F431211

General Info

Members Datasets Scaffolds Average Seq Length
388 205 776 183

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0062058|Ga0495580_0062058_914_1591
Length 225
Sequence MGVWGVGYCMPYTLYPKPMLKIPALILFTYFANPKHTNMKKIITRTACFLPLFAFVLSLESRAQALTPEDIKAQTVKEWERAKTYTIDYLNTMPADKYSFKAVDSLRSFANQMLHLASGNLLLMSFVTDQKPPSFLQSDIEHSPTAQKKDSVMYYVTTSYDYCIDAIKNLDVSKWGEKKIIFKKFEETRYSVMLKAFEHQTHHRGQTTIYIRLQNIIPPAERLFR

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
183 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
184 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
185 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
188 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
189 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
190 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
191 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
192 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
193 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
194 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
195 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
196 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
197 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
198 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 0.77
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 20.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0062058 3300046472 Bacteria 2623
2 JGI24751J29686_10000558 3300002459 Bacteria 10191
3 rootH1_10157040 3300003316 Bacteria 1922
4 rootH1_10061591 3300003323 Unclassified 4838
5 Ga0065704_10273554 3300005289 Unclassified 938
6 Ga0065712_10008270 3300005290 Bacteria 2633
7 Ga0065712_10297141 3300005290 Bacteria 865
8 Ga0065712_10524963 3300005290 Bacteria 633
9 Ga0065715_10211586 3300005293 Bacteria 1270
10 Ga0065715_10290452 3300005293 Bacteria 1064
11 Ga0070658_10292824 3300005327 Bacteria 1387
12 Ga0070676_10070748 3300005328 Bacteria 2094
13 Ga0070676_10914569 3300005328 Bacteria 654
14 Ga0070683_100015309 3300005329 Bacteria 6733
15 Ga0070683_100102505 3300005329 Bacteria 2696
16 Ga0070690_100080109 3300005330 Bacteria 2136
17 Ga0070670_100006585 3300005331 Bacteria 9844
18 Ga0070670_100525451 3300005331 Bacteria 1054
19 Ga0070670_100689895 3300005331 Bacteria 918
20 Ga0070670_100894455 3300005331 Bacteria 805
21 Ga0070677_10327394 3300005333 Bacteria 787
22 Ga0070677_10437958 3300005333 Bacteria 696
23 Ga0068869_100141252 3300005334 Bacteria 1859
24 Ga0068869_100468904 3300005334 Unclassified 1047
25 Ga0070666_10035466 3300005335 Bacteria 3308
26 Ga0070680_100072827 3300005336 Bacteria 2825
27 Ga0070680_101114090 3300005336 Bacteria 682
28 Ga0070682_100859145 3300005337 Bacteria 742
29 Ga0068868_100512857 3300005338 Bacteria 1052
30 Ga0068868_100524617 3300005338 Bacteria 1040
31 Ga0068868_100994528 3300005338 Bacteria 767
32 Ga0070660_100016514 3300005339 Bacteria 5359
33 Ga0070689_100073946 3300005340 Bacteria 2666
34 Ga0070689_100772224 3300005340 Bacteria 843
35 Ga0070689_100824956 3300005340 Unclassified 817
36 Ga0070687_100282755 3300005343 Unclassified 1045
37 Ga0070661_100067233 3300005344 Bacteria 2633
38 Ga0070668_100006017 3300005347 Bacteria 8999
39 Ga0070668_100328474 3300005347 Bacteria 1289
40 Ga0070669_100003045 3300005353 Bacteria 12061
41 Ga0070669_100745840 3300005353 Unclassified 829
42 Ga0070669_100949597 3300005353 Unclassified 736
43 Ga0070675_100010600 3300005354 Bacteria 7206
44 Ga0070675_100060351 3300005354 Bacteria 3131
45 Ga0070675_100857592 3300005354 Bacteria 831
46 Ga0070671_100191070 3300005355 Bacteria 1735
47 Ga0070674_100037876 3300005356 Unclassified 3247
48 Ga0070674_100076628 3300005356 Bacteria 2378
49 Ga0070674_101241054 3300005356 Unclassified 663
50 Ga0070673_100019929 3300005364 Bacteria 4827
51 Ga0070673_100129958 3300005364 Bacteria 2112
52 Ga0070673_100192513 3300005364 Bacteria 1752
53 Ga0070673_100488856 3300005364 Bacteria 1112
54 Ga0070673_100497128 3300005364 Bacteria 1103
55 Ga0070673_100527313 3300005364 Bacteria 1071
56 Ga0070688_100003180 3300005365 Bacteria 8410
57 Ga0070688_100081941 3300005365 Bacteria 2090
58 Ga0070659_100017872 3300005366 Bacteria 5342
59 Ga0070659_100917066 3300005366 Bacteria 766
60 Ga0070667_100139214 3300005367 Bacteria 2124
61 Ga0070667_101029858 3300005367 Unclassified 768
62 Ga0070700_100109113 3300005441 Bacteria 1837
63 Ga0070678_100438416 3300005456 Bacteria 1142
64 Ga0070678_101122707 3300005456 Bacteria 727
65 Ga0070662_100187880 3300005457 Bacteria 1632
66 Ga0070662_100374061 3300005457 Bacteria 1171
67 Ga0070681_10381172 3300005458 Bacteria 1321
68 Ga0070681_10972522 3300005458 Bacteria 768
69 Ga0068867_100036435 3300005459 Bacteria 3571
70 Ga0068867_100606431 3300005459 Bacteria 955
71 Ga0070685_10033897 3300005466 Unclassified 2872
72 Ga0070698_100001998 3300005471 Bacteria 22644
73 Ga0070698_100003211 3300005471 Bacteria 18007
74 Ga0070698_100008750 3300005471 Bacteria 10899
75 Ga0070679_100173245 3300005530 Bacteria 2130
76 Ga0070684_100096851 3300005535 Bacteria 2631
77 Ga0068853_100749576 3300005539 Bacteria 933
78 Ga0068853_101002787 3300005539 Bacteria 804
79 Ga0070672_100065707 3300005543 Bacteria 2870
80 Ga0070672_100361401 3300005543 Bacteria 1239
81 Ga0070672_100855330 3300005543 Bacteria 802
82 Ga0070686_100369093 3300005544 Unclassified 1083
83 Ga0070686_100374671 3300005544 Unclassified 1076
84 Ga0070693_100020878 3300005547 Unclassified 3463
85 Ga0070693_100714275 3300005547 Unclassified 735
86 Ga0070704_100163904 3300005549 Bacteria 1761
87 Ga0070704_101270465 3300005549 Unclassified 673
88 Ga0068855_100160463 3300005563 Bacteria 2552
89 Ga0070664_100017972 3300005564 Bacteria 5805
90 Ga0070664_100713375 3300005564 Unclassified 935
91 Ga0068857_100746179 3300005577 Unclassified 932
92 Ga0068857_101141225 3300005577 Unclassified 753
93 Ga0068856_100059267 3300005614 Bacteria 3781
94 Ga0068852_100066176 3300005616 Bacteria 3155
95 Ga0068852_100205089 3300005616 Bacteria 1867
96 Ga0068859_100017217 3300005617 Bacteria 7257
97 Ga0068859_100053118 3300005617 Bacteria 4074
98 Ga0068859_100059962 3300005617 Bacteria 3834
99 Ga0068859_100210235 3300005617 Unclassified 2032
100 Ga0068859_100383583 3300005617 Unclassified 1501
101 Ga0068859_100654098 3300005617 Bacteria 1143
102 Ga0068864_100011158 3300005618 Bacteria 7426
103 Ga0068864_100027463 3300005618 Bacteria 4808
104 Ga0068864_100039266 3300005618 Bacteria 4046
105 Ga0068861_100001380 3300005719 Bacteria 15246
106 Ga0068861_100162699 3300005719 Bacteria 1842
107 Ga0068851_10179053 3300005834 Bacteria 1173
108 Ga0068851_10272214 3300005834 Unclassified 966
109 Ga0068870_10163092 3300005840 Unclassified 1324
110 Ga0068863_101759941 3300005841 Bacteria 629
111 Ga0068858_100097419 3300005842 Bacteria 2742
112 Ga0068858_100461671 3300005842 Unclassified 1225
113 Ga0068858_100474328 3300005842 Bacteria 1207
114 Ga0068860_100009318 3300005843 Bacteria 9753
115 Ga0068860_100018238 3300005843 Bacteria 6830
116 Ga0068860_100390068 3300005843 Unclassified 1376
117 Ga0068860_100684532 3300005843 Bacteria 1035
118 Ga0068862_100028536 3300005844 Bacteria 4700
119 Ga0068862_100065198 3300005844 Bacteria 3137
120 Ga0068862_100072254 3300005844 Bacteria 2980
121 Ga0081539_10264697 3300005985 Bacteria 756
122 Ga0075366_10544875 3300006195 Unclassified 718
123 Ga0097621_100087492 3300006237 Bacteria 2602
124 Ga0097621_100943845 3300006237 Bacteria 805
125 Ga0097621_101037881 3300006237 Bacteria 768
126 Ga0068871_100189288 3300006358 Bacteria 1772
127 Ga0068871_100748987 3300006358 Bacteria 898
128 Ga0068871_101027194 3300006358 Bacteria 768
129 Ga0068871_101035709 3300006358 Bacteria 765
130 Ga0068871_101585659 3300006358 Unclassified 620
131 Ga0075428_100064824 3300006844 Unclassified 4001
132 Ga0075430_100071597 3300006846 Unclassified 2908
133 Ga0075430_100615248 3300006846 Bacteria 896
134 Ga0075431_100095188 3300006847 Bacteria 3074
135 Ga0075431_100835465 3300006847 Bacteria 893
136 Ga0075433_10899307 3300006852 Unclassified 772
137 Ga0075433_10963649 3300006852 Unclassified 743
138 Ga0075429_100108399 3300006880 Unclassified 2427
139 Ga0068865_100761903 3300006881 Bacteria 832
140 Ga0068865_100776410 3300006881 Bacteria 825
141 Ga0097620_100017217 3300006931 Bacteria 7257
142 Ga0097620_100053118 3300006931 Bacteria 4074
143 Ga0097620_100059965 3300006931 Bacteria 3834
144 Ga0097620_100210236 3300006931 Unclassified 2032
145 Ga0097620_100383583 3300006931 Unclassified 1501
146 Ga0097620_100654065 3300006931 Bacteria 1143
147 Ga0075435_100841912 3300007076 Bacteria 799
148 Ga0105251_10327251 3300009011 Unclassified 697
149 Ga0105240_10066362 3300009093 Bacteria 4477
150 Ga0111539_10006591 3300009094 Bacteria 14962
151 Ga0111539_10601098 3300009094 Bacteria 1281
152 Ga0111539_10923762 3300009094 Bacteria 1015
153 Ga0111539_11283605 3300009094 Bacteria 850
154 Ga0111539_11479379 3300009094 Bacteria 788
155 Ga0105247_10004663 3300009101 Bacteria 8739
156 Ga0105247_10005581 3300009101 Bacteria 7904
157 Ga0105247_10703598 3300009101 Unclassified 761
158 Ga0114129_11382512 3300009147 Bacteria 869
159 Ga0105243_10817143 3300009148 Bacteria 920
160 Ga0105242_10098613 3300009176 Bacteria 2471
161 Ga0105242_10169198 3300009176 Bacteria 1919
162 Ga0105242_10188577 3300009176 Bacteria 1824
163 Ga0105242_10861700 3300009176 Bacteria 902
164 Ga0105242_11389563 3300009176 Bacteria 729
165 Ga0105237_10058565 3300009545 Bacteria 3855
166 Ga0105249_10004059 3300009553 Bacteria 12624
167 Ga0105249_10004956 3300009553 Bacteria 11484
168 Ga0105249_10013169 3300009553 Bacteria 7297
169 Ga0105249_10031564 3300009553 Bacteria 4791
170 Ga0105249_10124046 3300009553 Unclassified 2458
171 Ga0105249_10201947 3300009553 Bacteria 1946
172 Ga0105249_10410486 3300009553 Bacteria 1386
173 Ga0105249_10826651 3300009553 Unclassified 991
174 Ga0105239_10000048 3300010375 Bacteria 177855
175 Ga0105239_10004001 3300010375 Bacteria 17855
176 Ga0105239_10134840 3300010375 Bacteria 2748
177 Ga0105239_11360548 3300010375 Bacteria 819
178 Ga0105246_10691278 3300011119 Unclassified 893
179 Ga0157373_10006531 3300013100 Bacteria 8702
180 Ga0157371_10014435 3300013102 Bacteria 5960
181 Ga0157370_10033988 3300013104 Bacteria 4968
182 Ga0157370_10276150 3300013104 Bacteria 1553
183 Ga0157370_10486535 3300013104 Bacteria 1134
184 Ga0157369_10185546 3300013105 Bacteria 2187
185 Ga0157374_10000001 3300013296 Bacteria 1077351
186 Ga0157374_10581487 3300013296 Bacteria 1129
187 Ga0157374_10815082 3300013296 Bacteria 949
188 Ga0157378_10008255 3300013297 Bacteria 9081
189 Ga0157378_10246628 3300013297 Unclassified 1708
190 Ga0157378_10353410 3300013297 Bacteria 1436
191 Ga0157378_11905026 3300013297 Bacteria 644
192 Ga0163162_10001722 3300013306 Bacteria 20499
193 Ga0163162_10104596 3300013306 Bacteria 2926
194 Ga0163162_10124903 3300013306 Unclassified 2679
195 Ga0163162_10188884 3300013306 Bacteria 2187
196 Ga0163162_10850045 3300013306 Bacteria 1028
197 Ga0163162_10904585 3300013306 Bacteria 996
198 Ga0157372_10058296 3300013307 Bacteria 4316
199 Ga0157372_10062089 3300013307 Bacteria 4185
200 Ga0157372_10146957 3300013307 Bacteria 2718
201 Ga0157372_10918346 3300013307 Bacteria 1015
202 Ga0157375_10016578 3300013308 Bacteria 6624
203 Ga0157375_10401573 3300013308 Bacteria 1537
204 Ga0157375_10636172 3300013308 Bacteria 1224
205 Ga0157375_11617017 3300013308 Bacteria 766
206 Ga0163163_10190879 3300014325 Unclassified 2097
207 Ga0163163_10332434 3300014325 Bacteria 1574
208 Ga0163163_10397484 3300014325 Bacteria 1436
209 Ga0163163_10552154 3300014325 Bacteria 1214
210 Ga0163163_10603018 3300014325 Bacteria 1161
211 Ga0163163_10738077 3300014325 Unclassified 1048
212 Ga0157380_10002867 3300014326 Bacteria 11706
213 Ga0157380_10004527 3300014326 Bacteria 9645
214 Ga0157380_10103367 3300014326 Bacteria 2377
215 Ga0157377_10000700 3300014745 Bacteria 13815
216 Ga0157377_10080306 3300014745 Bacteria 1905
217 Ga0157377_10150453 3300014745 Bacteria 1438
218 Ga0157379_10442382 3300014968 Unclassified 1199
219 Ga0157376_10000873 3300014969 Bacteria 19768
220 Ga0157376_10904077 3300014969 Bacteria 901
221 Ga0157376_11158474 3300014969 Unclassified 800
222 Ga0163161_10531432 3300017792 Bacteria 961
223 Ga0207682_10091924 3300025893 Bacteria 1317
224 Ga0207642_10035525 3300025899 Bacteria 2130
225 Ga0207710_10010974 3300025900 Bacteria 3816
226 Ga0207685_10168280 3300025905 Unclassified 1006
227 Ga0207645_10225681 3300025907 Bacteria 1235
228 Ga0207643_10017411 3300025908 Bacteria 3929
229 Ga0207643_10357753 3300025908 Bacteria 917
230 Ga0207643_10817758 3300025908 Unclassified 604
231 Ga0207705_10125214 3300025909 Bacteria 1909
232 Ga0207684_10594229 3300025910 Bacteria 946
233 Ga0207707_10539681 3300025912 Bacteria 992
234 Ga0207695_10038899 3300025913 Bacteria 5115
235 Ga0207662_10058259 3300025918 Unclassified 2312
236 Ga0207662_10187393 3300025918 Unclassified 1334
237 Ga0207657_10040070 3300025919 Bacteria 4154
238 Ga0207649_10783968 3300025920 Bacteria 743
239 Ga0207652_10015689 3300025921 Bacteria 6169
240 Ga0207646_10963860 3300025922 Bacteria 755
241 Ga0207681_10008669 3300025923 Bacteria 6209
242 Ga0207681_10344593 3300025923 Unclassified 1191
243 Ga0207694_10503792 3300025924 Unclassified 1014
244 Ga0207650_10094266 3300025925 Bacteria 2293
245 Ga0207650_10161065 3300025925 Bacteria 1778
246 Ga0207650_10843886 3300025925 Bacteria 777
247 Ga0207659_10020599 3300025926 Bacteria 4362
248 Ga0207659_10475993 3300025926 Bacteria 1055
249 Ga0207659_10615996 3300025926 Bacteria 926
250 Ga0207659_11083612 3300025926 Unclassified 689
251 Ga0207690_10439043 3300025932 Bacteria 1047
252 Ga0207706_10022512 3300025933 Bacteria 5654
253 Ga0207686_10081435 3300025934 Bacteria 2113
254 Ga0207686_10222353 3300025934 Bacteria 1364
255 Ga0207686_10619314 3300025934 Bacteria 854
256 Ga0207686_10659734 3300025934 Unclassified 828
257 Ga0207670_10029226 3300025936 Bacteria 3509
258 Ga0207669_10027081 3300025937 Bacteria 3131
259 Ga0207669_10039670 3300025937 Bacteria 2724
260 Ga0207704_10500760 3300025938 Unclassified 979
261 Ga0207704_10610888 3300025938 Bacteria 894
262 Ga0207691_10019398 3300025940 Bacteria 6435
263 Ga0207691_10565725 3300025940 Bacteria 963
264 Ga0207689_10088810 3300025942 Unclassified 2539
265 Ga0207689_10849558 3300025942 Bacteria 770
266 Ga0207661_10033436 3300025944 Bacteria 3991
267 Ga0207661_10915477 3300025944 Bacteria 808
268 Ga0207679_10112221 3300025945 Bacteria 2154
269 Ga0207679_10549327 3300025945 Bacteria 1036
270 Ga0207667_10133459 3300025949 Bacteria 2557
271 Ga0207651_10040387 3300025960 Bacteria 3086
272 Ga0207651_10115178 3300025960 Bacteria 2027
273 Ga0207651_10605374 3300025960 Bacteria 958
274 Ga0207651_10691687 3300025960 Bacteria 898
275 Ga0207712_10001716 3300025961 Bacteria 14705
276 Ga0207712_10028840 3300025961 Bacteria 3716
277 Ga0207712_10124770 3300025961 Unclassified 1953
278 Ga0207712_10515173 3300025961 Bacteria 1024
279 Ga0207668_10086336 3300025972 Bacteria 2292
280 Ga0207668_10221511 3300025972 Bacteria 1520
281 Ga0207668_10257751 3300025972 Bacteria 1420
282 Ga0207640_10241242 3300025981 Bacteria 1397
283 Ga0207658_10132625 3300025986 Unclassified 2004
284 Ga0207658_10243082 3300025986 Bacteria 1526
285 Ga0207658_11025401 3300025986 Unclassified 753
286 Ga0207677_11210434 3300026023 Bacteria 692
287 Ga0207703_10270940 3300026035 Unclassified 1538
288 Ga0207703_10577206 3300026035 Bacteria 1062
289 Ga0207703_11106424 3300026035 Bacteria 761
290 Ga0207703_11155741 3300026035 Bacteria 744
291 Ga0207639_10390824 3300026041 Bacteria 1251
292 Ga0207639_10401134 3300026041 Bacteria 1235
293 Ga0207678_10301665 3300026067 Bacteria 1377
294 Ga0207708_10134641 3300026075 Bacteria 1934
295 Ga0207708_10204515 3300026075 Bacteria 1576
296 Ga0207702_11109533 3300026078 Bacteria 785
297 Ga0207641_10001235 3300026088 Bacteria 25590
298 Ga0207641_11699290 3300026088 Bacteria 633
299 Ga0207648_10005962 3300026089 Bacteria 12184
300 Ga0207648_10175384 3300026089 Bacteria 1896
301 Ga0207648_10333042 3300026089 Bacteria 1366
302 Ga0207648_11072643 3300026089 Bacteria 755
303 Ga0207676_10004569 3300026095 Bacteria 9806
304 Ga0207676_10007158 3300026095 Bacteria 7900
305 Ga0207674_10003326 3300026116 Bacteria 19763
306 Ga0207674_10077372 3300026116 Bacteria 3332
307 Ga0207674_10163281 3300026116 Bacteria 2182
308 Ga0207674_10221936 3300026116 Unclassified 1838
309 Ga0207674_10269048 3300026116 Bacteria 1651
310 Ga0207674_10283805 3300026116 Bacteria 1604
311 Ga0207674_10506108 3300026116 Bacteria 1167
312 Ga0207675_100000051 3300026118 Bacteria 83288
313 Ga0207675_100242755 3300026118 Unclassified 1741
314 Ga0207675_100320112 3300026118 Bacteria 1514
315 Ga0207675_100627252 3300026118 Unclassified 1080
316 Ga0207683_10382939 3300026121 Unclassified 1293
317 Ga0207683_10557398 3300026121 Bacteria 1060
318 Ga0207698_10048704 3300026142 Bacteria 3219
319 Ga0207698_10178143 3300026142 Bacteria 1880
320 Ga0268265_10013778 3300028380 Bacteria 5502
321 Ga0268265_10053577 3300028380 Bacteria 3057
322 Ga0268265_10066128 3300028380 Bacteria 2793
323 Ga0268265_10575859 3300028380 Unclassified 1072
324 Ga0268264_10013038 3300028381 Bacteria 6831
325 Ga0268264_10021978 3300028381 Bacteria 5206
326 Ga0268264_11509163 3300028381 Unclassified 683
327 Ga0307517_10399381 3300028786 Bacteria 728
328 Ga0307509_10138998 3300031507 Bacteria 2369
329 Ga0307516_10114916 3300031730 Bacteria 2489
330 Ga0307414_10351117 3300032004 Unclassified 1266
331 Ga0307414_10688185 3300032004 Bacteria 925
332 Ga0439439_0030013 3300041406 Bacteria 1381
333 Ga0451793_0757368 3300041452 Unclassified 817
334 Ga0451800_0822622 3300041459 Bacteria 1675
335 Ga0451807_1176723 3300041486 Bacteria 1336
336 Ga0439431_0099766 3300041997 Unclassified 797
337 Ga0439442_008493 3300042002 Bacteria 2074
338 Ga0439448_0144217 3300042005 Bacteria 825
339 Ga0439449_0040363 3300042007 Bacteria 1735
340 Ga0439457_008335 3300042014 Bacteria 2449
341 Ga0450923_074168 3300042125 Unclassified 758
342 Ga0450898_002203 3300042134 Unclassified 2705
343 Ga0466961_0069759 3300044693 Unclassified 2231
344 Ga0466971_0006342 3300044719 Bacteria 5135
345 Ga0466957_0002370 3300044842 Bacteria 10112
346 Ga0466959_0092383 3300045049 Unclassified 2172
347 Ga0466958_0048374 3300045836 Unclassified 2570
348 Ga0466967_0299168 3300045976 Bacteria 1548
349 Ga0466967_0418958 3300045976 Bacteria 1305
350 Ga0495629_0098314 3300046459 Bacteria 2042
351 Ga0495582_0300393 3300046473 Bacteria 923
352 Ga0495594_0221974 3300046499 Bacteria 1078
353 Ga0495652_0353084 3300046529 Bacteria 1053
354 Ga0495587_0416822 3300046536 Bacteria 746
355 Ga0495598_0186278 3300046537 Bacteria 743
356 Ga0495645_0157001 3300046543 Bacteria 1576
357 Ga0495611_0000086 3300046648 Bacteria 66762
358 Ga0495611_0158223 3300046648 Unclassified 1058
359 Ga0495623_0254647 3300046679 Unclassified 986
360 Ga0495658_0156937 3300046683 Bacteria 1401
361 Ga0495674_1079911 3300047319 Unclassified 612
362 Ga0495672_0173282 3300047320 Bacteria 1098
363 Ga0495684_0150546 3300047471 Bacteria 1740
364 Ga0501298_013239 3300049521 Bacteria 1458
365 Ga0501300_036600 3300049523 Bacteria 733
366 Ga0501198_002861 3300049649 Bacteria 2345
367 Ga0501207_000556 3300049654 Bacteria 4265
368 Ga0501217_164428 3300049661 Bacteria 671
369 Ga0501223_001288 3300049663 Bacteria 5827
370 Ga0501233_040253 3300049668 Bacteria 1095
371 Ga0501246_007344 3300049676 Bacteria 960
372 Ga0501249_051510 3300049679 Bacteria 946
373 Ga0501252_000823 3300049682 Bacteria 2622
374 Ga0501259_001289 3300049688 Bacteria 4196
375 Ga0501221_025425 3300049704 Bacteria 1196
376 Ga0501245_014708 3300049708 Bacteria 1170
377 Ga0501232_006948 3300049757 Bacteria 1179
378 Ga0501266_040791 3300049763 Bacteria 690
379 Ga0501267_014349 3300049764 Bacteria 831
380 Ga0501279_004621 3300049775 Bacteria 1809
381 Ga0501044_0190282 3300049823 Bacteria 2015
382 nmdc:mga05p37_100274_c1 3300050507 Bacteria 3566
383 nmdc:mga09592_72684_c1 3300050508 Bacteria 2921
384 nmdc:mga0qj67_32779_c1 3300050509 Bacteria 4053
385 nmdc:mga08y16_1687653_c1 3300050511 Unclassified 589
386 nmdc:mga08y16_513338_c1 3300050511 Unclassified 1216
387 Ga0500588_0023912 3300053146 Bacteria 1681
388 Ga0466962_0016847 3300061719 Unclassified 3521
389 Ga0495580_0062058
390 JGI24751J29686_10000558
391 rootH1_10157040
392 rootH1_10061591
393 Ga0065704_10273554
394 Ga0065712_10008270
395 Ga0065712_10297141
396 Ga0065712_10524963
397 Ga0065715_10211586
398 Ga0065715_10290452
399 Ga0070658_10292824
400 Ga0070676_10070748
401 Ga0070676_10914569
402 Ga0070683_100015309
403 Ga0070683_100102505
404 Ga0070690_100080109
405 Ga0070670_100006585
406 Ga0070670_100525451
407 Ga0070670_100689895
408 Ga0070670_100894455
409 Ga0070677_10327394
410 Ga0070677_10437958
411 Ga0068869_100141252
412 Ga0068869_100468904
413 Ga0070666_10035466
414 Ga0070680_100072827
415 Ga0070680_101114090
416 Ga0070682_100859145
417 Ga0068868_100512857
418 Ga0068868_100524617
419 Ga0068868_100994528
420 Ga0070660_100016514
421 Ga0070689_100073946
422 Ga0070689_100772224
423 Ga0070689_100824956
424 Ga0070687_100282755
425 Ga0070661_100067233
426 Ga0070668_100006017
427 Ga0070668_100328474
428 Ga0070669_100003045
429 Ga0070669_100745840
430 Ga0070669_100949597
431 Ga0070675_100010600
432 Ga0070675_100060351
433 Ga0070675_100857592
434 Ga0070671_100191070
435 Ga0070674_100037876
436 Ga0070674_100076628
437 Ga0070674_101241054
438 Ga0070673_100019929
439 Ga0070673_100129958
440 Ga0070673_100192513
441 Ga0070673_100488856
442 Ga0070673_100497128
443 Ga0070673_100527313
444 Ga0070688_100003180
445 Ga0070688_100081941
446 Ga0070659_100017872
447 Ga0070659_100917066
448 Ga0070667_100139214
449 Ga0070667_101029858
450 Ga0070700_100109113
451 Ga0070678_100438416
452 Ga0070678_101122707
453 Ga0070662_100187880
454 Ga0070662_100374061
455 Ga0070681_10381172
456 Ga0070681_10972522
457 Ga0068867_100036435
458 Ga0068867_100606431
459 Ga0070685_10033897
460 Ga0070698_100001998
461 Ga0070698_100003211
462 Ga0070698_100008750
463 Ga0070679_100173245
464 Ga0070684_100096851
465 Ga0068853_100749576
466 Ga0068853_101002787
467 Ga0070672_100065707
468 Ga0070672_100361401
469 Ga0070672_100855330
470 Ga0070686_100369093
471 Ga0070686_100374671
472 Ga0070693_100020878
473 Ga0070693_100714275
474 Ga0070704_100163904
475 Ga0070704_101270465
476 Ga0068855_100160463
477 Ga0070664_100017972
478 Ga0070664_100713375
479 Ga0068857_100746179
480 Ga0068857_101141225
481 Ga0068856_100059267
482 Ga0068852_100066176
483 Ga0068852_100205089
484 Ga0068859_100017217
485 Ga0068859_100053118
486 Ga0068859_100059962
487 Ga0068859_100210235
488 Ga0068859_100383583
489 Ga0068859_100654098
490 Ga0068864_100011158
491 Ga0068864_100027463
492 Ga0068864_100039266
493 Ga0068861_100001380
494 Ga0068861_100162699
495 Ga0068851_10179053
496 Ga0068851_10272214
497 Ga0068870_10163092
498 Ga0068863_101759941
499 Ga0068858_100097419
500 Ga0068858_100461671
501 Ga0068858_100474328
502 Ga0068860_100009318
503 Ga0068860_100018238
504 Ga0068860_100390068
505 Ga0068860_100684532
506 Ga0068862_100028536
507 Ga0068862_100065198
508 Ga0068862_100072254
509 Ga0081539_10264697
510 Ga0075366_10544875
511 Ga0097621_100087492
512 Ga0097621_100943845
513 Ga0097621_101037881
514 Ga0068871_100189288
515 Ga0068871_100748987
516 Ga0068871_101027194
517 Ga0068871_101035709
518 Ga0068871_101585659
519 Ga0075428_100064824
520 Ga0075430_100071597
521 Ga0075430_100615248
522 Ga0075431_100095188
523 Ga0075431_100835465
524 Ga0075433_10899307
525 Ga0075433_10963649
526 Ga0075429_100108399
527 Ga0068865_100761903
528 Ga0068865_100776410
529 Ga0097620_100017217
530 Ga0097620_100053118
531 Ga0097620_100059965
532 Ga0097620_100210236
533 Ga0097620_100383583
534 Ga0097620_100654065
535 Ga0075435_100841912
536 Ga0105251_10327251
537 Ga0105240_10066362
538 Ga0111539_10006591
539 Ga0111539_10601098
540 Ga0111539_10923762
541 Ga0111539_11283605
542 Ga0111539_11479379
543 Ga0105247_10004663
544 Ga0105247_10005581
545 Ga0105247_10703598
546 Ga0114129_11382512
547 Ga0105243_10817143
548 Ga0105242_10098613
549 Ga0105242_10169198
550 Ga0105242_10188577
551 Ga0105242_10861700
552 Ga0105242_11389563
553 Ga0105237_10058565
554 Ga0105249_10004059
555 Ga0105249_10004956
556 Ga0105249_10013169
557 Ga0105249_10031564
558 Ga0105249_10124046
559 Ga0105249_10201947
560 Ga0105249_10410486
561 Ga0105249_10826651
562 Ga0105239_10000048
563 Ga0105239_10004001
564 Ga0105239_10134840
565 Ga0105239_11360548
566 Ga0105246_10691278
567 Ga0157373_10006531
568 Ga0157371_10014435
569 Ga0157370_10033988
570 Ga0157370_10276150
571 Ga0157370_10486535
572 Ga0157369_10185546
573 Ga0157374_10000001
574 Ga0157374_10581487
575 Ga0157374_10815082
576 Ga0157378_10008255
577 Ga0157378_10246628
578 Ga0157378_10353410
579 Ga0157378_11905026
580 Ga0163162_10001722
581 Ga0163162_10104596
582 Ga0163162_10124903
583 Ga0163162_10188884
584 Ga0163162_10850045
585 Ga0163162_10904585
586 Ga0157372_10058296
587 Ga0157372_10062089
588 Ga0157372_10146957
589 Ga0157372_10918346
590 Ga0157375_10016578
591 Ga0157375_10401573
592 Ga0157375_10636172
593 Ga0157375_11617017
594 Ga0163163_10190879
595 Ga0163163_10332434
596 Ga0163163_10397484
597 Ga0163163_10552154
598 Ga0163163_10603018
599 Ga0163163_10738077
600 Ga0157380_10002867
601 Ga0157380_10004527
602 Ga0157380_10103367
603 Ga0157377_10000700
604 Ga0157377_10080306
605 Ga0157377_10150453
606 Ga0157379_10442382
607 Ga0157376_10000873
608 Ga0157376_10904077
609 Ga0157376_11158474
610 Ga0163161_10531432
611 Ga0207682_10091924
612 Ga0207642_10035525
613 Ga0207710_10010974
614 Ga0207685_10168280
615 Ga0207645_10225681
616 Ga0207643_10017411
617 Ga0207643_10357753
618 Ga0207643_10817758
619 Ga0207705_10125214
620 Ga0207684_10594229
621 Ga0207707_10539681
622 Ga0207695_10038899
623 Ga0207662_10058259
624 Ga0207662_10187393
625 Ga0207657_10040070
626 Ga0207649_10783968
627 Ga0207652_10015689
628 Ga0207646_10963860
629 Ga0207681_10008669
630 Ga0207681_10344593
631 Ga0207694_10503792
632 Ga0207650_10094266
633 Ga0207650_10161065
634 Ga0207650_10843886
635 Ga0207659_10020599
636 Ga0207659_10475993
637 Ga0207659_10615996
638 Ga0207659_11083612
639 Ga0207690_10439043
640 Ga0207706_10022512
641 Ga0207686_10081435
642 Ga0207686_10222353
643 Ga0207686_10619314
644 Ga0207686_10659734
645 Ga0207670_10029226
646 Ga0207669_10027081
647 Ga0207669_10039670
648 Ga0207704_10500760
649 Ga0207704_10610888
650 Ga0207691_10019398
651 Ga0207691_10565725
652 Ga0207689_10088810
653 Ga0207689_10849558
654 Ga0207661_10033436
655 Ga0207661_10915477
656 Ga0207679_10112221
657 Ga0207679_10549327
658 Ga0207667_10133459
659 Ga0207651_10040387
660 Ga0207651_10115178
661 Ga0207651_10605374
662 Ga0207651_10691687
663 Ga0207712_10001716
664 Ga0207712_10028840
665 Ga0207712_10124770
666 Ga0207712_10515173
667 Ga0207668_10086336
668 Ga0207668_10221511
669 Ga0207668_10257751
670 Ga0207640_10241242
671 Ga0207658_10132625
672 Ga0207658_10243082
673 Ga0207658_11025401
674 Ga0207677_11210434
675 Ga0207703_10270940
676 Ga0207703_10577206
677 Ga0207703_11106424
678 Ga0207703_11155741
679 Ga0207639_10390824
680 Ga0207639_10401134
681 Ga0207678_10301665
682 Ga0207708_10134641
683 Ga0207708_10204515
684 Ga0207702_11109533
685 Ga0207641_10001235
686 Ga0207641_11699290
687 Ga0207648_10005962
688 Ga0207648_10175384
689 Ga0207648_10333042
690 Ga0207648_11072643
691 Ga0207676_10004569
692 Ga0207676_10007158
693 Ga0207674_10003326
694 Ga0207674_10077372
695 Ga0207674_10163281
696 Ga0207674_10221936
697 Ga0207674_10269048
698 Ga0207674_10283805
699 Ga0207674_10506108
700 Ga0207675_100000051
701 Ga0207675_100242755
702 Ga0207675_100320112
703 Ga0207675_100627252
704 Ga0207683_10382939
705 Ga0207683_10557398
706 Ga0207698_10048704
707 Ga0207698_10178143
708 Ga0268265_10013778
709 Ga0268265_10053577
710 Ga0268265_10066128
711 Ga0268265_10575859
712 Ga0268264_10013038
713 Ga0268264_10021978
714 Ga0268264_11509163
715 Ga0307517_10399381
716 Ga0307509_10138998
717 Ga0307516_10114916
718 Ga0307414_10351117
719 Ga0307414_10688185
720 Ga0439439_0030013
721 Ga0451793_0757368
722 Ga0451800_0822622
723 Ga0451807_1176723
724 Ga0439431_0099766
725 Ga0439442_008493
726 Ga0439448_0144217
727 Ga0439449_0040363
728 Ga0439457_008335
729 Ga0450923_074168
730 Ga0450898_002203
731 Ga0466961_0069759
732 Ga0466971_0006342
733 Ga0466957_0002370
734 Ga0466959_0092383
735 Ga0466958_0048374
736 Ga0466967_0299168
737 Ga0466967_0418958
738 Ga0495629_0098314
739 Ga0495582_0300393
740 Ga0495594_0221974
741 Ga0495652_0353084
742 Ga0495587_0416822
743 Ga0495598_0186278
744 Ga0495645_0157001
745 Ga0495611_0000086
746 Ga0495611_0158223
747 Ga0495623_0254647
748 Ga0495658_0156937
749 Ga0495674_1079911
750 Ga0495672_0173282
751 Ga0495684_0150546
752 Ga0501298_013239
753 Ga0501300_036600
754 Ga0501198_002861
755 Ga0501207_000556
756 Ga0501217_164428
757 Ga0501223_001288
758 Ga0501233_040253
759 Ga0501246_007344
760 Ga0501249_051510
761 Ga0501252_000823
762 Ga0501259_001289
763 Ga0501221_025425
764 Ga0501245_014708
765 Ga0501232_006948
766 Ga0501266_040791
767 Ga0501267_014349
768 Ga0501279_004621
769 Ga0501044_0190282
770 nmdc:mga05p37_100274_c1
771 nmdc:mga09592_72684_c1
772 nmdc:mga0qj67_32779_c1
773 nmdc:mga08y16_1687653_c1
774 nmdc:mga08y16_513338_c1
775 Ga0500588_0023912
776 Ga0466962_0016847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

78

207

0.92

PF05163

DinB

DinB family

61

219

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8458 37 183
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8278 34 183
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.8131 33 170
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8054 37 183
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.8043 30 170
ID Description Score Start End Superfamily
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.823 35 183 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.798 35 183 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7969 37 170 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7885 36 175 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7759 32 176 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A3D2XHH3-F1-model_v4 Damage-inducible protein DinB 0.9653 26 185
AF-A0A1T5DTK7-F1-model_v4 Uncharacterized damage-inducible protein DinB (Forms a four-helix bundle) 0.964 29 185
AF-A0A317GX78-F1-model_v4 Damage-inducible protein DinB 0.9543 27 185
AF-A0A7T9GK62-F1-model_v4 deleted 0.9497 32 185
AF-A0A7Y2UW99-F1-model_v4 DinB family protein 0.9484 38 185

Map