F431125

General Info

Members Datasets Scaffolds Average Seq Length
388 289 776 292

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10084731|Ga0157372_100847312
Length 344
Sequence LDTFAHVTDSHQLREQPREGVDQLRPVSGPAWGLGLATFAGLDGESGVLDTWYPSPALGEPTGDGGGAPADLTALEGVDEARGVRLAVVRTRIPDLQAPPADAHDAWLRLHLLSSRLVRPRTINLDGIFGRLTNVVWTSAGPCAVDGFEHTRLRLRAAGRTVHVFGVDKFPRMTDYVLPSGVRIADADRVRLGAHLAEGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGKQVISVGRRCLVGANAGIGISLGDDGVVEAGCYVTAGTKVTVHQPGGEPRVVKAMELSGADNVLFRRNSVSGVVEATPWKGAGTALNADLHANE

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
223 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
224 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
225 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
226 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
227 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
228 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
229 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
230 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
231 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
232 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
233 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
234 2643221561 Nocardioides sp. Root151 Isolate Unclassified
235 2643221569 Achromobacter sp. Root565 Isolate Unclassified
236 2643221576 Nocardioides sp. Root614 Isolate Unclassified
237 2643221590 Nocardioides sp. Root682 Isolate Unclassified
238 2643221594 Achromobacter sp. Root170 Isolate Unclassified
239 2643221621 Achromobacter sp. Root83 Isolate Unclassified
240 2643221696 Nocardioides sp. Root140 Isolate Unclassified
241 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
242 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
243 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
244 2739367898 Nocardioides sp. CF479 Isolate Unclassified
245 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
246 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
247 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
248 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
249 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
250 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
251 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
252 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
253 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
254 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
255 2858950400 Achromobacter sp. K91 Isolate Unclassified
256 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
257 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
258 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
259 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
260 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
261 2904699407
262 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
263 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
264 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
265 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
266 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
267 2922425934
268 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
269 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
270 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
271 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
272 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
273 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
274 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
275 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
276 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
277 2941479691
278 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
279 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
280 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
281 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
282 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
283 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
284 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
285 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
286 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
287 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
288 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
289 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.64
Metatranscriptomes 0.26
Isolates 17.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.19
Nodule 8.76
Rhizoplane 9.28
Rhizosphere 60.31
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10084731 3300013307 Bacteria 3593
2 JGI25165J46597_1005646 3300003214 Bacteria 2367
3 JGI25160J50197_1000843 3300003354 Bacteria 16282
4 JGI25404J52841_10018556 3300003659 Bacteria 1508
5 Ga0065165_1000659 3300005262 Bacteria 49829
6 Ga0070658_10486905 3300005327 Bacteria 1065
7 Ga0068869_100129179 3300005334 Bacteria 1941
8 Ga0070682_100034783 3300005337 Unclassified 3071
9 Ga0070682_100044838 3300005337 Bacteria 2739
10 Ga0070682_100158145 3300005337 Bacteria 1562
11 Ga0070682_100208712 3300005337 Bacteria 1383
12 Ga0068868_100065974 3300005338 Unclassified 2877
13 Ga0070661_100224757 3300005344 Bacteria 1441
14 Ga0070668_100010677 3300005347 Bacteria 6828
15 Ga0070668_100039390 3300005347 Bacteria 3614
16 Ga0070710_10150582 3300005437 Bacteria 1434
17 Ga0070711_100084785 3300005439 Bacteria 2267
18 Ga0070705_100078842 3300005440 Bacteria 2016
19 Ga0070663_100021387 3300005455 Bacteria 4303
20 Ga0070663_100049799 3300005455 Unclassified 2977
21 Ga0070678_100025485 3300005456 Bacteria 3979
22 Ga0070678_100133990 3300005456 Unclassified 1973
23 Ga0070662_100045081 3300005457 Bacteria 3162
24 Ga0070685_10031729 3300005466 Bacteria 2954
25 Ga0068853_100129208 3300005539 Bacteria 2260
26 Ga0070672_100137099 3300005543 Bacteria 2016
27 Ga0070693_100054428 3300005547 Bacteria 2301
28 Ga0070693_100179937 3300005547 Bacteria 1361
29 Ga0070665_100188080 3300005548 Bacteria 2066
30 Ga0070704_100015882 3300005549 Bacteria 4742
31 Ga0068855_100040738 3300005563 Bacteria 5511
32 Ga0070664_100286915 3300005564 Unclassified 1485
33 Ga0068857_100126776 3300005577 Bacteria 2300
34 Ga0068857_100522901 3300005577 Bacteria 1115
35 Ga0068859_100152195 3300005617 Bacteria 2389
36 Ga0068859_100169796 3300005617 Bacteria 2262
37 Ga0068859_100171325 3300005617 Bacteria 2252
38 Ga0068864_100079199 3300005618 Bacteria 2876
39 Ga0068863_100064753 3300005841 Bacteria 3457
40 Ga0068858_100036707 3300005842 Bacteria 4544
41 Ga0081455_10029960 3300005937 Bacteria 4954
42 Ga0081455_10053407 3300005937 Bacteria 3451
43 Ga0081455_10054623 3300005937 Bacteria 3403
44 Ga0081455_10196749 3300005937 Bacteria 1513
45 Ga0081540_1001934 3300005983 Bacteria 17349
46 Ga0081540_1003681 3300005983 Bacteria 12022
47 Ga0081540_1021954 3300005983 Bacteria 3781
48 Ga0070717_10084725 3300006028 Bacteria 2666
49 Ga0075365_10003909 3300006038 Bacteria 7802
50 Ga0075365_10013900 3300006038 Bacteria 4829
51 Ga0075363_100022102 3300006048 Unclassified 3213
52 Ga0075364_10018271 3300006051 Bacteria 4388
53 Ga0070712_100147439 3300006175 Bacteria 1802
54 Ga0075369_10020455 3300006186 Bacteria 2710
55 Ga0097620_100152194 3300006931 Bacteria 2389
56 Ga0097620_100169796 3300006931 Bacteria 2262
57 Ga0097620_100171315 3300006931 Bacteria 2252
58 Ga0099795_10079280 3300007788 Bacteria 1253
59 Ga0105240_10279629 3300009093 Bacteria 1918
60 Ga0111539_10241794 3300009094 Bacteria 2102
61 Ga0105245_10016326 3300009098 Bacteria 6474
62 Ga0105245_10061578 3300009098 Bacteria 3383
63 Ga0105245_10194835 3300009098 Bacteria 1943
64 Ga0105245_10530253 3300009098 Bacteria 1197
65 Ga0105247_10120639 3300009101 Bacteria 1698
66 Ga0114129_10002400 3300009147 Bacteria 26030
67 Ga0105243_10057793 3300009148 Bacteria 3090
68 Ga0105241_10033759 3300009174 Bacteria 3842
69 Ga0105241_10108842 3300009174 Bacteria 2216
70 Ga0105242_10122824 3300009176 Bacteria 2231
71 Ga0105242_10142804 3300009176 Bacteria 2079
72 Ga0105248_10025166 3300009177 Bacteria 6616
73 Ga0105237_10002274 3300009545 Bacteria 23895
74 Ga0105237_10303041 3300009545 Bacteria 1601
75 Ga0105238_10130577 3300009551 Bacteria 2490
76 Ga0105238_10205369 3300009551 Unclassified 1946
77 Ga0105238_10281937 3300009551 Bacteria 1643
78 Ga0105249_10004668 3300009553 Bacteria 11830
79 Ga0105249_10273048 3300009553 Bacteria 1685
80 Ga0099796_10043585 3300010159 Bacteria 1529
81 Ga0105239_10059523 3300010375 Bacteria 4192
82 Ga0105246_10015285 3300011119 Bacteria 4845
83 Ga0157373_10045829 3300013100 Bacteria 3121
84 Ga0157371_10137452 3300013102 Bacteria 1740
85 Ga0157369_10173283 3300013105 Bacteria 2272
86 Ga0157374_10034825 3300013296 Bacteria 4603
87 Ga0157378_10002138 3300013297 Bacteria 17552
88 Ga0163162_10174698 3300013306 Bacteria 2273
89 Ga0157372_10145972 3300013307 Bacteria 2728
90 Ga0157372_10178070 3300013307 Bacteria 2461
91 Ga0157372_10298439 3300013307 Bacteria 1874
92 Ga0157375_10143321 3300013308 Bacteria 2518
93 Ga0163163_10183713 3300014325 Bacteria 2138
94 Ga0157380_10037715 3300014326 Bacteria 3746
95 Ga0157377_10083434 3300014745 Bacteria 1872
96 Ga0157376_10015279 3300014969 Bacteria 5795
97 Ga0206354_11198610 3300020081 Bacteria 1266
98 Ga0213876_10007115 3300021384 Bacteria 6099
99 Ga0209677_101272 3300025253 Bacteria 11319
100 Ga0209233_1003593 3300025261 Bacteria 5437
101 Ga0209676_1005951 3300025292 Bacteria 6172
102 Ga0209050_1004128 3300025298 Bacteria 10088
103 Ga0207426_1000120 3300025302 Bacteria 219117
104 Ga0207426_1002210 3300025302 Bacteria 13068
105 Ga0209051_1042154 3300025303 Bacteria 1615
106 Ga0207642_10020537 3300025899 Bacteria 2581
107 Ga0207688_10013912 3300025901 Bacteria 4374
108 Ga0207647_10044745 3300025904 Bacteria 2764
109 Ga0207654_10006100 3300025911 Bacteria 6059
110 Ga0207654_10024341 3300025911 Bacteria 3254
111 Ga0207654_10078475 3300025911 Bacteria 1981
112 Ga0207707_10222280 3300025912 Bacteria 1644
113 Ga0207695_10000008 3300025913 Bacteria 1058268
114 Ga0207671_10001041 3300025914 Bacteria 33720
115 Ga0207671_10130390 3300025914 Bacteria 1929
116 Ga0207671_10176129 3300025914 Bacteria 1663
117 Ga0207693_10009301 3300025915 Bacteria 8019
118 Ga0207663_10057839 3300025916 Bacteria 2444
119 Ga0207662_10027894 3300025918 Bacteria 3261
120 Ga0207657_10010073 3300025919 Bacteria 9451
121 Ga0207657_10233510 3300025919 Bacteria 1470
122 Ga0207694_10273462 3300025924 Bacteria 1386
123 Ga0207687_10006324 3300025927 Bacteria 7828
124 Ga0207687_10014216 3300025927 Bacteria 5207
125 Ga0207687_10150482 3300025927 Bacteria 1775
126 Ga0207706_10004364 3300025933 Bacteria 13293
127 Ga0207706_10050533 3300025933 Bacteria 3674
128 Ga0207686_10043260 3300025934 Bacteria 2759
129 Ga0207709_10006466 3300025935 Bacteria 6579
130 Ga0207670_10215465 3300025936 Bacteria 1467
131 Ga0207669_10285629 3300025937 Bacteria 1247
132 Ga0207704_10009310 3300025938 Bacteria 4731
133 Ga0207665_10041876 3300025939 Bacteria 3060
134 Ga0207711_10020028 3300025941 Bacteria 5575
135 Ga0207689_10010553 3300025942 Bacteria 7954
136 Ga0207689_10127827 3300025942 Bacteria 2090
137 Ga0207679_10171574 3300025945 Bacteria 1786
138 Ga0207679_10364839 3300025945 Bacteria 1262
139 Ga0207667_10392397 3300025949 Bacteria 1413
140 Ga0207651_10217004 3300025960 Bacteria 1544
141 Ga0207712_10247610 3300025961 Bacteria 1439
142 Ga0207668_10104896 3300025972 Bacteria 2108
143 Ga0207668_10241178 3300025972 Bacteria 1463
144 Ga0207677_10036728 3300026023 Bacteria 3196
145 Ga0207677_10060390 3300026023 Unclassified 2620
146 Ga0207703_10058173 3300026035 Bacteria 3154
147 Ga0207639_10202631 3300026041 Bacteria 1703
148 Ga0207678_10054505 3300026067 Bacteria 3444
149 Ga0207702_10000516 3300026078 Bacteria 43552
150 Ga0207641_10042557 3300026088 Bacteria 3811
151 Ga0207676_10032129 3300026095 Bacteria 3953
152 Ga0207676_10062086 3300026095 Bacteria 2962
153 Ga0207675_100011560 3300026118 Bacteria 8254
154 Ga0207675_100024656 3300026118 Bacteria 5593
155 Ga0207683_10015426 3300026121 Bacteria 6507
156 Ga0207698_10134110 3300026142 Bacteria 2121
157 Ga0209371_1010420 3300027312 Bacteria 2859
158 Ga0209813_10028039 3300027866 Bacteria 1639
159 Ga0268266_10126340 3300028379 Bacteria 2283
160 Ga0268264_10078207 3300028381 Bacteria 2819
161 Ga0268256_1011179 3300030500 Bacteria 2859
162 Ga0307509_10372620 3300031507 Bacteria 1143
163 Ga0307408_100039663 3300031548 Bacteria 3331
164 Ga0307508_10102008 3300031616 Bacteria 2465
165 Ga0265314_10000777 3300031711 Bacteria 37889
166 Ga0307405_10001012 3300031731 Bacteria 11359
167 Ga0307410_10090633 3300031852 Bacteria 2169
168 Ga0307406_10325651 3300031901 Bacteria 1190
169 Ga0307407_10005496 3300031903 Bacteria 5507
170 Ga0307412_10000169 3300031911 Bacteria 46494
171 Ga0307409_100000392 3300031995 Bacteria 18558
172 Ga0307416_100003503 3300032002 Bacteria 9232
173 Ga0307415_100000002 3300032126 Bacteria 133560
174 Ga0307507_10007150 3300033179 Bacteria 16482
175 Ga0315911_1000010 3300033442 Bacteria 322197
176 Ga0373954_0114940 3300035118 Bacteria 1304
177 Ga0373931_0021587 3300035691 Bacteria 3231
178 Ga0373927_0110668 3300035695 Bacteria 1789
179 Ga0395899_0016451 3300037312 Bacteria 5639
180 Ga0395900_0003395 3300037418 Bacteria 17196
181 Ga0395901_0182560 3300038443 Bacteria 2201
182 Ga0436365_0357055 3300039437 Bacteria 2512
183 Ga0436365_1887167 3300039437 Bacteria 40011
184 Ga0436363_0445094 3300039450 Bacteria 1710
185 Ga0436362_0364006 3300039453 Bacteria 4707
186 Ga0466969_0020374 3300044656 Bacteria 3436
187 Ga0466966_0000275 3300044684 Bacteria 33692
188 Ga0466966_0001756 3300044684 Bacteria 14038
189 Ga0466966_0040512 3300044684 Bacteria 2998
190 Ga0466961_0000008 3300044693 Bacteria 142607
191 Ga0466961_0011911 3300044693 Bacteria 5559
192 Ga0466961_0013345 3300044693 Bacteria 5259
193 Ga0466963_0070817 3300044694 Bacteria 2346
194 Ga0466970_0014658 3300044765 Bacteria 4026
195 Ga0466957_0018061 3300044842 Bacteria 4138
196 Ga0466957_0036900 3300044842 Bacteria 2940
197 Ga0466957_0182716 3300044842 Bacteria 1370
198 Ga0466959_0011689 3300045049 Bacteria 6314
199 Ga0466959_0112802 3300045049 Bacteria 1939
200 Ga0466959_0113571 3300045049 Bacteria 1931
201 Ga0466958_0044141 3300045836 Bacteria 2686
202 Ga0466958_0045384 3300045836 Bacteria 2650
203 Ga0466967_0009092 3300045976 Bacteria 7348
204 Ga0466967_0022450 3300045976 Bacteria 5150
205 Ga0466967_0072281 3300045976 Bacteria 3091
206 Ga0466967_0223592 3300045976 Bacteria 1790
207 Ga0495592_0075415 3300046454 Bacteria 2449
208 Ga0495629_0118888 3300046459 Bacteria 1841
209 Ga0495641_0043954 3300046461 Bacteria 2064
210 Ga0495653_0075493 3300046463 Bacteria 2508
211 Ga0495582_0037611 3300046473 Bacteria 2662
212 Ga0495606_0043108 3300046507 Bacteria 3012
213 Ga0495610_0098440 3300046512 Bacteria 1314
214 Ga0495628_0012302 3300046516 Bacteria 7213
215 Ga0495648_0006904 3300046524 Bacteria 9157
216 Ga0495640_0012046 3300046533 Bacteria 6626
217 Ga0495640_0157514 3300046533 Bacteria 1457
218 Ga0495634_0012681 3300046642 Bacteria 6102
219 Ga0495625_0045965 3300046660 Bacteria 3153
220 Ga0495635_0011503 3300046663 Bacteria 6203
221 Ga0495658_0368968 3300046683 Bacteria 913
222 Ga0495624_0073401 3300046690 Bacteria 2127
223 Ga0495604_0024227 3300047317 Bacteria 4842
224 Ga0495674_0085639 3300047319 Bacteria 2699
225 Ga0495676_0024318 3300047321 Bacteria 5247
226 Ga0495686_0104827 3300047472 Bacteria 1702
227 Ga0495593_0161109 3300047673 Bacteria 1132
228 Ga0496100_0010824 3300048903 Bacteria 5176
229 Ga0496100_0059158 3300048903 Bacteria 2517
230 Ga0496101_0017025 3300048904 Bacteria 4922
231 Ga0496101_0030571 3300048904 Bacteria 3778
232 Ga0496101_0351134 3300048904 Bacteria 1159
233 Ga0496102_0001789 3300048905 Bacteria 18636
234 Ga0496103_0048898 3300048906 Bacteria 2614
235 Ga0496104_0010377 3300048907 Bacteria 8321
236 Ga0496104_0094023 3300048907 Bacteria 2867
237 Ga0496105_0011712 3300048908 Bacteria 6939
238 Ga0496105_0169268 3300048908 Bacteria 1791
239 Ga0496106_0013882 3300048909 Bacteria 5953
240 Ga0496106_0028975 3300048909 Bacteria 4126
241 Ga0496107_0000795 3300048910 Bacteria 18299
242 Ga0496108_0036497 3300048911 Bacteria 4089
243 Ga0496108_0198819 3300048911 Bacteria 1739
244 Ga0496109_0009281 3300048912 Bacteria 8380
245 Ga0496109_0050216 3300048912 Bacteria 3799
246 Ga0496109_0067326 3300048912 Bacteria 3280
247 Ga0496109_0143980 3300048912 Unclassified 2229
248 Ga0496110_0047906 3300048913 Bacteria 3744
249 Ga0496111_0069784 3300048914 Bacteria 2555
250 Ga0496112_0072207 3300048915 Bacteria 3411
251 Ga0496112_0188400 3300048915 Bacteria 2026
252 Ga0496112_0384415 3300048915 Bacteria 1344
253 Ga0496113_0038655 3300048916 Bacteria 3509
254 Ga0496113_0057591 3300048916 Bacteria 2921
255 Ga0496113_0140409 3300048916 Bacteria 1900
256 Ga0496114_0012539 3300048917 Bacteria 6788
257 Ga0496114_0052279 3300048917 Bacteria 3403
258 Ga0496114_0101288 3300048917 Bacteria 2459
259 Ga0496114_0487521 3300048917 Bacteria 1090
260 Ga0496115_0004317 3300048918 Bacteria 10288
261 Ga0496115_0012989 3300048918 Bacteria 6283
262 Ga0496116_0007427 3300048919 Bacteria 9724
263 Ga0496116_0061851 3300048919 Bacteria 2421
264 Ga0496117_0013875 3300048920 Bacteria 6987
265 Ga0496118_0005653 3300048921 Bacteria 14097
266 Ga0496118_0169947 3300048921 Bacteria 1334
267 Ga0496119_0063718 3300048922 Bacteria 2191
268 Ga0496120_0060252 3300048923 Bacteria 2123
269 Ga0496120_0063386 3300048923 Bacteria 2056
270 Ga0496121_0003775 3300048924 Bacteria 21157
271 Ga0496121_0011407 3300048924 Bacteria 9874
272 Ga0496121_0029420 3300048924 Bacteria 5079
273 Ga0496121_0112893 3300048924 Bacteria 2069
274 Ga0496121_0130764 3300048924 Bacteria 1879
275 Ga0496121_0182746 3300048924 Bacteria 1511
276 Ga0496122_0000497 3300048925 Bacteria 81763
277 Ga0496123_0003359 3300048926 Bacteria 18097
278 Ga0496124_0189731 3300048927 Bacteria 1574
279 Ga0496125_0000166 3300048928 Bacteria 147432
280 Ga0496125_0036273 3300048928 Bacteria 4309
281 Ga0496125_0058107 3300048928 Bacteria 3126
282 Ga0496126_0001427 3300048929 Bacteria 37551
283 Ga0496126_0062691 3300048929 Bacteria 3335
284 Ga0496126_0079371 3300048929 Bacteria 2905
285 Ga0495682_0008435 3300049460 Bacteria 4058
286 Ga0501036_0232801 3300049572 Bacteria 1546
287 Ga0501043_0055297 3300049579 Bacteria 3118
288 Ga0501046_0001277 3300049580 Bacteria 24381
289 Ga0501046_0051545 3300049580 Bacteria 3247
290 Ga0501067_0009939 3300049583 Bacteria 5268
291 Ga0501070_0000826 3300049586 Bacteria 28120
292 Ga0501070_0105013 3300049586 Bacteria 2335
293 Ga0501073_0024839 3300049589 Bacteria 4301
294 Ga0501074_0006942 3300049590 Bacteria 8176
295 Ga0501074_0282667 3300049590 Bacteria 1180
296 Ga0501077_0004190 3300049593 Bacteria 8714
297 Ga0501079_0023760 3300049741 Bacteria 4703
298 Ga0501080_0005549 3300049742 Bacteria 11264
299 Ga0501080_0023837 3300049742 Bacteria 5672
300 Ga0501080_0047515 3300049742 Bacteria 3996
301 nmdc:mga0yw44_20372_c1 3300050492 Bacteria 3680
302 nmdc:mga0yw44_297960_c1 3300050492 Bacteria 1080
303 nmdc:mga0yw44_91178_c1 3300050492 Bacteria 1926
304 nmdc:mga05p37_9806_c2 3300050507 Bacteria 5066
305 nmdc:mga0qj67_4423_c1 3300050509 Bacteria 10177
306 nmdc:mga0n895_73654_c1 3300050512 Bacteria 3391
307 nmdc:mga0rr50_51099_c1 3300050513 Bacteria 3066
308 nmdc:mga0a205_27627_c1 3300050515 Bacteria 5419
309 nmdc:mga0sz30_10314_c1 3300050516 Bacteria 3580
310 Ga0495619_0195269 3300053085 Bacteria 1401
311 Ga0495619_0233855 3300053085 Bacteria 1273
312 Ga0495619_0238541 3300053085 Bacteria 1260
313 Ga0500559_0018672 3300053136 Bacteria 2928
314 Ga0500627_0080736 3300053158 Bacteria 1450
315 Ga0500636_0128561 3300053177 Bacteria 1414
316 Ga0500552_006392 3300053733 Bacteria 1321
317 Ga0501084_0115490 3300054114 Bacteria 2256
318 Ga0501082_0041893 3300060353 Bacteria 3948
319 Ga0466962_0030165 3300061719 Bacteria 2596
320 Ga0466962_0130727 3300061719 Bacteria 1213
321 2508691062 2508501042 Bacteria 8719808
322 2513639260 2513237094 Bacteria 8789602
323 2513654891 2513237096 Bacteria 8722461
324 2513717201 2513237104 Bacteria 10034502
325 2513861312 2513237137 Bacteria 9558895
326 2513891152 2513237141 Bacteria 8496279
327 2513916086 2513237145 Bacteria 8979722
328 2515852796 2515154155 Bacteria 7985436
329 2517104878 2517093001 Bacteria 9002274
330 2517894615 2517572143 Bacteria 9484767
331 2524537782 2524023228 Bacteria 10118060
332 2599904150 2599185292 Bacteria 6290804
333 2643823878 2643221561 Bacteria 4984412
334 2643861347 2643221569 Bacteria 6064337
335 2643889755 2643221576 Bacteria 5214352
336 2643958811 2643221590 Bacteria 5214697
337 2643983134 2643221594 Bacteria 5811388
338 2644122603 2643221621 Bacteria 6212786
339 2644533154 2643221696 Bacteria 5431823
340 2671122917 2667528175 Bacteria 7532676
341 2738693169 2738541272 Bacteria 6848551
342 2739323256 2738543027 Bacteria 6409078
343 2740166441 2739367898 Bacteria 4367674
344 2809032906 2808606395 Bacteria 6020352
345 2824604441 2824600985 Bacteria 8488197
346 2824615018 2824609381 Bacteria 8672835
347 2824659198 2824653114 Bacteria 8493680
348 2824712445 2824704595 Bacteria 9667483
349 2824762133 2824753945 Bacteria 9787441
350 2824772198 2824763712 Bacteria 9792355
351 2855389059 2855386786 Bacteria 4752232
352 2857482715 2857481737 Bacteria 4761446
353 2857542712 2857537821 Bacteria 5248181
354 2858956223 2858950400 Bacteria 6783797
355 2874633217 2874628541 Bacteria 8630250
356 2885312772 2885312484 Bacteria 6415165
357 2885376779 2885374607 Bacteria 8927485
358 2903749173 2903748898 Bacteria 9972761
359 2904698831 2904690495 Bacteria 9412302
360 2904705105
361 2904712298 2904711408 Bacteria 9771557
362 2906643451 2906635258 Bacteria 8601019
363 2906661325 2906660503 Bacteria 8595048
364 2908743727 2908739725 Bacteria 8628932
365 2908763442 2908756301 Bacteria 8864324
366 2922431385
367 2932795434 2932794094 Bacteria 7915132
368 2932807972 2932801729 Bacteria 7987968
369 2935649612 2935648319 Bacteria 8801166
370 2935658873 2935656913 Bacteria 8965014
371 2935989934 2935984226 Bacteria 8302647
372 2936012906 2936011229 Bacteria 8801034
373 2936021470 2936019824 Bacteria 8804134
374 2936030199 2936028420 Bacteria 8965941
375 2936047664 2936046547 Bacteria 8903709
376 2941482870
377 3005599940 3005594810 Bacteria 8716512
378 3005722875 3005718088 Bacteria 8283608
379 8001782316 8001781756 Bacteria 9586736
380 8006942608 8006933436 Bacteria 10410654
381 8006982336 8006973647 Bacteria 10679141
382 8016631529 8016630954 Bacteria 9217207
383 8019565416 8019555841 Bacteria 9642137
384 8019575510 8019565922 Bacteria 9639779
385 8019655561 8019648815 Bacteria 10014479
386 8054610390 8054609563 Bacteria 5170090
387 8056692787 8056689827 Bacteria 6712655
388 8057575156 8057568493 Bacteria 7221719
389 Ga0157372_10084731
390 JGI25165J46597_1005646
391 JGI25160J50197_1000843
392 JGI25404J52841_10018556
393 Ga0065165_1000659
394 Ga0070658_10486905
395 Ga0068869_100129179
396 Ga0070682_100034783
397 Ga0070682_100044838
398 Ga0070682_100158145
399 Ga0070682_100208712
400 Ga0068868_100065974
401 Ga0070661_100224757
402 Ga0070668_100010677
403 Ga0070668_100039390
404 Ga0070710_10150582
405 Ga0070711_100084785
406 Ga0070705_100078842
407 Ga0070663_100021387
408 Ga0070663_100049799
409 Ga0070678_100025485
410 Ga0070678_100133990
411 Ga0070662_100045081
412 Ga0070685_10031729
413 Ga0068853_100129208
414 Ga0070672_100137099
415 Ga0070693_100054428
416 Ga0070693_100179937
417 Ga0070665_100188080
418 Ga0070704_100015882
419 Ga0068855_100040738
420 Ga0070664_100286915
421 Ga0068857_100126776
422 Ga0068857_100522901
423 Ga0068859_100152195
424 Ga0068859_100169796
425 Ga0068859_100171325
426 Ga0068864_100079199
427 Ga0068863_100064753
428 Ga0068858_100036707
429 Ga0081455_10029960
430 Ga0081455_10053407
431 Ga0081455_10054623
432 Ga0081455_10196749
433 Ga0081540_1001934
434 Ga0081540_1003681
435 Ga0081540_1021954
436 Ga0070717_10084725
437 Ga0075365_10003909
438 Ga0075365_10013900
439 Ga0075363_100022102
440 Ga0075364_10018271
441 Ga0070712_100147439
442 Ga0075369_10020455
443 Ga0097620_100152194
444 Ga0097620_100169796
445 Ga0097620_100171315
446 Ga0099795_10079280
447 Ga0105240_10279629
448 Ga0111539_10241794
449 Ga0105245_10016326
450 Ga0105245_10061578
451 Ga0105245_10194835
452 Ga0105245_10530253
453 Ga0105247_10120639
454 Ga0114129_10002400
455 Ga0105243_10057793
456 Ga0105241_10033759
457 Ga0105241_10108842
458 Ga0105242_10122824
459 Ga0105242_10142804
460 Ga0105248_10025166
461 Ga0105237_10002274
462 Ga0105237_10303041
463 Ga0105238_10130577
464 Ga0105238_10205369
465 Ga0105238_10281937
466 Ga0105249_10004668
467 Ga0105249_10273048
468 Ga0099796_10043585
469 Ga0105239_10059523
470 Ga0105246_10015285
471 Ga0157373_10045829
472 Ga0157371_10137452
473 Ga0157369_10173283
474 Ga0157374_10034825
475 Ga0157378_10002138
476 Ga0163162_10174698
477 Ga0157372_10145972
478 Ga0157372_10178070
479 Ga0157372_10298439
480 Ga0157375_10143321
481 Ga0163163_10183713
482 Ga0157380_10037715
483 Ga0157377_10083434
484 Ga0157376_10015279
485 Ga0206354_11198610
486 Ga0213876_10007115
487 Ga0209677_101272
488 Ga0209233_1003593
489 Ga0209676_1005951
490 Ga0209050_1004128
491 Ga0207426_1000120
492 Ga0207426_1002210
493 Ga0209051_1042154
494 Ga0207642_10020537
495 Ga0207688_10013912
496 Ga0207647_10044745
497 Ga0207654_10006100
498 Ga0207654_10024341
499 Ga0207654_10078475
500 Ga0207707_10222280
501 Ga0207695_10000008
502 Ga0207671_10001041
503 Ga0207671_10130390
504 Ga0207671_10176129
505 Ga0207693_10009301
506 Ga0207663_10057839
507 Ga0207662_10027894
508 Ga0207657_10010073
509 Ga0207657_10233510
510 Ga0207694_10273462
511 Ga0207687_10006324
512 Ga0207687_10014216
513 Ga0207687_10150482
514 Ga0207706_10004364
515 Ga0207706_10050533
516 Ga0207686_10043260
517 Ga0207709_10006466
518 Ga0207670_10215465
519 Ga0207669_10285629
520 Ga0207704_10009310
521 Ga0207665_10041876
522 Ga0207711_10020028
523 Ga0207689_10010553
524 Ga0207689_10127827
525 Ga0207679_10171574
526 Ga0207679_10364839
527 Ga0207667_10392397
528 Ga0207651_10217004
529 Ga0207712_10247610
530 Ga0207668_10104896
531 Ga0207668_10241178
532 Ga0207677_10036728
533 Ga0207677_10060390
534 Ga0207703_10058173
535 Ga0207639_10202631
536 Ga0207678_10054505
537 Ga0207702_10000516
538 Ga0207641_10042557
539 Ga0207676_10032129
540 Ga0207676_10062086
541 Ga0207675_100011560
542 Ga0207675_100024656
543 Ga0207683_10015426
544 Ga0207698_10134110
545 Ga0209371_1010420
546 Ga0209813_10028039
547 Ga0268266_10126340
548 Ga0268264_10078207
549 Ga0268256_1011179
550 Ga0307509_10372620
551 Ga0307408_100039663
552 Ga0307508_10102008
553 Ga0265314_10000777
554 Ga0307405_10001012
555 Ga0307410_10090633
556 Ga0307406_10325651
557 Ga0307407_10005496
558 Ga0307412_10000169
559 Ga0307409_100000392
560 Ga0307416_100003503
561 Ga0307415_100000002
562 Ga0307507_10007150
563 Ga0315911_1000010
564 Ga0373954_0114940
565 Ga0373931_0021587
566 Ga0373927_0110668
567 Ga0395899_0016451
568 Ga0395900_0003395
569 Ga0395901_0182560
570 Ga0436365_0357055
571 Ga0436365_1887167
572 Ga0436363_0445094
573 Ga0436362_0364006
574 Ga0466969_0020374
575 Ga0466966_0000275
576 Ga0466966_0001756
577 Ga0466966_0040512
578 Ga0466961_0000008
579 Ga0466961_0011911
580 Ga0466961_0013345
581 Ga0466963_0070817
582 Ga0466970_0014658
583 Ga0466957_0018061
584 Ga0466957_0036900
585 Ga0466957_0182716
586 Ga0466959_0011689
587 Ga0466959_0112802
588 Ga0466959_0113571
589 Ga0466958_0044141
590 Ga0466958_0045384
591 Ga0466967_0009092
592 Ga0466967_0022450
593 Ga0466967_0072281
594 Ga0466967_0223592
595 Ga0495592_0075415
596 Ga0495629_0118888
597 Ga0495641_0043954
598 Ga0495653_0075493
599 Ga0495582_0037611
600 Ga0495606_0043108
601 Ga0495610_0098440
602 Ga0495628_0012302
603 Ga0495648_0006904
604 Ga0495640_0012046
605 Ga0495640_0157514
606 Ga0495634_0012681
607 Ga0495625_0045965
608 Ga0495635_0011503
609 Ga0495658_0368968
610 Ga0495624_0073401
611 Ga0495604_0024227
612 Ga0495674_0085639
613 Ga0495676_0024318
614 Ga0495686_0104827
615 Ga0495593_0161109
616 Ga0496100_0010824
617 Ga0496100_0059158
618 Ga0496101_0017025
619 Ga0496101_0030571
620 Ga0496101_0351134
621 Ga0496102_0001789
622 Ga0496103_0048898
623 Ga0496104_0010377
624 Ga0496104_0094023
625 Ga0496105_0011712
626 Ga0496105_0169268
627 Ga0496106_0013882
628 Ga0496106_0028975
629 Ga0496107_0000795
630 Ga0496108_0036497
631 Ga0496108_0198819
632 Ga0496109_0009281
633 Ga0496109_0050216
634 Ga0496109_0067326
635 Ga0496109_0143980
636 Ga0496110_0047906
637 Ga0496111_0069784
638 Ga0496112_0072207
639 Ga0496112_0188400
640 Ga0496112_0384415
641 Ga0496113_0038655
642 Ga0496113_0057591
643 Ga0496113_0140409
644 Ga0496114_0012539
645 Ga0496114_0052279
646 Ga0496114_0101288
647 Ga0496114_0487521
648 Ga0496115_0004317
649 Ga0496115_0012989
650 Ga0496116_0007427
651 Ga0496116_0061851
652 Ga0496117_0013875
653 Ga0496118_0005653
654 Ga0496118_0169947
655 Ga0496119_0063718
656 Ga0496120_0060252
657 Ga0496120_0063386
658 Ga0496121_0003775
659 Ga0496121_0011407
660 Ga0496121_0029420
661 Ga0496121_0112893
662 Ga0496121_0130764
663 Ga0496121_0182746
664 Ga0496122_0000497
665 Ga0496123_0003359
666 Ga0496124_0189731
667 Ga0496125_0000166
668 Ga0496125_0036273
669 Ga0496125_0058107
670 Ga0496126_0001427
671 Ga0496126_0062691
672 Ga0496126_0079371
673 Ga0495682_0008435
674 Ga0501036_0232801
675 Ga0501043_0055297
676 Ga0501046_0001277
677 Ga0501046_0051545
678 Ga0501067_0009939
679 Ga0501070_0000826
680 Ga0501070_0105013
681 Ga0501073_0024839
682 Ga0501074_0006942
683 Ga0501074_0282667
684 Ga0501077_0004190
685 Ga0501079_0023760
686 Ga0501080_0005549
687 Ga0501080_0023837
688 Ga0501080_0047515
689 nmdc:mga0yw44_20372_c1
690 nmdc:mga0yw44_297960_c1
691 nmdc:mga0yw44_91178_c1
692 nmdc:mga05p37_9806_c2
693 nmdc:mga0qj67_4423_c1
694 nmdc:mga0n895_73654_c1
695 nmdc:mga0rr50_51099_c1
696 nmdc:mga0a205_27627_c1
697 nmdc:mga0sz30_10314_c1
698 Ga0495619_0195269
699 Ga0495619_0233855
700 Ga0495619_0238541
701 Ga0500559_0018672
702 Ga0500627_0080736
703 Ga0500636_0128561
704 Ga0500552_006392
705 Ga0501084_0115490
706 Ga0501082_0041893
707 Ga0466962_0030165
708 Ga0466962_0130727
709 2508691062
710 2513639260
711 2513654891
712 2513717201
713 2513861312
714 2513891152
715 2513916086
716 2515852796
717 2517104878
718 2517894615
719 2524537782
720 2599904150
721 2643823878
722 2643861347
723 2643889755
724 2643958811
725 2643983134
726 2644122603
727 2644533154
728 2671122917
729 2738693169
730 2739323256
731 2740166441
732 2809032906
733 2824604441
734 2824615018
735 2824659198
736 2824712445
737 2824762133
738 2824772198
739 2855389059
740 2857482715
741 2857542712
742 2858956223
743 2874633217
744 2885312772
745 2885376779
746 2903749173
747 2904698831
748 2904705105
749 2904712298
750 2906643451
751 2906661325
752 2908743727
753 2908763442
754 2922431385
755 2932795434
756 2932807972
757 2935649612
758 2935658873
759 2935989934
760 2936012906
761 2936021470
762 2936030199
763 2936047664
764 2941482870
765 3005599940
766 3005722875
767 8001782316
768 8006942608
769 8006982336
770 8016631529
771 8019565416
772 8019575510
773 8019655561
774 8054610390
775 8056692787
776 8057575156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14789

THDPS_M

Tetrahydrodipicolinate N-succinyltransferase middle

132

172

0.99

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

253

286

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fsx-assembly3.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7395 7 249
3fsy-assembly1.cif.gz_C structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis 0.7368 7 249
3fsy-assembly3.cif.gz_E structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis 0.7195 7 256
3fsy-assembly2.cif.gz_D structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis 0.7187 5 256
3fsy-assembly1.cif.gz_A structure of tetrahydrodipicolinate n-succinyltransferase (rv1201c;dapd) in complex with succinyl-coa from mycobacterium tuberculosis 0.7177 7 256
ID Description Score Start End Superfamily
af_P9WP21_1_110_3.30.70.2010 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9279 5 116 3.30.70.2010
5e3rA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9169 7 116 3.30.70.2010
5e3rA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8975 7 116 3.30.70.2010
af_P9WP21_1_110_3.30.70.2010 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8956 5 116 3.30.70.2010
3r5bD02 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;Trimeric LpxA-like enzymes 0.8411 117 157 3.30.60.70
ID Description Score Start End GO Terms
AF-A0A6G3UZU7-F1-model_v4 deleted 0.9599 20 177
AF-A0A6B3INQ2-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 0.9568 2 83 GO:0016740
AF-A0A658AFG7-F1-model_v4 deleted 0.9528 6 201
AF-A0A6B3G969-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 0.9519 103 174 GO:0005737
GO:0016740
AF-X8CNL6-F1-model_v4 Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 0.9492 7 185 GO:0005737
GO:0016740

Map