100457333 218
170 3300014497 Ga0182008_10085035 Ga0182008_100850352 218
171 3300014968 Ga0157379_10000552 Ga0157379_100005527 218
172 3300014968 Ga0157379_10025768 Ga0157379_100257684 218
173 3300021327 Ga0214543_1000038 Ga0214543_1000038160 218
174 3300021384 Ga0213876_10005161 Ga0213876_100051614 218
175 3300021384 Ga0213876_10081741 Ga0213876_100817412 218
176 3300025250 Ga0209026_1000962 Ga0209026_10009628 218
177 3300025250 Ga0209026_1008344 Ga0209026_10083443 218
178 3300025297 Ga0209758_1002020 Ga0209758_100202013 218
179 3300025298 Ga0209050_1000029 Ga0209050_100002968 218
180 3300025302 Ga0207426_1030013 Ga0207426_10300132 218
181 3300025304 Ga0209257_1000271 Ga0209257_100027152 218
182 3300025304 Ga0209257_1009893 Ga0209257_10098934 218
183 3300025900 Ga0207710_10190475 Ga0207710_101904752 218
184 3300025903 Ga0207680_10408120 Ga0207680_104081202 218
185 3300025909 Ga0207705_10001898 Ga0207705_100018985 218
186 3300025909 Ga0207705_10355449 Ga0207705_103554492 218
187 3300025909 Ga0207705_10478507 Ga0207705_104785072 218
188 3300025912 Ga0207707_10039141 Ga0207707_100391412 218
189 3300025912 Ga0207707_10097913 Ga0207707_100979133 218
190 3300025912 Ga0207707_10313451 Ga0207707_103134512 218
191 3300025913 Ga0207695_10001525 Ga0207695_1000152523 218
192 3300025913 Ga0207695_10001672 Ga0207695_1000167215 218
193 3300025913 Ga0207695_10041938 Ga0207695_100419382 218
194 3300025913 Ga0207695_10054598 Ga0207695_100545983 218
195 3300025913 Ga0207695_10268734 Ga0207695_102687342 218
196 3300025913 Ga0207695_10686381 Ga0207695_106863811 218
197 3300025917 Ga0207660_10001363 Ga0207660_1000136311 218
198 3300025919 Ga0207657_10008562 Ga0207657_100085629 218
199 3300025919 Ga0207657_10236619 Ga0207657_102366192 218
200 3300025921 Ga0207652_10003790 Ga0207652_1000379011 218
201 3300025921 Ga0207652_10055873 Ga0207652_100558733 218
202 3300025921 Ga0207652_10361327 Ga0207652_103613272 218
203 3300025923 Ga0207681_10014347 Ga0207681_100143474 218
204 3300025924 Ga0207694_10041325 Ga0207694_100413253 218
205 3300025924 Ga0207694_10112936 Ga0207694_101129362 218
206 3300025924 Ga0207694_10384679 Ga0207694_103846791 218
207 3300025925 Ga0207650_10000014 Ga0207650_10000014345 218
208 3300025925 Ga0207650_10071707 Ga0207650_100717073 218
209 3300025926 Ga0207659_10108551 Ga0207659_101085513 218
210 3300025931 Ga0207644_10006317 Ga0207644_100063174 218
211 3300025931 Ga0207644_10107009 Ga0207644_101070093 218
212 3300025931 Ga0207644_10662139 Ga0207644_106621391 218
213 3300025932 Ga0207690_10020769 Ga0207690_100207692 218
214 3300025933 Ga0207706_10145814 Ga0207706_101458142 218
215 3300025934 Ga0207686_10032204 Ga0207686_100322043 218
216 3300025936 Ga0207670_10270423 Ga0207670_102704231 218
217 3300025937 Ga0207669_10043829 Ga0207669_100438292 218
218 3300025938 Ga0207704_10000804 Ga0207704_100008043 218
219 3300025941 Ga0207711_10000552 Ga0207711_1000055237 218
220 3300025941 Ga0207711_10001339 Ga0207711_1000133914 218
221 3300025941 Ga0207711_10008691 Ga0207711_100086915 218
222 3300025941 Ga0207711_10012900 Ga0207711_100129007 218
223 3300025941 Ga0207711_10169379 Ga0207711_101693792 218
224 3300025941 Ga0207711_10301468 Ga0207711_103014682 218
225 3300025941 Ga0207711_10325696 Ga0207711_103256963 218
226 3300025941 Ga0207711_10372876 Ga0207711_103728762 218
227 3300025949 Ga0207667_10001369 Ga0207667_1000136928 218
228 3300025949 Ga0207667_10124025 Ga0207667_101240253 218
229 3300025949 Ga0207667_10281764 Ga0207667_102817642 218
230 3300025960 Ga0207651_10146045 Ga0207651_101460453 218
231 3300025961 Ga0207712_10120207 Ga0207712_101202072 218
232 3300025961 Ga0207712_10512783 Ga0207712_105127831 218
233 3300025972 Ga0207668_10000033 Ga0207668_10000033103 218
234 3300025972 Ga0207668_10000322 Ga0207668_1000032214 218
235 3300025972 Ga0207668_10001513 Ga0207668_100015137 218
236 3300025972 Ga0207668_10446858 Ga0207668_104468582 218
237 3300025986 Ga0207658_10001187 Ga0207658_100011872 218
238 3300025986 Ga0207658_10012698 Ga0207658_100126983 218
239 3300026023 Ga0207677_10078805 Ga0207677_100788052 218
240 3300026035 Ga0207703_10000079 Ga0207703_1000007917 218
241 3300026035 Ga0207703_10003197 Ga0207703_100031979 218
242 3300026035 Ga0207703_10030508 Ga0207703_100305083 218
243 3300026067 Ga0207678_10145280 Ga0207678_101452802 218
244 3300026078 Ga0207702_10300733 Ga0207702_103007333 218
245 3300026078 Ga0207702_10506832 Ga0207702_105068322 218
246 3300026088 Ga0207641_10000034 Ga0207641_1000003417 218
247 3300026088 Ga0207641_10082058 Ga0207641_100820583 218
248 3300026088 Ga0207641_10224025 Ga0207641_102240252 218
249 3300026088 Ga0207641_10492559 Ga0207641_104925592 218
250 3300026095 Ga0207676_10000103 Ga0207676_1000010358 218
251 3300026095 Ga0207676_10000925 Ga0207676_1000092524 218
252 3300026095 Ga0207676_10014235 Ga0207676_100142354 218
253 3300026095 Ga0207676_10038282 Ga0207676_100382822 218
254 3300026095 Ga0207676_10550396 Ga0207676_105503962 218
255 3300026116 Ga0207674_10069820 Ga0207674_100698202 218
256 3300026118 Ga0207675_100240251 Ga0207675_1002402512 218
257 3300026121 Ga0207683_10070460 Ga0207683_100704603 218
258 3300026121 Ga0207683_10195568 Ga0207683_101955682 218
259 3300027111 Ga0209281_1018228 Ga0209281_10182282 218
260 3300027378 Ga0209981_1001377 Ga0209981_10013772 218
261 3300027543 Ga0209999_1001394 Ga0209999_10013942 218
262 3300027866 Ga0209813_10013876 Ga0209813_100138762 218
263 3300028379 Ga0268266_10000005 Ga0268266_10000005790 218
264 3300028379 Ga0268266_10001055 Ga0268266_100010559 218
265 3300028379 Ga0268266_10019998 Ga0268266_100199987 218
266 3300028379 Ga0268266_10057779 Ga0268266_100577793 218
267 3300028379 Ga0268266_10070532 Ga0268266_100705323 218
268 3300028379 Ga0268266_10099271 Ga0268266_100992713 218
269 3300028379 Ga0268266_10404659 Ga0268266_104046592 218
270 3300028379 Ga0268266_10493587 Ga0268266_104935872 218
271 3300028380 Ga0268265_10002715 Ga0268265_100027159 218
272 3300028380 Ga0268265_10064817 Ga0268265_100648173 218
273 3300028380 Ga0268265_10153002 Ga0268265_101530023 218
274 3300028380 Ga0268265_10180635 Ga0268265_101806352 218
275 3300028381 Ga0268264_10000029 Ga0268264_10000029292 218
276 3300028381 Ga0268264_10000124 Ga0268264_10000124137 218
277 3300028381 Ga0268264_10000170 Ga0268264_10000170114 218
278 3300028381 Ga0268264_10015900 Ga0268264_100159003 218
279 3300028381 Ga0268264_10038168 Ga0268264_100381684 218
280 3300028786 Ga0307517_10007858 Ga0307517_100078588 218
281 3300028786 Ga0307517_10059074 Ga0307517_100590743 218
282 3300028786 Ga0307517_10105193 Ga0307517_101051932 218
283 3300028786 Ga0307517_10363033 Ga0307517_103630331 218
284 3300028800 Ga0265338_10015526 Ga0265338_100155266 218
285 3300028800 Ga0265338_10274455 Ga0265338_102744552 218
286 3300031247 Ga0265340_10167499 Ga0265340_101674992 218
287 3300031251 Ga0265327_10009789 Ga0265327_100097895 218
288 3300031456 Ga0307513_10000303 Ga0307513_1000030333 218
289 3300031456 Ga0307513_10012719 Ga0307513_100127194 218
290 3300031456 Ga0307513_10069469 Ga0307513_100694694 218
291 3300031548 Ga0307408_100339932 Ga0307408_1003399322 218
292 3300031616 Ga0307508_10198739 Ga0307508_101987392 218
293 3300031711 Ga0265314_10185195 Ga0265314_101851952 218
294 3300031730 Ga0307516_10000004 Ga0307516_10000004338 218
295 3300031730 Ga0307516_10000257 Ga0307516_1000025762 218
296 3300032005 Ga0307411_10140003 Ga0307411_101400032 218
297 3300033180 Ga0307510_10049080 Ga0307510_100490804 218
298 3300035089 Ga0373944_0025198 Ga0373944_0025198_1050_1724 218
299 3300035691 Ga0373931_0143892 Ga0373931_0143892_336_1007 218
300 3300035695 Ga0373927_0001105 Ga0373927_0001105_6159_6833 218
301 3300037068 Ga0373925_0000067 Ga0373925_0000067_91887_92561 218
302 3300037418 Ga0395900_0028120 Ga0395900_0028120_805_1473 218
303 3300037418 Ga0395900_0066287 Ga0395900_0066287_2191_2889 218
304 3300037471 Ga0395905_0143158 Ga0395905_0143158_1356_2024 218
305 3300037471 Ga0395905_0511726 Ga0395905_0511726_286_954 218
306 3300037471 Ga0395905_0526708 Ga0395905_0526708_128_793 218
307 3300038443 Ga0395901_0006366 Ga0395901_0006366_850_1548 218
308 3300039437 Ga0436365_0768429 Ga0436365_0768429_604_1275 218
309 3300039437 Ga0436365_1283333 Ga0436365_1283333_3635_4300 218
310 3300044842 Ga0466957_0316403 Ga0466957_0316403_88_753 218
311 3300046507 Ga0495606_0033430 Ga0495606_0033430_1219_1974 218
312 3300046516 Ga0495628_0206655 Ga0495628_0206655_362_1030 218
313 3300046522 Ga0495643_0122048 Ga0495643_0122048_51_806 218
314 3300046528 Ga0495642_0007881 Ga0495642_0007881_2155_2823 218
315 3300046528 Ga0495642_0183973 Ga0495642_0183973_214_888 218
316 3300046538 Ga0495609_0015233 Ga0495609_0015233_2138_2893 218
317 3300046542 Ga0495597_0011671 Ga0495597_0011671_2852_3607 218
318 3300046543 Ga0495645_0130551 Ga0495645_0130551_37_705 218
319 3300046616 Ga0495668_0012148 Ga0495668_0012148_3102_3857 218
320 3300046616 Ga0495668_0020856 Ga0495668_0020856_1719_2393 218
321 3300046616 Ga0495668_0220409 Ga0495668_0220409_259_933 218
322 3300046660 Ga0495625_0009959 Ga0495625_0009959_1674_2348 218
323 3300046660 Ga0495625_0241829 Ga0495625_0241829_252_1007 218
324 3300046660 Ga0495625_0277963 Ga0495625_0277963_184_858 218
325 3300046684 Ga0495669_0000022 Ga0495669_0000022_41688_42362 218
326 3300046684 Ga0495669_0000427 Ga0495669_0000427_5479_6144 218
327 3300046684 Ga0495669_0010711 Ga0495669_0010711_2942_3607 218
328 3300046684 Ga0495669_0064488 Ga0495669_0064488_669_1343 218
329 3300047315 Ga0495581_0038068 Ga0495581_0038068_1840_2505 218
330 3300047320 Ga0495672_0017095 Ga0495672_0017095_1918_2586 218
331 3300047445 Ga0495677_0022207 Ga0495677_0022207_989_1657 218
332 3300047445 Ga0495677_0028601 Ga0495677_0028601_659_1333 218
333 3300047472 Ga0495686_0003194 Ga0495686_0003194_3025_3693 218
334 3300047472 Ga0495686_0218722 Ga0495686_0218722_327_995 218
335 3300048903 Ga0496100_0085413 Ga0496100_0085413_752_1426 218
336 3300048903 Ga0496100_0241483 Ga0496100_0241483_491_1156 218
337 3300048903 Ga0496100_0322418 Ga0496100_0322418_222_914 218
338 3300048905 Ga0496102_0006240 Ga0496102_0006240_6331_7020 218
339 3300048905 Ga0496102_0426309 Ga0496102_0426309_431_1123 218
340 3300048906 Ga0496103_0123276 Ga0496103_0123276_187_855 218
341 3300048908 Ga0496105_0316486 Ga0496105_0316486_512_1177 218
342 3300048911 Ga0496108_0104337 Ga0496108_0104337_306_980 218
343 3300048913 Ga0496110_0126004 Ga0496110_0126004_373_1047 218
344 3300048915 Ga0496112_0042214 Ga0496112_0042214_2236_2913 218
345 3300048915 Ga0496112_0128217 Ga0496112_0128217_740_1414 218
346 3300048918 Ga0496115_0001826 Ga0496115_0001826_7135_7803 218
347 3300048918 Ga0496115_0047927 Ga0496115_0047927_673_1344 218
348 3300048919 Ga0496116_0208546 Ga0496116_0208546_267_932 218
349 3300048920 Ga0496117_0031451 Ga0496117_0031451_541_1209 218
350 3300048922 Ga0496119_0149112 Ga0496119_0149112_15_683 218
351 3300048924 Ga0496121_0000130 Ga0496121_0000130_57198_57866 218
352 3300049571 Ga0501034_0002576 Ga0501034_0002576_10945_11628 218
353 3300049571 Ga0501034_0152300 Ga0501034_0152300_881_1579 218
354 3300049581 Ga0501047_0005483 Ga0501047_0005483_2030_2695 218
355 3300049583 Ga0501067_0021934 Ga0501067_0021934_2095_2757 218
356 3300049590 Ga0501074_0012166 Ga0501074_0012166_1388_2050 218
357 3300049686 Ga0501257_001863 Ga0501257_001863_1361_2035 218
358 3300049742 Ga0501080_0058542 Ga0501080_0058542_789_1451 218
359 3300049744 Ga0501083_0060153 Ga0501083_0060153_494_1156 218
360 3300050490 nmdc:mga03n38_77154_c1 nmdc:mga03n38_77154_c1_648_1340 218
361 3300050491 nmdc:mga00v17_13668_c1 nmdc:mga00v17_13668_c1_2411_3085 218
362 3300050494 nmdc:mga06z11_219486_c1 nmdc:mga06z11_219486_c1_363_1031 218
363 3300050494 nmdc:mga06z11_24533_c1 nmdc:mga06z11_24533_c1_32_706 218
364 3300050495 nmdc:mga04h51_13418_c1 nmdc:mga04h51_13418_c1_1174_1848 218
365 3300050511 nmdc:mga08y16_848616_c1 nmdc:mga08y16_848616_c1_161_832 218
366 3300053091 Ga0500647_0023371 Ga0500647_0023371_413_1081 218
367 3300053096 Ga0500641_0000730 Ga0500641_0000730_6959_7624 218
368 3300053103 Ga0500555_001248 Ga0500555_001248_6912_7577 218
369 3300053104 Ga0500556_0005692 Ga0500556_0005692_252_917 218
370 3300053108 Ga0500562_001450 Ga0500562_001450_883_1539 218
371 3300053108 Ga0500562_005937 Ga0500562_005937_922_1587 218
372 3300053109 Ga0500569_000626 Ga0500569_000626_1247_2002 218
373 3300053119 Ga0500595_065008 Ga0500595_065008_84_752 218
374 3300053121 Ga0500607_066514 Ga0500607_066514_464_1129 218
375 3300053123 Ga0500614_004475 Ga0500614_004475_347_1012 218
376 3300053136 Ga0500559_0041891 Ga0500559_0041891_112_867 218
377 3300053148 Ga0500590_220296 Ga0500590_220296_71_736 218
378 3300053162 Ga0500638_057706 Ga0500638_057706_91_756 218
379 3300053177 Ga0500636_0019215 Ga0500636_0019215_2800_3465 218
380 3300053177 Ga0500636_0292473 Ga0500636_0292473_64_729 218
381 3300053729 Ga0500625_069121 Ga0500625_069121_54_719 218
382 3300053730 Ga0500645_003410 Ga0500645_003410_5285_5950 218
383 3300053730 Ga0500645_003928 Ga0500645_003928_1283_1942 218
384 3300053732 Ga0500656_016407 Ga0500656_016407_28_696 218
385 3300053735 Ga0500596_006157 Ga0500596_006157_257_1012 218
386 3300053737 Ga0500601_014287 Ga0500601_014287_107_772 218
387 3300054114 Ga0501084_0066210 Ga0501084_0066210_2262_2924 218
388 3300060353 Ga0501082_0112198 Ga0501082_0112198_1408_2070 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

40

219

0.92

PF13242

Hydrolase_like

HAD-hyrolase-like

174

243

0.9

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

37

213

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ocn-assembly1.cif.gz_A crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.935 1 217
7ocq-assembly1.cif.gz_A nadh bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.935 1 217
7ocp-assembly1.cif.gz_A nadph bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.9345 1 217
7oct-assembly1.cif.gz_A nadph bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-n374a from acinetobacter baumannii 0.9341 1 217
7ocr-assembly1.cif.gz_A nadph and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.9334 1 217
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9599 90 189 3.40.50.1000
3nasA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9208 94 212 3.40.50.1000
af_I1K4I3_171_289_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9159 92 206 3.40.50.1000
3kzxA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9144 90 217 3.40.50.1000
af_Q84MD8_87_222_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9084 92 216 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A522CU05-F1-model_v4 HAD family phosphatase 0.9998 1 218
AF-A0A838UHE0-F1-model_v4 HAD family phosphatase 0.9791 1 218
AF-B0T4U6-F1-model_v4 HAD-superfamily hydrolase, subfamily IA, variant 3 0.9778 1 217 GO:0016787
AF-A0A1V4I4G5-F1-model_v4 Phosphorylated carbohydrates phosphatase (EC 3.1.3.-) 0.9778 5 217 GO:0016787
AF-A0A3C1TT46-F1-model_v4 deleted 0.9773 5 217

Feature Viewer

pLDDT pTM Quality
95.47 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map