F431169

General Info

Members Datasets Scaffolds Average Seq Length
388 277 388 130

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100256866|Ga0307409_1002568662
Length 120
Sequence MTSRSDTSALPGLPADGATPVFAAPWQAHAFAMVVALHEKGLFTWPEWAAALAAEIKAAGDRDTGDTYYAHWLAALERLLAAKRVTTADALARYRDAWDTAAHRTPHGAPIELMAEDFRD

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
133 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
270 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
273 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
274 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.73
Nodule 0
Rhizoplane 8.51
Rhizosphere 80.67
Stem 0
Stem Tuber 0
Unclassified 3.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1021990 3300001977 Bacteria 890
2 JGI25406J46586_10069525 3300003203 Bacteria 1109
3 JGI25406J46586_10234899 3300003203 Bacteria 537
4 Ga0070690_100333403 3300005330 Bacteria 1097
5 Ga0070670_100166994 3300005331 Bacteria 1908
6 Ga0070670_100340878 3300005331 Bacteria 1316
7 Ga0070677_10316615 3300005333 Bacteria 798
8 Ga0070666_10921272 3300005335 Bacteria 647
9 Ga0068868_100006791 3300005338 Bacteria 8129
10 Ga0070689_100043691 3300005340 Bacteria 3445
11 Ga0070689_101256361 3300005340 Bacteria 666
12 Ga0070687_100165137 3300005343 Bacteria 1312
13 Ga0070661_100448194 3300005344 Bacteria 1027
14 Ga0070675_100518210 3300005354 Bacteria 1076
15 Ga0070675_101058815 3300005354 Bacteria 745
16 Ga0070671_100201276 3300005355 Bacteria 1689
17 Ga0070674_100128711 3300005356 Bacteria 1884
18 Ga0070710_10164326 3300005437 Bacteria 1379
19 Ga0070701_10052879 3300005438 Bacteria 2112
20 Ga0070701_10587898 3300005438 Bacteria 735
21 Ga0070711_100235290 3300005439 Bacteria 1430
22 Ga0070700_100408193 3300005441 Bacteria 1023
23 Ga0070708_100251130 3300005445 Bacteria 1662
24 Ga0070708_100606769 3300005445 Bacteria 1032
25 Ga0070678_101596883 3300005456 Bacteria 612
26 Ga0070662_100364934 3300005457 Bacteria 1186
27 Ga0068867_100331489 3300005459 Bacteria 1264
28 Ga0070685_11583188 3300005466 Bacteria 506
29 Ga0070697_100744122 3300005536 Bacteria 866
30 Ga0070695_101818130 3300005545 Bacteria 511
31 Ga0070704_100126756 3300005549 Bacteria 1971
32 Ga0068857_100241298 3300005577 Bacteria 1655
33 Ga0068856_100032045 3300005614 Bacteria 5144
34 Ga0068856_100237582 3300005614 Bacteria 1838
35 Ga0070702_100306615 3300005615 Bacteria 1101
36 Ga0068852_100522414 3300005616 Bacteria 1185
37 Ga0068852_102372353 3300005616 Bacteria 551
38 Ga0068859_100150199 3300005617 Bacteria 2405
39 Ga0068859_101258029 3300005617 Bacteria 815
40 Ga0068864_100022753 3300005618 Bacteria 5256
41 Ga0068861_100019565 3300005719 Bacteria 4836
42 Ga0068861_100261596 3300005719 Bacteria 1481
43 Ga0068861_100267490 3300005719 Bacteria 1466
44 Ga0068870_10211985 3300005840 Bacteria 1180
45 Ga0068863_100845009 3300005841 Bacteria 914
46 Ga0068858_100108729 3300005842 Bacteria 2588
47 Ga0068858_100121282 3300005842 Unclassified 2445
48 Ga0068858_100240133 3300005842 Bacteria 1719
49 Ga0068858_100423201 3300005842 Bacteria 1281
50 Ga0068860_100049999 3300005843 Bacteria 3981
51 Ga0068860_100411966 3300005843 Bacteria 1338
52 Ga0068862_100146898 3300005844 Unclassified 2096
53 Ga0068862_100241813 3300005844 Bacteria 1641
54 Ga0081455_10757004 3300005937 Bacteria 613
55 Ga0081455_10919638 3300005937 Bacteria 543
56 Ga0081540_1003549 3300005983 Bacteria 12287
57 Ga0081539_10002634 3300005985 Bacteria 24532
58 Ga0081539_10023930 3300005985 Bacteria 3983
59 Ga0070717_11009576 3300006028 Bacteria 758
60 Ga0075365_10166858 3300006038 Bacteria 1536
61 Ga0075365_10398922 3300006038 Bacteria 971
62 Ga0075368_10001575 3300006042 Bacteria 7319
63 Ga0075363_100001337 3300006048 Bacteria 9247
64 Ga0075363_100236505 3300006048 Bacteria 1049
65 Ga0075363_100801700 3300006048 Bacteria 573
66 Ga0075364_10232866 3300006051 Bacteria 1251
67 Ga0070716_100442844 3300006173 Bacteria 945
68 Ga0070716_101513888 3300006173 Bacteria 549
69 Ga0070712_100111343 3300006175 Bacteria 2044
70 Ga0075367_10002161 3300006178 Bacteria 8857
71 Ga0075369_10000095 3300006186 Bacteria 23768
72 Ga0075370_10212393 3300006353 Bacteria 1142
73 Ga0075370_10285882 3300006353 Bacteria 980
74 Ga0075370_10851030 3300006353 Bacteria 557
75 Ga0068871_101186455 3300006358 Bacteria 716
76 Ga0075428_100351934 3300006844 Bacteria 1581
77 Ga0075428_100488563 3300006844 Bacteria 1317
78 Ga0075431_100197133 3300006847 Bacteria 2061
79 Ga0075433_10061418 3300006852 Bacteria 3292
80 Ga0075434_100095903 3300006871 Bacteria 2971
81 Ga0075434_101281004 3300006871 Bacteria 744
82 Ga0097620_100150198 3300006931 Bacteria 2405
83 Ga0097620_101257712 3300006931 Bacteria 815
84 Ga0075435_100042932 3300007076 Bacteria 3618
85 Ga0075435_100647650 3300007076 Bacteria 917
86 Ga0099795_10124562 3300007788 Bacteria 1034
87 Ga0105244_10463582 3300009036 Bacteria 583
88 Ga0111539_10012470 3300009094 Bacteria 10653
89 Ga0111539_10628946 3300009094 Bacteria 1250
90 Ga0111539_10759044 3300009094 Bacteria 1129
91 Ga0105245_12518747 3300009098 Bacteria 568
92 Ga0105247_10083834 3300009101 Bacteria 2014
93 Ga0105247_10202567 3300009101 Bacteria 1334
94 Ga0105247_10212270 3300009101 Bacteria 1306
95 Ga0105247_10402940 3300009101 Bacteria 975
96 Ga0114129_11236363 3300009147 Bacteria 929
97 Ga0105243_10453745 3300009148 Bacteria 1203
98 Ga0105243_10903538 3300009148 Bacteria 878
99 Ga0105242_10466140 3300009176 Unclassified 1194
100 Ga0105248_10135958 3300009177 Bacteria 2773
101 Ga0105237_10472429 3300009545 Bacteria 1260
102 Ga0105238_10109194 3300009551 Bacteria 2748
103 Ga0105249_11456059 3300009553 Bacteria 757
104 Ga0105249_11918973 3300009553 Bacteria 665
105 Ga0099796_10040021 3300010159 Bacteria 1581
106 Ga0105239_10057561 3300010375 Bacteria 4264
107 Ga0105246_11031996 3300011119 Bacteria 746
108 Ga0157374_12766516 3300013296 Bacteria 518
109 Ga0157375_10487309 3300013308 Bacteria 1398
110 Ga0163163_10268838 3300014325 Bacteria 1756
111 Ga0163163_11708676 3300014325 Bacteria 690
112 Ga0157380_10548549 3300014326 Bacteria 1133
113 Ga0182008_10520006 3300014497 Bacteria 657
114 Ga0157377_10173232 3300014745 Bacteria 1351
115 Ga0157379_10217389 3300014968 Bacteria 1731
116 Ga0157376_10427847 3300014969 Bacteria 1286
117 Ga0163161_10357290 3300017792 Bacteria 1163
118 Ga0213873_10025237 3300021358 Bacteria 1433
119 Ga0213872_10051285 3300021361 Bacteria 1873
120 Ga0213875_10025835 3300021388 Bacteria 2795
121 Ga0213871_10057017 3300021441 Bacteria 1082
122 Ga0207692_10180729 3300025898 Bacteria 1229
123 Ga0207692_10252297 3300025898 Bacteria 1058
124 Ga0207692_10926431 3300025898 Bacteria 574
125 Ga0207710_10070618 3300025900 Bacteria 1601
126 Ga0207710_10081177 3300025900 Bacteria 1505
127 Ga0207710_10127586 3300025900 Bacteria 1220
128 Ga0207688_10227460 3300025901 Bacteria 1125
129 Ga0207647_10070013 3300025904 Bacteria 2120
130 Ga0207685_10236246 3300025905 Bacteria 877
131 Ga0207699_10295487 3300025906 Bacteria 1130
132 Ga0207643_10023724 3300025908 Bacteria 3384
133 Ga0207643_10032478 3300025908 Bacteria 2916
134 Ga0207707_10453335 3300025912 Bacteria 1097
135 Ga0207693_10045184 3300025915 Bacteria 3461
136 Ga0207663_10111111 3300025916 Bacteria 1860
137 Ga0207663_10272757 3300025916 Unclassified 1254
138 Ga0207663_10417083 3300025916 Bacteria 1030
139 Ga0207662_10004684 3300025918 Bacteria 7220
140 Ga0207649_11447631 3300025920 Bacteria 544
141 Ga0207694_10122005 3300025924 Bacteria 2081
142 Ga0207650_10080800 3300025925 Bacteria 2465
143 Ga0207650_10295042 3300025925 Bacteria 1323
144 Ga0207659_10209546 3300025926 Bacteria 1561
145 Ga0207700_10712064 3300025928 Bacteria 896
146 Ga0207664_10102086 3300025929 Bacteria 2371
147 Ga0207664_10636677 3300025929 Bacteria 958
148 Ga0207690_10696240 3300025932 Bacteria 835
149 Ga0207686_11176747 3300025934 Unclassified 627
150 Ga0207709_10834167 3300025935 Bacteria 746
151 Ga0207670_11104352 3300025936 Bacteria 670
152 Ga0207704_10408389 3300025938 Bacteria 1073
153 Ga0207704_11340501 3300025938 Bacteria 612
154 Ga0207665_10271924 3300025939 Bacteria 1258
155 Ga0207691_10000903 3300025940 Bacteria 29435
156 Ga0207711_10674212 3300025941 Bacteria 964
157 Ga0207711_10970285 3300025941 Bacteria 789
158 Ga0207689_10021327 3300025942 Bacteria 5447
159 Ga0207679_10766352 3300025945 Bacteria 878
160 Ga0207679_11429593 3300025945 Bacteria 634
161 Ga0207668_11266730 3300025972 Unclassified 663
162 Ga0207703_10127399 3300026035 Bacteria 2194
163 Ga0207703_10182098 3300026035 Bacteria 1855
164 Ga0207703_10244582 3300026035 Bacteria 1614
165 Ga0207639_10201824 3300026041 Bacteria 1706
166 Ga0207678_10139983 3300026067 Bacteria 2065
167 Ga0207708_10020606 3300026075 Bacteria 4973
168 Ga0207708_10218253 3300026075 Bacteria 1527
169 Ga0207708_10354516 3300026075 Unclassified 1204
170 Ga0207702_10012944 3300026078 Bacteria 6939
171 Ga0207702_10043097 3300026078 Bacteria 3788
172 Ga0207702_10716885 3300026078 Bacteria 986
173 Ga0207676_10259406 3300026095 Bacteria 1568
174 Ga0207674_10256140 3300026116 Bacteria 1697
175 Ga0207675_100017780 3300026118 Bacteria 6633
176 Ga0207675_100382021 3300026118 Bacteria 1385
177 Ga0207683_10021888 3300026121 Bacteria 5483
178 Ga0209813_10046942 3300027866 Bacteria 1336
179 Ga0209813_10077297 3300027866 Bacteria 1094
180 Ga0207428_10060944 3300027907 Bacteria 2989
181 Ga0268266_10651126 3300028379 Bacteria 1014
182 Ga0268266_11003641 3300028379 Bacteria 808
183 Ga0268265_10129233 3300028380 Unclassified 2096
184 Ga0268265_10903786 3300028380 Bacteria 867
185 Ga0268264_10037423 3300028381 Bacteria 4001
186 Ga0265337_1013681 3300028556 Bacteria 2713
187 Ga0265319_1019908 3300028563 Bacteria 2496
188 Ga0265334_10002202 3300028573 Bacteria 9163
189 Ga0265318_10027059 3300028577 Bacteria 2256
190 Ga0265318_10140763 3300028577 Bacteria 886
191 Ga0265323_10002846 3300028653 Bacteria 7782
192 Ga0265322_10041781 3300028654 Bacteria 1305
193 Ga0265336_10000277 3300028666 Bacteria 36011
194 Ga0265338_10002073 3300028800 Bacteria 30961
195 Ga0265324_10007119 3300029957 Bacteria 4574
196 Ga0265325_10336104 3300031241 Bacteria 669
197 Ga0265329_10088443 3300031242 Bacteria 982
198 Ga0265316_10367488 3300031344 Bacteria 1039
199 Ga0265314_10403721 3300031711 Bacteria 738
200 Ga0307413_10494066 3300031824 Bacteria 981
201 Ga0307406_10099424 3300031901 Bacteria 1978
202 Ga0307409_100256866 3300031995 Bacteria 1601
203 Ga0373950_0030875 3300034818 Bacteria 991
204 Ga0373926_0159595 3300035083 Bacteria 860
205 Ga0373923_0015498 3300035111 Bacteria 2879
206 Ga0373945_0040076 3300035116 Bacteria 1690
207 Ga0373953_0006486 3300035117 Bacteria 3857
208 Ga0373954_0003435 3300035118 Bacteria 6717
209 Ga0373957_0058548 3300035120 Bacteria 1488
210 Ga0373943_0068692 3300035170 Bacteria 1789
211 Ga0373946_0000442 3300035171 Bacteria 13617
212 Ga0373955_0581188 3300035172 Bacteria 686
213 Ga0373924_0000432 3300035410 Bacteria 12866
214 Ga0373924_0178918 3300035410 Bacteria 933
215 Ga0373924_0504238 3300035410 Bacteria 544
216 Ga0373935_0000370 3300035692 Bacteria 23018
217 Ga0373927_0144012 3300035695 Bacteria 1559
218 Ga0373933_0004813 3300035724 Bacteria 7379
219 Ga0373947_0000476 3300035725 Bacteria 22980
220 Ga0373937_0000009 3300036401 Bacteria 169521
221 Ga0373937_1065374 3300036401 Unclassified 757
222 Ga0373925_0000194 3300037068 Bacteria 66124
223 Ga0395899_0008112 3300037312 Bacteria 8090
224 Ga0395899_0033005 3300037312 Bacteria 3890
225 Ga0395900_0006945 3300037418 Bacteria 11745
226 Ga0395900_0557879 3300037418 Bacteria 1089
227 Ga0395898_0064902 3300037466 Bacteria 3540
228 Ga0436364_0843035 3300037853 Bacteria 18049
229 Ga0395901_0000251 3300038443 Bacteria 66862
230 Ga0395901_0038242 3300038443 Bacteria 4963
231 Ga0436365_0478745 3300039437 Bacteria 2291
232 Ga0436365_1026669 3300039437 Bacteria 9110
233 Ga0436365_1251083 3300039437 Bacteria 570
234 Ga0436365_1829005 3300039437 Bacteria 1514
235 Ga0436365_1867931 3300039437 Bacteria 546
236 Ga0436360_0140042 3300039438 Bacteria 1053
237 Ga0436360_0527790 3300039438 Bacteria 1410
238 Ga0436360_0607391 3300039438 Bacteria 548
239 Ga0436363_0141151 3300039450 Bacteria 5192
240 Ga0436362_0315359 3300039453 Bacteria 2283
241 Ga0451853_0714571 3300041512 Bacteria 539
242 Ga0451853_1704332 3300041512 Bacteria 1046
243 Ga0439434_0153056 3300042435 Bacteria 764
244 Ga0451577_0021603 3300042876 Bacteria 5887
245 Ga0466960_0340051 3300044901 Bacteria 854
246 Ga0466959_0070095 3300045049 Bacteria 2540
247 Ga0451576_0000762 3300045051 Bacteria 63612
248 Ga0451576_1139597 3300045051 Bacteria 815
249 Ga0451576_2692579 3300045051 Bacteria 506
250 Ga0466967_0536267 3300045976 Bacteria 1151
251 Ga0495592_0000018 3300046454 Bacteria 140962
252 Ga0495629_0004511 3300046459 Bacteria 10415
253 Ga0495629_0056543 3300046459 Bacteria 2743
254 Ga0495651_0001122 3300046462 Bacteria 20711
255 Ga0495653_0000032 3300046463 Bacteria 132763
256 Ga0495664_0000010 3300046477 Bacteria 268381
257 Ga0495584_0562407 3300046491 Bacteria 581
258 Ga0495585_0135709 3300046492 Bacteria 1292
259 Ga0495606_0465494 3300046507 Bacteria 645
260 Ga0495608_0000008 3300046511 Bacteria 268629
261 Ga0495618_0000002 3300046514 Bacteria 271353
262 Ga0495628_0000009 3300046516 Bacteria 237611
263 Ga0495630_0001850 3300046517 Bacteria 14780
264 Ga0495652_0000011 3300046529 Bacteria 255329
265 Ga0495640_0000009 3300046533 Bacteria 217086
266 Ga0495586_0502728 3300046535 Bacteria 699
267 Ga0495587_0000006 3300046536 Bacteria 310070
268 Ga0495645_0000010 3300046543 Bacteria 238337
269 Ga0495667_0000005 3300046559 Bacteria 268252
270 Ga0495656_0758965 3300046615 Bacteria 523
271 Ga0495668_0783073 3300046616 Bacteria 528
272 Ga0495634_0000223 3300046642 Bacteria 53103
273 Ga0495635_0000008 3300046663 Bacteria 268349
274 Ga0495657_0000058 3300046675 Bacteria 97827
275 Ga0495657_0647341 3300046675 Bacteria 610
276 Ga0495599_0000007 3300046678 Bacteria 236638
277 Ga0495623_0005790 3300046679 Bacteria 8063
278 Ga0495646_0000021 3300046680 Bacteria 115358
279 Ga0495646_0278867 3300046680 Bacteria 889
280 Ga0495658_0073514 3300046683 Bacteria 1990
281 Ga0495658_0844520 3300046683 Bacteria 586
282 Ga0495613_0086621 3300046689 Bacteria 2271
283 Ga0495624_0007573 3300046690 Bacteria 7619
284 Ga0495600_0000001 3300046809 Bacteria 214870
285 Ga0495581_0005192 3300047315 Bacteria 7535
286 Ga0495581_0027682 3300047315 Bacteria 3288
287 Ga0495604_0000012 3300047317 Bacteria 268341
288 Ga0495674_0000011 3300047319 Bacteria 270911
289 Ga0495680_0001281 3300047322 Bacteria 27427
290 Ga0495675_0000096 3300047444 Bacteria 62617
291 Ga0495684_0000084 3300047471 Bacteria 65600
292 Ga0495593_0000727 3300047673 Bacteria 19074
293 Ga0495593_0252371 3300047673 Bacteria 883
294 Ga0495602_0000073 3300048088 Bacteria 98745
295 Ga0496100_0214970 3300048903 Bacteria 1408
296 Ga0496101_0046318 3300048904 Bacteria 3118
297 Ga0496101_0503211 3300048904 Bacteria 957
298 Ga0496102_0628458 3300048905 Bacteria 997
299 Ga0496103_0003681 3300048906 Bacteria 9320
300 Ga0496104_0017048 3300048907 Bacteria 6609
301 Ga0496104_0020368 3300048907 Bacteria 6080
302 Ga0496104_0473009 3300048907 Bacteria 1165
303 Ga0496104_0669135 3300048907 Bacteria 947
304 Ga0496105_0003854 3300048908 Bacteria 11205
305 Ga0496105_0010517 3300048908 Bacteria 7277
306 Ga0496105_0018631 3300048908 Bacteria 5587
307 Ga0496106_0036599 3300048909 Bacteria 3671
308 Ga0496106_0132818 3300048909 Bacteria 1953
309 Ga0496106_0209202 3300048909 Bacteria 1553
310 Ga0496107_0282851 3300048910 Bacteria 1234
311 Ga0496108_0101849 3300048911 Bacteria 2450
312 Ga0496108_0561590 3300048911 Bacteria 995
313 Ga0496109_0080144 3300048912 Bacteria 3008
314 Ga0496109_0225329 3300048912 Bacteria 1763
315 Ga0496109_0323750 3300048912 Bacteria 1455
316 Ga0496110_0023368 3300048913 Bacteria 5256
317 Ga0496111_0215132 3300048914 Bacteria 1427
318 Ga0496112_0112696 3300048915 Bacteria 2690
319 Ga0496112_0312575 3300048915 Bacteria 1516
320 Ga0496112_1098629 3300048915 Bacteria 713
321 Ga0496112_1372683 3300048915 Bacteria 621
322 Ga0496113_0090070 3300048916 Bacteria 2362
323 Ga0496113_0365840 3300048916 Bacteria 1157
324 Ga0496114_0124577 3300048917 Bacteria 2220
325 Ga0496114_0774431 3300048917 Bacteria 837
326 Ga0496115_0104809 3300048918 Bacteria 2321
327 Ga0496115_0749804 3300048918 Bacteria 763
328 Ga0496121_0109084 3300048924 Bacteria 2116
329 Ga0496126_0080062 3300048929 Bacteria 2891
330 Ga0501032_0881266 3300049569 Bacteria 564
331 Ga0501033_0919121 3300049570 Bacteria 587
332 Ga0501034_0138054 3300049571 Bacteria 2418
333 Ga0501034_0370719 3300049571 Bacteria 1358
334 Ga0501036_1159536 3300049572 Bacteria 630
335 Ga0501037_0801753 3300049573 Bacteria 622
336 Ga0501038_0667506 3300049574 Bacteria 781
337 Ga0501040_0137864 3300049576 Bacteria 1718
338 Ga0501042_0205597 3300049578 Bacteria 1420
339 Ga0501042_0420258 3300049578 Bacteria 969
340 Ga0501047_0093171 3300049581 Bacteria 2892
341 Ga0501047_0458876 3300049581 Bacteria 1103
342 Ga0501070_0102175 3300049586 Bacteria 2371
343 Ga0501072_0125644 3300049588 Bacteria 2044
344 Ga0501073_0195808 3300049589 Bacteria 1398
345 Ga0501074_0183412 3300049590 Bacteria 1493
346 Ga0501077_0091350 3300049593 Bacteria 1929
347 Ga0501079_0457505 3300049741 Bacteria 1002
348 Ga0501083_0531886 3300049744 Bacteria 765
349 Ga0501044_0055174 3300049823 Bacteria 4082
350 Ga0501044_0149016 3300049823 Bacteria 2323
351 Ga0501044_0174797 3300049823 Bacteria 2117
352 Ga0501044_0310650 3300049823 Bacteria 1503
353 nmdc:mga03683_129796_c1 3300050489 Bacteria 1126
354 nmdc:mga03683_36434_c1 3300050489 Bacteria 2001
355 nmdc:mga03n38_4528_c1 3300050490 Bacteria 4623
356 nmdc:mga0yw44_11104_c1 3300050492 Bacteria 4630
357 nmdc:mga0yw44_143047_c1 3300050492 Bacteria 1555
358 nmdc:mga06z11_118_c1 3300050494 Bacteria 32745
359 nmdc:mga04h51_218_c1 3300050495 Bacteria 15338
360 nmdc:mga04h51_31248_c1 3300050495 Bacteria 1681
361 nmdc:mga07m45_183392_c1 3300050496 Bacteria 1217
362 nmdc:mga05p37_316492_c1 3300050507 Bacteria 1848
363 nmdc:mga05p37_829600_c1 3300050507 Bacteria 1007
364 nmdc:mga0qj67_146147_c1 3300050509 Bacteria 1917
365 nmdc:mga0qj67_425431_c1 3300050509 Bacteria 1070
366 nmdc:mga06r32_112094_c1 3300050510 Bacteria 2684
367 nmdc:mga08y16_77844_c1 3300050511 Bacteria 3457
368 nmdc:mga0n895_99800_c1 3300050512 Bacteria 2912
369 nmdc:mga0rr50_626862_c1 3300050513 Bacteria 917
370 nmdc:mga0a205_1098958_c1 3300050515 Bacteria 642
371 nmdc:mga0a205_13177_c1 3300050515 Bacteria 6670
372 nmdc:mga0sz30_191_c1 3300050516 Bacteria 22683
373 Ga0495601_0000009 3300053077 Bacteria 270622
374 Ga0495601_0548583 3300053077 Bacteria 744
375 Ga0495612_0000019 3300053078 Bacteria 137844
376 Ga0495655_0040899 3300053083 Bacteria 1183
377 Ga0495595_0000015 3300053084 Bacteria 144946
378 Ga0495619_0000012 3300053085 Bacteria 268349
379 Ga0500572_000281 3300053111 Bacteria 18537
380 Ga0500595_000006 3300053119 Bacteria 300857
381 Ga0500559_0000609 3300053136 Bacteria 24325
382 Ga0500639_014892 3300053163 Bacteria 4090
383 Ga0500637_0617727 3300053178 Bacteria 510
384 Ga0500596_001399 3300053735 Bacteria 4878
385 Ga0501084_0309503 3300054114 Bacteria 1334
386 Ga0501084_0463892 3300054114 Bacteria 1071
387 Ga0501082_0718729 3300060353 Bacteria 874
388 Ga0530510_0251820 3300061734 Bacteria 1316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0458876 Ga0501047_0458876_201_587 115
2 3300049823 Ga0501044_0174797 Ga0501044_0174797_748_1101 116
3 3300035172 Ga0373955_0581188 Ga0373955_0581188_247_603 118
4 3300036401 Ga0373937_1065374 Ga0373937_1065374_380_736 118
5 3300042435 Ga0439434_0153056 Ga0439434_0153056_166_540 118
6 3300042876 Ga0451577_0021603 Ga0451577_0021603_361_726 119
7 3300045051 Ga0451576_0000762 Ga0451576_0000762_33724_34089 119
8 3300049571 Ga0501034_0138054 Ga0501034_0138054_385_744 119
9 3300049586 Ga0501070_0102175 Ga0501070_0102175_1908_2267 119
10 3300005536 Ga0070697_100744122 Ga0070697_1007441221 120
11 3300005549 Ga0070704_100126756 Ga0070704_1001267562 120
12 3300006871 Ga0075434_101281004 Ga0075434_1012810042 120
13 3300007076 Ga0075435_100042932 Ga0075435_1000429323 120
14 3300007788 Ga0099795_10124562 Ga0099795_101245622 120
15 3300014497 Ga0182008_10520006 Ga0182008_105200062 120
16 3300017792 Ga0163161_10357290 Ga0163161_103572902 120
17 3300026075 Ga0207708_10218253 Ga0207708_102182531 120
18 3300026118 Ga0207675_100382021 Ga0207675_1003820212 120
19 3300027907 Ga0207428_10060944 Ga0207428_100609442 120
20 3300031824 Ga0307413_10494066 Ga0307413_104940662 120
21 3300031995 Ga0307409_100256866 Ga0307409_1002568662 120
22 3300044901 Ga0466960_0340051 Ga0466960_0340051_299_661 120
23 3300046683 Ga0495658_0844520 Ga0495658_0844520_79_441 120
24 3300048929 Ga0496126_0080062 Ga0496126_0080062_1989_2351 120
25 3300005340 Ga0070689_101256361 Ga0070689_1012563611 121
26 3300005354 Ga0070675_101058815 Ga0070675_1010588152 121
27 3300005445 Ga0070708_100251130 Ga0070708_1002511302 121
28 3300005456 Ga0070678_101596883 Ga0070678_1015968832 121
29 3300005466 Ga0070685_11583188 Ga0070685_115831881 121
30 3300005841 Ga0068863_100845009 Ga0068863_1008450091 121
31 3300006038 Ga0075365_10398922 Ga0075365_103989222 121
32 3300006048 Ga0075363_100801700 Ga0075363_1008017001 121
33 3300006051 Ga0075364_10232866 Ga0075364_102328661 121
34 3300006353 Ga0075370_10851030 Ga0075370_108510301 121
35 3300013296 Ga0157374_12766516 Ga0157374_127665161 121
36 3300021361 Ga0213872_10051285 Ga0213872_100512852 121
37 3300025936 Ga0207670_11104352 Ga0207670_111043522 121
38 3300025938 Ga0207704_11340501 Ga0207704_113405011 121
39 3300031901 Ga0307406_10099424 Ga0307406_100994242 121
40 3300039438 Ga0436360_0527790 Ga0436360_0527790_444_809 121
41 3300050515 nmdc:mga0a205_1098958_c1 nmdc:mga0a205_1098958_c1_149_514 121
42 3300003203 JGI25406J46586_10069525 JGI25406J46586_100695252 122
43 3300003203 JGI25406J46586_10234899 JGI25406J46586_102348991 122
44 3300005985 Ga0081539_10002634 Ga0081539_100026344 122
45 3300006048 Ga0075363_100236505 Ga0075363_1002365052 122
46 3300006186 Ga0075369_10000095 Ga0075369_100000953 122
47 3300006353 Ga0075370_10212393 Ga0075370_102123932 122
48 3300011119 Ga0105246_11031996 Ga0105246_110319961 122
49 3300028379 Ga0268266_11003641 Ga0268266_110036412 122
50 3300050489 nmdc:mga03683_36434_c1 nmdc:mga03683_36434_c1_506_874 122
51 3300050496 nmdc:mga07m45_183392_c1 nmdc:mga07m45_183392_c1_190_558 122
52 3300050516 nmdc:mga0sz30_191_c1 nmdc:mga0sz30_191_c1_3202_3570 122
53 3300005438 Ga0070701_10587898 Ga0070701_105878981 123
54 3300005441 Ga0070700_100408193 Ga0070700_1004081932 123
55 3300005459 Ga0068867_100331489 Ga0068867_1003314892 123
56 3300005614 Ga0068856_100032045 Ga0068856_1000320453 123
57 3300005616 Ga0068852_102372353 Ga0068852_1023723531 123
58 3300005719 Ga0068861_100019565 Ga0068861_1000195652 123
59 3300005842 Ga0068858_100121282 Ga0068858_1001212822 123
60 3300005843 Ga0068860_100049999 Ga0068860_1000499992 123
61 3300005844 Ga0068862_100146898 Ga0068862_1001468982 123
62 3300006038 Ga0075365_10166858 Ga0075365_101668582 123
63 3300006042 Ga0075368_10001575 Ga0075368_100015753 123
64 3300006048 Ga0075363_100001337 Ga0075363_1000013379 123
65 3300006178 Ga0075367_10002161 Ga0075367_100021618 123
66 3300009094 Ga0111539_10759044 Ga0111539_107590442 123
67 3300009101 Ga0105247_10402940 Ga0105247_104029402 123
68 3300009176 Ga0105242_10466140 Ga0105242_104661401 123
69 3300009553 Ga0105249_11456059 Ga0105249_114560592 123
70 3300025932 Ga0207690_10696240 Ga0207690_106962402 123
71 3300025934 Ga0207686_11176747 Ga0207686_111767471 123
72 3300025972 Ga0207668_11266730 Ga0207668_112667302 123
73 3300026035 Ga0207703_10127399 Ga0207703_101273993 123
74 3300026075 Ga0207708_10354516 Ga0207708_103545162 123
75 3300026078 Ga0207702_10043097 Ga0207702_100430974 123
76 3300026118 Ga0207675_100017780 Ga0207675_1000177803 123
77 3300027866 Ga0209813_10077297 Ga0209813_100772972 123
78 3300028380 Ga0268265_10129233 Ga0268265_101292332 123
79 3300028381 Ga0268264_10037423 Ga0268264_100374232 123
80 3300039437 Ga0436365_0478745 Ga0436365_0478745_969_1340 123
81 3300039437 Ga0436365_1867931 Ga0436365_1867931_23_394 123
82 3300045051 Ga0451576_1139597 Ga0451576_1139597_310_732 123
83 3300050490 nmdc:mga03n38_4528_c1 nmdc:mga03n38_4528_c1_3891_4265 123
84 3300050492 nmdc:mga0yw44_143047_c1 nmdc:mga0yw44_143047_c1_1115_1489 123
85 3300050494 nmdc:mga06z11_118_c1 nmdc:mga06z11_118_c1_15164_15538 123
86 3300050495 nmdc:mga04h51_218_c1 nmdc:mga04h51_218_c1_5798_6172 123
87 3300054114 Ga0501084_0309503 Ga0501084_0309503_868_1242 123
88 3300005331 Ga0070670_100166994 Ga0070670_1001669942 124
89 3300005445 Ga0070708_100606769 Ga0070708_1006067691 124
90 3300005577 Ga0068857_100241298 Ga0068857_1002412983 124
91 3300005617 Ga0068859_100150199 Ga0068859_1001501994 124
92 3300005618 Ga0068864_100022753 Ga0068864_1000227532 124
93 3300005719 Ga0068861_100267490 Ga0068861_1002674902 124
94 3300005842 Ga0068858_100108729 Ga0068858_1001087293 124
95 3300006173 Ga0070716_100442844 Ga0070716_1004428442 124
96 3300006931 Ga0097620_100150198 Ga0097620_1001501982 124
97 3300009098 Ga0105245_12518747 Ga0105245_125187472 124
98 3300009101 Ga0105247_10083834 Ga0105247_100838342 124
99 3300009148 Ga0105243_10453745 Ga0105243_104537452 124
100 3300009177 Ga0105248_10135958 Ga0105248_101359582 124
101 3300009553 Ga0105249_11918973 Ga0105249_119189732 124
102 3300014325 Ga0163163_11708676 Ga0163163_117086762 124
103 3300025900 Ga0207710_10070618 Ga0207710_100706182 124
104 3300025908 Ga0207643_10023724 Ga0207643_100237243 124
105 3300025925 Ga0207650_10295042 Ga0207650_102950422 124
106 3300025935 Ga0207709_10834167 Ga0207709_108341672 124
107 3300025942 Ga0207689_10021327 Ga0207689_100213276 124
108 3300025945 Ga0207679_11429593 Ga0207679_114295932 124
109 3300026116 Ga0207674_10256140 Ga0207674_102561402 124
110 3300046616 Ga0495668_0783073 Ga0495668_0783073_103_477 124
111 3300048915 Ga0496112_0312575 Ga0496112_0312575_91_543 124
112 3300048924 Ga0496121_0109084 Ga0496121_0109084_784_1161 124
113 3300053083 Ga0495655_0040899 Ga0495655_0040899_242_616 124
114 3300049741 Ga0501079_0457505 Ga0501079_0457505_59_436 125
115 3300054114 Ga0501084_0463892 Ga0501084_0463892_523_900 125
116 3300060353 Ga0501082_0718729 Ga0501082_0718729_308_685 125
117 3300005937 Ga0081455_10757004 Ga0081455_107570042 126
118 3300005983 Ga0081540_1003549 Ga0081540_10035498 126
119 3300006028 Ga0070717_11009576 Ga0070717_110095762 126
120 3300014326 Ga0157380_10548549 Ga0157380_105485491 126
121 3300021441 Ga0213871_10057017 Ga0213871_100570172 126
122 3300025898 Ga0207692_10926431 Ga0207692_109264312 126
123 3300025905 Ga0207685_10236246 Ga0207685_102362462 126
124 3300025916 Ga0207663_10417083 Ga0207663_104170832 126
125 3300025929 Ga0207664_10636677 Ga0207664_106366772 126
126 3300031241 Ga0265325_10336104 Ga0265325_103361041 126
127 3300031242 Ga0265329_10088443 Ga0265329_100884432 126
128 3300031344 Ga0265316_10367488 Ga0265316_103674882 126
129 3300031711 Ga0265314_10403721 Ga0265314_104037212 126
130 3300034818 Ga0373950_0030875 Ga0373950_0030875_410_790 126
131 3300035083 Ga0373926_0159595 Ga0373926_0159595_146_526 126
132 3300035111 Ga0373923_0015498 Ga0373923_0015498_1126_1506 126
133 3300035116 Ga0373945_0040076 Ga0373945_0040076_948_1328 126
134 3300035117 Ga0373953_0006486 Ga0373953_0006486_1951_2331 126
135 3300035118 Ga0373954_0003435 Ga0373954_0003435_143_523 126
136 3300035120 Ga0373957_0058548 Ga0373957_0058548_894_1274 126
137 3300035170 Ga0373943_0068692 Ga0373943_0068692_808_1188 126
138 3300035171 Ga0373946_0000442 Ga0373946_0000442_6999_7379 126
139 3300035410 Ga0373924_0000432 Ga0373924_0000432_6584_6964 126
140 3300035692 Ga0373935_0000370 Ga0373935_0000370_12063_12443 126
141 3300035695 Ga0373927_0144012 Ga0373927_0144012_42_422 126
142 3300035724 Ga0373933_0004813 Ga0373933_0004813_2559_2939 126
143 3300035725 Ga0373947_0000476 Ga0373947_0000476_8086_8466 126
144 3300036401 Ga0373937_0000009 Ga0373937_0000009_91238_91618 126
145 3300037068 Ga0373925_0000194 Ga0373925_0000194_20580_20960 126
146 3300046454 Ga0495592_0000018 Ga0495592_0000018_28329_28709 126
147 3300046459 Ga0495629_0004511 Ga0495629_0004511_367_747 126
148 3300046462 Ga0495651_0001122 Ga0495651_0001122_16213_16593 126
149 3300046463 Ga0495653_0000032 Ga0495653_0000032_60439_60819 126
150 3300046477 Ga0495664_0000010 Ga0495664_0000010_176893_177273 126
151 3300046511 Ga0495608_0000008 Ga0495608_0000008_91376_91756 126
152 3300046514 Ga0495618_0000002 Ga0495618_0000002_179166_179546 126
153 3300046516 Ga0495628_0000009 Ga0495628_0000009_176921_177301 126
154 3300046517 Ga0495630_0001850 Ga0495630_0001850_6327_6707 126
155 3300046529 Ga0495652_0000011 Ga0495652_0000011_91066_91446 126
156 3300046533 Ga0495640_0000009 Ga0495640_0000009_39818_40198 126
157 3300046535 Ga0495586_0502728 Ga0495586_0502728_248_628 126
158 3300046536 Ga0495587_0000006 Ga0495587_0000006_290639_291019 126
159 3300046543 Ga0495645_0000010 Ga0495645_0000010_60439_60819 126
160 3300046559 Ga0495667_0000005 Ga0495667_0000005_176921_177301 126
161 3300046642 Ga0495634_0000223 Ga0495634_0000223_46708_47088 126
162 3300046663 Ga0495635_0000008 Ga0495635_0000008_91049_91429 126
163 3300046675 Ga0495657_0000058 Ga0495657_0000058_45802_46182 126
164 3300046678 Ga0495599_0000007 Ga0495599_0000007_91066_91446 126
165 3300046679 Ga0495623_0005790 Ga0495623_0005790_6062_6442 126
166 3300046680 Ga0495646_0000021 Ga0495646_0000021_91021_91401 126
167 3300046683 Ga0495658_0073514 Ga0495658_0073514_1145_1525 126
168 3300046689 Ga0495613_0086621 Ga0495613_0086621_977_1357 126
169 3300046690 Ga0495624_0007573 Ga0495624_0007573_202_582 126
170 3300046809 Ga0495600_0000001 Ga0495600_0000001_91066_91446 126
171 3300047315 Ga0495581_0005192 Ga0495581_0005192_678_1058 126
172 3300047317 Ga0495604_0000012 Ga0495604_0000012_176908_177288 126
173 3300047319 Ga0495674_0000011 Ga0495674_0000011_179194_179574 126
174 3300047322 Ga0495680_0001281 Ga0495680_0001281_7936_8316 126
175 3300047444 Ga0495675_0000096 Ga0495675_0000096_23378_23758 126
176 3300047471 Ga0495684_0000084 Ga0495684_0000084_4782_5162 126
177 3300047673 Ga0495593_0000727 Ga0495593_0000727_4071_4451 126
178 3300048088 Ga0495602_0000073 Ga0495602_0000073_91049_91429 126
179 3300049571 Ga0501034_0370719 Ga0501034_0370719_601_981 126
180 3300049572 Ga0501036_1159536 Ga0501036_1159536_47_427 126
181 3300049574 Ga0501038_0667506 Ga0501038_0667506_293_673 126
182 3300049581 Ga0501047_0093171 Ga0501047_0093171_696_1076 126
183 3300049589 Ga0501073_0195808 Ga0501073_0195808_488_868 126
184 3300049823 Ga0501044_0055174 Ga0501044_0055174_1606_1986 126
185 3300053077 Ga0495601_0000009 Ga0495601_0000009_91049_91429 126
186 3300053078 Ga0495612_0000019 Ga0495612_0000019_46399_46779 126
187 3300053084 Ga0495595_0000015 Ga0495595_0000015_72304_72684 126
188 3300053085 Ga0495619_0000012 Ga0495619_0000012_91049_91429 126
189 3300053119 Ga0500595_000006 Ga0500595_000006_144925_145305 126
190 3300053178 Ga0500637_0617727 Ga0500637_0617727_93_473 126
191 3300005545 Ga0070695_101818130 Ga0070695_1018181301 127
192 3300006852 Ga0075433_10061418 Ga0075433_100614183 127
193 3300006871 Ga0075434_100095903 Ga0075434_1000959034 127
194 3300007076 Ga0075435_100647650 Ga0075435_1006476502 127
195 3300009094 Ga0111539_10012470 Ga0111539_100124708 127
196 3300027866 Ga0209813_10046942 Ga0209813_100469422 127
197 3300028577 Ga0265318_10140763 Ga0265318_101407632 127
198 3300035410 Ga0373924_0178918 Ga0373924_0178918_515_898 127
199 3300039438 Ga0436360_0140042 Ga0436360_0140042_468_851 127
200 3300045051 Ga0451576_2692579 Ga0451576_2692579_16_405 127
201 3300046459 Ga0495629_0056543 Ga0495629_0056543_82_465 127
202 3300046675 Ga0495657_0647341 Ga0495657_0647341_88_471 127
203 3300046680 Ga0495646_0278867 Ga0495646_0278867_45_428 127
204 3300047315 Ga0495581_0027682 Ga0495581_0027682_156_539 127
205 3300047673 Ga0495593_0252371 Ga0495593_0252371_138_521 127
206 3300049744 Ga0501083_0531886 Ga0501083_0531886_63_446 127
207 3300050495 nmdc:mga04h51_31248_c1 nmdc:mga04h51_31248_c1_145_528 127
208 3300050509 nmdc:mga0qj67_425431_c1 nmdc:mga0qj67_425431_c1_244_627 127
209 3300050511 nmdc:mga08y16_77844_c1 nmdc:mga08y16_77844_c1_1924_2307 127
210 3300050512 nmdc:mga0n895_99800_c1 nmdc:mga0n895_99800_c1_1692_2075 127
211 3300050513 nmdc:mga0rr50_626862_c1 nmdc:mga0rr50_626862_c1_164_547 127
212 3300050515 nmdc:mga0a205_13177_c1 nmdc:mga0a205_13177_c1_2730_3113 127
213 3300005937 Ga0081455_10919638 Ga0081455_109196381 128
214 3300005985 Ga0081539_10023930 Ga0081539_100239302 128
215 3300021388 Ga0213875_10025835 Ga0213875_100258352 128
216 3300025941 Ga0207711_10970285 Ga0207711_109702851 128
217 3300037312 Ga0395899_0033005 Ga0395899_0033005_1243_1632 128
218 3300037418 Ga0395900_0006945 Ga0395900_0006945_3405_3794 128
219 3300037466 Ga0395898_0064902 Ga0395898_0064902_1736_2125 128
220 3300037853 Ga0436364_0843035 Ga0436364_0843035_8223_8609 128
221 3300038443 Ga0395901_0038242 Ga0395901_0038242_3159_3548 128
222 3300039437 Ga0436365_1026669 Ga0436365_1026669_5151_5537 128
223 3300039450 Ga0436363_0141151 Ga0436363_0141151_680_1066 128
224 3300041512 Ga0451853_1704332 Ga0451853_1704332_31_417 128
225 3300045049 Ga0466959_0070095 Ga0466959_0070095_1127_1513 128
226 3300046491 Ga0495584_0562407 Ga0495584_0562407_106_492 128
227 3300046492 Ga0495585_0135709 Ga0495585_0135709_567_953 128
228 3300046507 Ga0495606_0465494 Ga0495606_0465494_50_436 128
229 3300046615 Ga0495656_0758965 Ga0495656_0758965_10_396 128
230 3300048907 Ga0496104_0020368 Ga0496104_0020368_1445_1834 128
231 3300048908 Ga0496105_0018631 Ga0496105_0018631_430_819 128
232 3300048909 Ga0496106_0036599 Ga0496106_0036599_939_1328 128
233 3300048912 Ga0496109_0323750 Ga0496109_0323750_457_843 128
234 3300048916 Ga0496113_0365840 Ga0496113_0365840_92_481 128
235 3300048917 Ga0496114_0124577 Ga0496114_0124577_1153_1542 128
236 3300049569 Ga0501032_0881266 Ga0501032_0881266_87_473 128
237 3300049570 Ga0501033_0919121 Ga0501033_0919121_158_544 128
238 3300049573 Ga0501037_0801753 Ga0501037_0801753_50_436 128
239 3300049576 Ga0501040_0137864 Ga0501040_0137864_946_1332 128
240 3300049578 Ga0501042_0205597 Ga0501042_0205597_461_850 128
241 3300049588 Ga0501072_0125644 Ga0501072_0125644_218_604 128
242 3300049590 Ga0501074_0183412 Ga0501074_0183412_283_669 128
243 3300049823 Ga0501044_0149016 Ga0501044_0149016_1678_2064 128
244 3300049823 Ga0501044_0310650 Ga0501044_0310650_755_1141 128
245 3300053111 Ga0500572_000281 Ga0500572_000281_6315_6701 128
246 3300053136 Ga0500559_0000609 Ga0500559_0000609_1794_2180 128
247 3300053163 Ga0500639_014892 Ga0500639_014892_1467_1853 128
248 3300053735 Ga0500596_001399 Ga0500596_001399_3515_3901 128
249 3300005617 Ga0068859_101258029 Ga0068859_1012580292 129
250 3300005842 Ga0068858_100240133 Ga0068858_1002401332 129
251 3300005842 Ga0068858_100423201 Ga0068858_1004232012 129
252 3300006844 Ga0075428_100351934 Ga0075428_1003519342 129
253 3300006931 Ga0097620_101257712 Ga0097620_1012577121 129
254 3300009036 Ga0105244_10463582 Ga0105244_104635821 129
255 3300009101 Ga0105247_10212270 Ga0105247_102122702 129
256 3300009545 Ga0105237_10472429 Ga0105237_104724291 129
257 3300009551 Ga0105238_10109194 Ga0105238_101091943 129
258 3300025900 Ga0207710_10081177 Ga0207710_100811772 129
259 3300025912 Ga0207707_10453335 Ga0207707_104533352 129
260 3300025924 Ga0207694_10122005 Ga0207694_101220053 129
261 3300026035 Ga0207703_10182098 Ga0207703_101820981 129
262 3300028556 Ga0265337_1013681 Ga0265337_10136814 129
263 3300028563 Ga0265319_1019908 Ga0265319_10199082 129
264 3300028573 Ga0265334_10002202 Ga0265334_100022028 129
265 3300028577 Ga0265318_10027059 Ga0265318_100270592 129
266 3300028653 Ga0265323_10002846 Ga0265323_100028465 129
267 3300028654 Ga0265322_10041781 Ga0265322_100417812 129
268 3300028666 Ga0265336_10000277 Ga0265336_1000027719 129
269 3300028800 Ga0265338_10002073 Ga0265338_1000207310 129
270 3300029957 Ga0265324_10007119 Ga0265324_100071194 129
271 3300039437 Ga0436365_1829005 Ga0436365_1829005_416_805 129
272 3300039438 Ga0436360_0607391 Ga0436360_0607391_15_404 129
273 3300048903 Ga0496100_0214970 Ga0496100_0214970_100_489 129
274 3300048904 Ga0496101_0503211 Ga0496101_0503211_42_431 129
275 3300048905 Ga0496102_0628458 Ga0496102_0628458_504_893 129
276 3300048907 Ga0496104_0017048 Ga0496104_0017048_4903_5292 129
277 3300048908 Ga0496105_0003854 Ga0496105_0003854_10477_10866 129
278 3300048909 Ga0496106_0132818 Ga0496106_0132818_968_1357 129
279 3300048911 Ga0496108_0101849 Ga0496108_0101849_39_428 129
280 3300048911 Ga0496108_0561590 Ga0496108_0561590_496_885 129
281 3300048912 Ga0496109_0080144 Ga0496109_0080144_1023_1412 129
282 3300048918 Ga0496115_0104809 Ga0496115_0104809_1497_1886 129
283 3300049578 Ga0501042_0420258 Ga0501042_0420258_58_447 129
284 3300049593 Ga0501077_0091350 Ga0501077_0091350_236_625 129
285 3300061734 Ga0530510_0251820 Ga0530510_0251820_822_1226 130
286 3300037312 Ga0395899_0008112 Ga0395899_0008112_1578_1973 131
287 3300037418 Ga0395900_0557879 Ga0395900_0557879_207_602 131
288 3300038443 Ga0395901_0000251 Ga0395901_0000251_28679_29074 131
289 3300006173 Ga0070716_101513888 Ga0070716_1015138881 132
290 3300006175 Ga0070712_100111343 Ga0070712_1001113432 132
291 3300010159 Ga0099796_10040021 Ga0099796_100400213 132
292 3300025898 Ga0207692_10252297 Ga0207692_102522972 132
293 3300025906 Ga0207699_10295487 Ga0207699_102954872 132
294 3300025915 Ga0207693_10045184 Ga0207693_100451842 132
295 3300025916 Ga0207663_10272757 Ga0207663_102727572 132
296 3300025928 Ga0207700_10712064 Ga0207700_107120642 132
297 3300025929 Ga0207664_10102086 Ga0207664_101020862 132
298 3300025939 Ga0207665_10271924 Ga0207665_102719242 132
299 3300026078 Ga0207702_10012944 Ga0207702_100129442 132
300 3300021358 Ga0213873_10025237 Ga0213873_100252371 133
301 3300039437 Ga0436365_1251083 Ga0436365_1251083_158_559 133
302 3300039453 Ga0436362_0315359 Ga0436362_0315359_17_418 133
303 3300045976 Ga0466967_0536267 Ga0466967_0536267_526_927 133
304 3300050507 nmdc:mga05p37_316492_c1 nmdc:mga05p37_316492_c1_1352_1765 137
305 3300006844 Ga0075428_100488563 Ga0075428_1004885632 142
306 3300006847 Ga0075431_100197133 Ga0075431_1001971333 142
307 3300009147 Ga0114129_11236363 Ga0114129_112363632 142
308 3300050489 nmdc:mga03683_129796_c1 nmdc:mga03683_129796_c1_67_504 142
309 3300050492 nmdc:mga0yw44_11104_c1 nmdc:mga0yw44_11104_c1_1533_1970 142
310 3300050507 nmdc:mga05p37_829600_c1 nmdc:mga05p37_829600_c1_411_848 142
311 3300050509 nmdc:mga0qj67_146147_c1 nmdc:mga0qj67_146147_c1_56_493 142
312 3300050510 nmdc:mga06r32_112094_c1 nmdc:mga06r32_112094_c1_1674_2111 142
313 3300009094 Ga0111539_10628946 Ga0111539_106289462 144
314 3300001977 JGI24746J21847_1021990 JGI24746J21847_10219902 145
315 3300005330 Ga0070690_100333403 Ga0070690_1003334032 145
316 3300005331 Ga0070670_100340878 Ga0070670_1003408782 145
317 3300005333 Ga0070677_10316615 Ga0070677_103166152 145
318 3300005335 Ga0070666_10921272 Ga0070666_109212721 145
319 3300005338 Ga0068868_100006791 Ga0068868_1000067919 145
320 3300005340 Ga0070689_100043691 Ga0070689_1000436913 145
321 3300005343 Ga0070687_100165137 Ga0070687_1001651372 145
322 3300005344 Ga0070661_100448194 Ga0070661_1004481942 145
323 3300005354 Ga0070675_100518210 Ga0070675_1005182102 145
324 3300005355 Ga0070671_100201276 Ga0070671_1002012762 145
325 3300005356 Ga0070674_100128711 Ga0070674_1001287112 145
326 3300005437 Ga0070710_10164326 Ga0070710_101643262 145
327 3300005438 Ga0070701_10052879 Ga0070701_100528792 145
328 3300005439 Ga0070711_100235290 Ga0070711_1002352902 145
329 3300005457 Ga0070662_100364934 Ga0070662_1003649342 145
330 3300005614 Ga0068856_100237582 Ga0068856_1002375821 145
331 3300005615 Ga0070702_100306615 Ga0070702_1003066152 145
332 3300005616 Ga0068852_100522414 Ga0068852_1005224142 145
333 3300005719 Ga0068861_100261596 Ga0068861_1002615963 145
334 3300005840 Ga0068870_10211985 Ga0068870_102119852 145
335 3300005843 Ga0068860_100411966 Ga0068860_1004119662 145
336 3300005844 Ga0068862_100241813 Ga0068862_1002418133 145
337 3300006353 Ga0075370_10285882 Ga0075370_102858821 145
338 3300006358 Ga0068871_101186455 Ga0068871_1011864552 145
339 3300009101 Ga0105247_10202567 Ga0105247_102025672 145
340 3300009148 Ga0105243_10903538 Ga0105243_109035382 145
341 3300010375 Ga0105239_10057561 Ga0105239_100575615 145
342 3300013308 Ga0157375_10487309 Ga0157375_104873093 145
343 3300014325 Ga0163163_10268838 Ga0163163_102688382 145
344 3300014745 Ga0157377_10173232 Ga0157377_101732322 145
345 3300014968 Ga0157379_10217389 Ga0157379_102173892 145
346 3300014969 Ga0157376_10427847 Ga0157376_104278472 145
347 3300025898 Ga0207692_10180729 Ga0207692_101807292 145
348 3300025900 Ga0207710_10127586 Ga0207710_101275862 145
349 3300025901 Ga0207688_10227460 Ga0207688_102274602 145
350 3300025904 Ga0207647_10070013 Ga0207647_100700134 145
351 3300025908 Ga0207643_10032478 Ga0207643_100324784 145
352 3300025916 Ga0207663_10111111 Ga0207663_101111112 145
353 3300025918 Ga0207662_10004684 Ga0207662_100046846 145
354 3300025920 Ga0207649_11447631 Ga0207649_114476311 145
355 3300025925 Ga0207650_10080800 Ga0207650_100808002 145
356 3300025926 Ga0207659_10209546 Ga0207659_102095463 145
357 3300025938 Ga0207704_10408389 Ga0207704_104083892 145
358 3300025940 Ga0207691_10000903 Ga0207691_1000090322 145
359 3300025941 Ga0207711_10674212 Ga0207711_106742122 145
360 3300025945 Ga0207679_10766352 Ga0207679_107663522 145
361 3300026035 Ga0207703_10244582 Ga0207703_102445821 145
362 3300026041 Ga0207639_10201824 Ga0207639_102018242 145
363 3300026067 Ga0207678_10139983 Ga0207678_101399832 145
364 3300026075 Ga0207708_10020606 Ga0207708_100206065 145
365 3300026078 Ga0207702_10716885 Ga0207702_107168852 145
366 3300026095 Ga0207676_10259406 Ga0207676_102594063 145
367 3300026121 Ga0207683_10021888 Ga0207683_100218882 145
368 3300028379 Ga0268266_10651126 Ga0268266_106511261 145
369 3300028380 Ga0268265_10903786 Ga0268265_109037862 145
370 3300035410 Ga0373924_0504238 Ga0373924_0504238_70_507 145
371 3300041512 Ga0451853_0714571 Ga0451853_0714571_77_514 145
372 3300048904 Ga0496101_0046318 Ga0496101_0046318_1710_2147 145
373 3300048906 Ga0496103_0003681 Ga0496103_0003681_1694_2131 145
374 3300048907 Ga0496104_0473009 Ga0496104_0473009_586_1023 145
375 3300048907 Ga0496104_0669135 Ga0496104_0669135_242_679 145
376 3300048908 Ga0496105_0010517 Ga0496105_0010517_5644_6081 145
377 3300048909 Ga0496106_0209202 Ga0496106_0209202_461_898 145
378 3300048910 Ga0496107_0282851 Ga0496107_0282851_643_1080 145
379 3300048912 Ga0496109_0225329 Ga0496109_0225329_61_498 145
380 3300048913 Ga0496110_0023368 Ga0496110_0023368_4803_5240 145
381 3300048914 Ga0496111_0215132 Ga0496111_0215132_882_1319 145
382 3300048915 Ga0496112_0112696 Ga0496112_0112696_1265_1702 145
383 3300048915 Ga0496112_1098629 Ga0496112_1098629_229_666 145
384 3300048915 Ga0496112_1372683 Ga0496112_1372683_132_569 145
385 3300048916 Ga0496113_0090070 Ga0496113_0090070_1604_2041 145
386 3300048917 Ga0496114_0774431 Ga0496114_0774431_60_497 145
387 3300048918 Ga0496115_0749804 Ga0496115_0749804_152_589 145
388 3300053077 Ga0495601_0548583 Ga0495601_0548583_120_557 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

10

117

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ire-assembly1.cif.gz_B crystal structure of co-type nitrile hydratase from pseudonocardia thermophila 0.6769 34 142
4fm4-assembly7.cif.gz_N wild type fe-type nitrile hydratase from comamonas testosteroni ni1 0.633 34 139
4zgd-assembly1.cif.gz_B mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.6322 34 139
1v29-assembly1.cif.gz_B-2 crystal structure of nitrile hydratase from a thermophile bacillus smithii 0.6311 36 143
7w8m-assembly1.cif.gz_B-2 crystal structure of co-type nitrile hydratase mutant from pseudomonas thermophila - a129r 0.6224 34 142
ID Description Score Start End Superfamily
1ireB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.6769 34 142 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.6326 34 139 1.10.472.20
af_P36001_2_277_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.6287 65 112 3.40.1190.10
3qxeB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.6179 34 141 1.10.472.20
2dd4H00 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5641 25 139 1.10.472.20
ID Description Score Start End GO Terms
AF-A0A536J6X5-F1-model_v4 Nitrile hydratase accessory protein 0.9542 58 139
AF-A0A5A7YB97-F1-model_v4 Nitrile hydratase accessory protein 0.9425 56 139
AF-A0A5A7YB97-F1-model_v4 Nitrile hydratase accessory protein 0.9217 56 139
AF-A0A160V843-F1-model_v4 Putative metal chaperone, involved in Fe-nitrile hydratase activation, GTPase of COG0523 family 0.9192 56 140
AF-A0A1Y5RWQ0-F1-model_v4 Nitrile hydratase beta subunit 0.919 56 139

Feature Viewer

pLDDT pTM Quality
80.25 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map