F431078

General Info

Members Datasets Scaffolds Average Seq Length
388 195 388 129

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_101504381|Ga0075434_1015043811
Length 138
Sequence MDGRGQGAGVSYASMKTGLLIISVLLTTSSVLAHHSNAAFDGDKVVVLKGTVTEWKWTNPHVWILLSVDDGKGGKVDWAIEGRTPGQLLRAGWSRSILKAGDVITVDFSPAKDGTRTGLLTRVRLADGTVLGQAPPAQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
147 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
176 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
177 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.06
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13859647 2162886012 Bacteria 812
2 Ga0065714_10226877 3300005288 Bacteria 822
3 Ga0065704_10722619 3300005289 Unclassified 549
4 Ga0065712_10136814 3300005290 Bacteria 1482
5 Ga0065712_10169505 3300005290 Bacteria 1252
6 Ga0065715_10034783 3300005293 Bacteria 1353
7 Ga0065715_10724573 3300005293 Bacteria 642
8 Ga0065707_10699135 3300005295 Unclassified 640
9 Ga0070676_10299363 3300005328 Bacteria 1090
10 Ga0070690_101756313 3300005330 Bacteria 505
11 Ga0070670_100000974 3300005331 Bacteria 22427
12 Ga0070670_100509216 3300005331 Bacteria 1071
13 Ga0070670_100752937 3300005331 Bacteria 878
14 Ga0070670_101192892 3300005331 Unclassified 695
15 Ga0068869_100509374 3300005334 Bacteria 1006
16 Ga0070666_10023898 3300005335 Bacteria 3979
17 Ga0070666_10914699 3300005335 Bacteria 649
18 Ga0068868_101242646 3300005338 Bacteria 690
19 Ga0070689_100411496 3300005340 Bacteria 1145
20 Ga0070689_100990203 3300005340 Unclassified 747
21 Ga0070689_101037258 3300005340 Bacteria 731
22 Ga0070689_101412932 3300005340 Unclassified 629
23 Ga0070689_101905612 3300005340 Unclassified 543
24 Ga0070689_102137167 3300005340 Unclassified 513
25 Ga0070668_100518663 3300005347 Bacteria 1034
26 Ga0070669_100066741 3300005353 Bacteria 2652
27 Ga0070669_100172554 3300005353 Bacteria 1687
28 Ga0070675_100000597 3300005354 Bacteria 24772
29 Ga0070675_100049437 3300005354 Bacteria 3451
30 Ga0070675_100125619 3300005354 Bacteria 2182
31 Ga0070675_100661139 3300005354 Bacteria 950
32 Ga0070675_101154088 3300005354 Bacteria 713
33 Ga0070671_100339224 3300005355 Bacteria 1282
34 Ga0070671_100670391 3300005355 Unclassified 899
35 Ga0070671_101084085 3300005355 Bacteria 703
36 Ga0070671_101749842 3300005355 Bacteria 552
37 Ga0070674_100116209 3300005356 Bacteria 1974
38 Ga0070673_100146323 3300005364 Bacteria 1998
39 Ga0070673_100213473 3300005364 Bacteria 1668
40 Ga0070673_100443401 3300005364 Bacteria 1167
41 Ga0070673_100555780 3300005364 Bacteria 1043
42 Ga0070673_100714719 3300005364 Bacteria 921
43 Ga0070688_100089424 3300005365 Bacteria 2009
44 Ga0070688_100119885 3300005365 Bacteria 1761
45 Ga0070688_101707276 3300005365 Unclassified 515
46 Ga0070667_101997767 3300005367 Bacteria 546
47 Ga0070713_100142391 3300005436 Bacteria 2125
48 Ga0070701_11304419 3300005438 Unclassified 519
49 Ga0070705_100121728 3300005440 Unclassified 1686
50 Ga0070700_100329378 3300005441 Bacteria 1125
51 Ga0070678_100236975 3300005456 Unclassified 1524
52 Ga0070678_100585440 3300005456 Bacteria 994
53 Ga0070662_100015838 3300005457 Bacteria 5057
54 Ga0070662_100325074 3300005457 Bacteria 1255
55 Ga0070662_101457453 3300005457 Unclassified 590
56 Ga0070681_10295774 3300005458 Bacteria 1529
57 Ga0070681_10372410 3300005458 Bacteria 1339
58 Ga0068867_100077508 3300005459 Bacteria 2498
59 Ga0068867_100142894 3300005459 Bacteria 1872
60 Ga0068867_100219015 3300005459 Bacteria 1533
61 Ga0068867_100663253 3300005459 Unclassified 916
62 Ga0068867_100798921 3300005459 Bacteria 841
63 Ga0070685_10866554 3300005466 Bacteria 670
64 Ga0070706_101182624 3300005467 Bacteria 703
65 Ga0070707_100082412 3300005468 Unclassified 3106
66 Ga0070707_101537655 3300005468 Bacteria 632
67 Ga0070698_100753427 3300005471 Bacteria 917
68 Ga0070699_100361174 3300005518 Bacteria 1309
69 Ga0070699_100386230 3300005518 Bacteria 1264
70 Ga0070679_100290346 3300005530 Bacteria 1587
71 Ga0070684_100166520 3300005535 Unclassified 2001
72 Ga0070672_100030154 3300005543 Unclassified 4072
73 Ga0070672_101104395 3300005543 Bacteria 705
74 Ga0070686_100536849 3300005544 Bacteria 913
75 Ga0070665_100002769 3300005548 Bacteria 19002
76 Ga0070665_100326714 3300005548 Unclassified 1538
77 Ga0070664_100025669 3300005564 Unclassified 4887
78 Ga0070664_100338781 3300005564 Bacteria 1366
79 Ga0070664_101068081 3300005564 Unclassified 760
80 Ga0070664_101247801 3300005564 Bacteria 702
81 Ga0068857_100890724 3300005577 Bacteria 853
82 Ga0068857_101553988 3300005577 Unclassified 645
83 Ga0068854_100335753 3300005578 Bacteria 1233
84 Ga0068854_101681286 3300005578 Bacteria 580
85 Ga0070702_100168624 3300005615 Bacteria 1422
86 Ga0068852_102191186 3300005616 Unclassified 574
87 Ga0068859_100061348 3300005617 Unclassified 3789
88 Ga0068859_100191105 3300005617 Unclassified 2132
89 Ga0068859_100494249 3300005617 Bacteria 1319
90 Ga0068864_100025999 3300005618 Bacteria 4934
91 Ga0068864_100263218 3300005618 Bacteria 1605
92 Ga0068864_102393169 3300005618 Unclassified 534
93 Ga0068866_10157579 3300005718 Bacteria 1321
94 Ga0068866_10242237 3300005718 Unclassified 1099
95 Ga0068861_100339674 3300005719 Bacteria 1314
96 Ga0068861_100457676 3300005719 Bacteria 1145
97 Ga0068870_10334789 3300005840 Unclassified 966
98 Ga0068870_10366467 3300005840 Bacteria 929
99 Ga0068870_10457830 3300005840 Unclassified 842
100 Ga0068863_100078241 3300005841 Bacteria 3132
101 Ga0068863_100841725 3300005841 Bacteria 916
102 Ga0068858_100005033 3300005842 Bacteria 12956
103 Ga0068858_100148929 3300005842 Bacteria 2199
104 Ga0068858_100192394 3300005842 Unclassified 1928
105 Ga0068858_100214068 3300005842 Bacteria 1824
106 Ga0068858_100475197 3300005842 Bacteria 1206
107 Ga0068858_101195184 3300005842 Unclassified 747
108 Ga0068860_100613048 3300005843 Bacteria 1094
109 Ga0068860_101300764 3300005843 Bacteria 748
110 Ga0068862_101126487 3300005844 Bacteria 781
111 Ga0068862_101263324 3300005844 Bacteria 739
112 Ga0075432_10213305 3300006058 Bacteria 769
113 Ga0097621_100016199 3300006237 Bacteria 5630
114 Ga0097621_100112795 3300006237 Bacteria 2299
115 Ga0097621_100130800 3300006237 Unclassified 2137
116 Ga0068871_100023378 3300006358 Bacteria 4780
117 Ga0068871_100858381 3300006358 Bacteria 839
118 Ga0075428_100391621 3300006844 Bacteria 1489
119 Ga0075428_100647313 3300006844 Bacteria 1127
120 Ga0075433_10668056 3300006852 Unclassified 911
121 Ga0075433_11611495 3300006852 Unclassified 560
122 Ga0075434_100394120 3300006871 Unclassified 1405
123 Ga0075434_101026506 3300006871 Unclassified 838
124 Ga0075434_101504381 3300006871 Bacteria 682
125 Ga0075429_100755565 3300006880 Unclassified 852
126 Ga0068865_100130009 3300006881 Bacteria 1885
127 Ga0068865_100465062 3300006881 Bacteria 1048
128 Ga0075436_100750218 3300006914 Unclassified 725
129 Ga0097620_100061351 3300006931 Unclassified 3789
130 Ga0097620_100191098 3300006931 Unclassified 2132
131 Ga0097620_100494248 3300006931 Bacteria 1319
132 Ga0097620_101277757 3300006931 Unclassified 809
133 Ga0075435_100171077 3300007076 Bacteria 1832
134 Ga0075435_100339773 3300007076 Unclassified 1286
135 Ga0105251_10275190 3300009011 Unclassified 761
136 Ga0111539_10084571 3300009094 Bacteria 3730
137 Ga0111539_10955398 3300009094 Unclassified 996
138 Ga0105245_10227856 3300009098 Bacteria 1801
139 Ga0105245_10870191 3300009098 Unclassified 942
140 Ga0105245_12130014 3300009098 Unclassified 614
141 Ga0105245_12653273 3300009098 Unclassified 554
142 Ga0114129_10029025 3300009147 Bacteria 7836
143 Ga0114129_10040470 3300009147 Bacteria 6570
144 Ga0114129_13295759 3300009147 Bacteria 522
145 Ga0105243_12188577 3300009148 Unclassified 589
146 Ga0105242_10380708 3300009176 Unclassified 1311
147 Ga0105242_10396034 3300009176 Bacteria 1287
148 Ga0105242_11032292 3300009176 Bacteria 832
149 Ga0105242_11285123 3300009176 Unclassified 755
150 Ga0105248_10049791 3300009177 Unclassified 4698
151 Ga0105248_10108481 3300009177 Unclassified 3130
152 Ga0105248_10234286 3300009177 Bacteria 2067
153 Ga0105248_10411152 3300009177 Unclassified 1523
154 Ga0105248_10457805 3300009177 Bacteria 1438
155 Ga0105248_10705966 3300009177 Bacteria 1138
156 Ga0105248_10842885 3300009177 Bacteria 1035
157 Ga0105248_10866052 3300009177 Bacteria 1020
158 Ga0105248_11686993 3300009177 Bacteria 718
159 Ga0105238_10234078 3300009551 Bacteria 1813
160 Ga0105238_11961278 3300009551 Unclassified 619
161 Ga0105249_10488340 3300009553 Unclassified 1275
162 Ga0105249_11757533 3300009553 Unclassified 693
163 Ga0105249_13268563 3300009553 Unclassified 521
164 Ga0105246_10605110 3300011119 Bacteria 948
165 Ga0157374_10878651 3300013296 Bacteria 914
166 Ga0157374_11048614 3300013296 Bacteria 835
167 Ga0157378_10042101 3300013297 Bacteria 4052
168 Ga0157378_10232554 3300013297 Bacteria 1757
169 Ga0157378_12332968 3300013297 Bacteria 587
170 Ga0163162_10159553 3300013306 Bacteria 2377
171 Ga0163162_10876532 3300013306 Bacteria 1012
172 Ga0163162_10965835 3300013306 Unclassified 962
173 Ga0163162_11702798 3300013306 Bacteria 720
174 Ga0157375_10120431 3300013308 Bacteria 2733
175 Ga0157375_10337996 3300013308 Bacteria 1671
176 Ga0157375_11542735 3300013308 Bacteria 784
177 Ga0157375_11969196 3300013308 Unclassified 694
178 Ga0163163_10034296 3300014325 Bacteria 4913
179 Ga0163163_10761974 3300014325 Bacteria 1031
180 Ga0163163_11382071 3300014325 Unclassified 766
181 Ga0163163_12543840 3300014325 Unclassified 570
182 Ga0157380_10939610 3300014326 Bacteria 894
183 Ga0157380_11261525 3300014326 Bacteria 785
184 Ga0157380_11629795 3300014326 Bacteria 701
185 Ga0157377_10216479 3300014745 Unclassified 1224
186 Ga0157379_10016968 3300014968 Bacteria 6408
187 Ga0157379_10489481 3300014968 Bacteria 1139
188 Ga0157379_11853616 3300014968 Unclassified 593
189 Ga0157376_10131384 3300014969 Bacteria 2234
190 Ga0157376_10350833 3300014969 Bacteria 1412
191 Ga0163161_10204076 3300017792 Bacteria 1524
192 Ga0163161_11750664 3300017792 Unclassified 551
193 Ga0213876_10251089 3300021384 Unclassified 940
194 Ga0207697_10029325 3300025315 Unclassified 2252
195 Ga0207642_10588338 3300025899 Unclassified 691
196 Ga0207688_10098617 3300025901 Bacteria 1685
197 Ga0207680_10034512 3300025903 Bacteria 2895
198 Ga0207680_10748891 3300025903 Bacteria 700
199 Ga0207643_10300407 3300025908 Unclassified 999
200 Ga0207684_11069453 3300025910 Unclassified 673
201 Ga0207707_10377566 3300025912 Bacteria 1219
202 Ga0207660_11132360 3300025917 Unclassified 637
203 Ga0207660_11591494 3300025917 Unclassified 527
204 Ga0207649_10778542 3300025920 Unclassified 746
205 Ga0207652_10763328 3300025921 Unclassified 860
206 Ga0207646_11023443 3300025922 Unclassified 729
207 Ga0207646_11670915 3300025922 Unclassified 548
208 Ga0207681_10037922 3300025923 Bacteria 3189
209 Ga0207694_10816109 3300025924 Bacteria 788
210 Ga0207650_10004403 3300025925 Bacteria 9622
211 Ga0207650_10505507 3300025925 Bacteria 1010
212 Ga0207659_10028855 3300025926 Bacteria 3774
213 Ga0207659_10123823 3300025926 Bacteria 1985
214 Ga0207659_10201658 3300025926 Bacteria 1589
215 Ga0207687_10096905 3300025927 Bacteria 2163
216 Ga0207644_10301097 3300025931 Bacteria 1292
217 Ga0207644_10396893 3300025931 Bacteria 1127
218 Ga0207644_10994477 3300025931 Bacteria 704
219 Ga0207706_10017124 3300025933 Bacteria 6535
220 Ga0207706_10605696 3300025933 Unclassified 941
221 Ga0207686_10166342 3300025934 Unclassified 1551
222 Ga0207686_10993602 3300025934 Bacteria 681
223 Ga0207709_11073985 3300025935 Unclassified 660
224 Ga0207670_10539214 3300025936 Bacteria 952
225 Ga0207669_10037755 3300025937 Unclassified 2775
226 Ga0207669_10044678 3300025937 Bacteria 2605
227 Ga0207704_10094381 3300025938 Bacteria 1975
228 Ga0207704_10825658 3300025938 Bacteria 775
229 Ga0207704_10927879 3300025938 Unclassified 733
230 Ga0207691_10017637 3300025940 Bacteria 6765
231 Ga0207691_10186505 3300025940 Bacteria 1810
232 Ga0207691_11458797 3300025940 Bacteria 560
233 Ga0207711_10016007 3300025941 Bacteria 6223
234 Ga0207711_10097115 3300025941 Bacteria 2601
235 Ga0207711_10101008 3300025941 Bacteria 2552
236 Ga0207711_10356092 3300025941 Unclassified 1355
237 Ga0207711_10451709 3300025941 Bacteria 1196
238 Ga0207711_10946016 3300025941 Bacteria 800
239 Ga0207689_10249341 3300025942 Bacteria 1468
240 Ga0207689_11124891 3300025942 Bacteria 662
241 Ga0207679_10125394 3300025945 Unclassified 2051
242 Ga0207651_10050530 3300025960 Bacteria 2823
243 Ga0207651_10173314 3300025960 Bacteria 1704
244 Ga0207651_10236949 3300025960 Bacteria 1485
245 Ga0207651_10532743 3300025960 Bacteria 1019
246 Ga0207651_10664946 3300025960 Unclassified 915
247 Ga0207712_10384263 3300025961 Unclassified 1176
248 Ga0207640_10039329 3300025981 Bacteria 2993
249 Ga0207640_10416926 3300025981 Bacteria 1098
250 Ga0207658_10419353 3300025986 Bacteria 1180
251 Ga0207677_10383608 3300026023 Bacteria 1187
252 Ga0207703_10091498 3300026035 Bacteria 2559
253 Ga0207703_10117869 3300026035 Bacteria 2275
254 Ga0207703_10244766 3300026035 Unclassified 1614
255 Ga0207703_10452741 3300026035 Bacteria 1199
256 Ga0207703_10785051 3300026035 Unclassified 909
257 Ga0207639_10703025 3300026041 Bacteria 938
258 Ga0207708_10016682 3300026075 Bacteria 5526
259 Ga0207641_10021380 3300026088 Bacteria 5317
260 Ga0207641_10432815 3300026088 Bacteria 1269
261 Ga0207641_10890978 3300026088 Bacteria 883
262 Ga0207648_10020571 3300026089 Bacteria 5941
263 Ga0207648_10104066 3300026089 Bacteria 2489
264 Ga0207648_10170681 3300026089 Bacteria 1922
265 Ga0207648_10266483 3300026089 Bacteria 1529
266 Ga0207648_10279627 3300026089 Bacteria 1492
267 Ga0207648_10721158 3300026089 Bacteria 925
268 Ga0207676_10343355 3300026095 Unclassified 1378
269 Ga0207676_10987819 3300026095 Unclassified 829
270 Ga0207674_10140214 3300026116 Bacteria 2377
271 Ga0207674_11492528 3300026116 Unclassified 645
272 Ga0207675_100141811 3300026118 Bacteria 2283
273 Ga0207675_100387914 3300026118 Bacteria 1374
274 Ga0207675_100763115 3300026118 Unclassified 979
275 Ga0207675_100938679 3300026118 Bacteria 882
276 Ga0207683_10022499 3300026121 Bacteria 5411
277 Ga0209974_10242987 3300027876 Bacteria 676
278 Ga0207428_10115049 3300027907 Unclassified 2066
279 Ga0207428_10153839 3300027907 Unclassified 1750
280 Ga0207428_10224640 3300027907 Bacteria 1406
281 Ga0268266_11290797 3300028379 Bacteria 705
282 Ga0268265_10182648 3300028380 Bacteria 1804
283 Ga0268264_10069148 3300028381 Bacteria 2986
284 Ga0268264_10168318 3300028381 Bacteria 1980
285 Ga0268264_10446328 3300028381 Unclassified 1252
286 Ga0268264_10844516 3300028381 Bacteria 917
287 Ga0307408_100271747 3300031548 Bacteria 1408
288 Ga0307410_10540907 3300031852 Unclassified 964
289 Ga0307410_10821173 3300031852 Unclassified 792
290 Ga0307407_10372131 3300031903 Bacteria 1018
291 Ga0307409_100402497 3300031995 Bacteria 1308
292 Ga0307409_100526426 3300031995 Bacteria 1156
293 Ga0307416_100307384 3300032002 Bacteria 1580
294 Ga0307416_100365946 3300032002 Unclassified 1466
295 Ga0307414_10359227 3300032004 Bacteria 1253
296 Ga0307411_10028078 3300032005 Bacteria 3416
297 Ga0307411_10091093 3300032005 Unclassified 2129
298 Ga0373953_0108785 3300035117 Unclassified 1171
299 Ga0373956_0317688 3300035119 Bacteria 742
300 Ga0373955_0643549 3300035172 Bacteria 650
301 Ga0373927_1054156 3300035695 Unclassified 536
302 Ga0373947_0629528 3300035725 Bacteria 731
303 Ga0373937_0756915 3300036401 Bacteria 919
304 Ga0373937_0886456 3300036401 Bacteria 841
305 Ga0436365_1632235 3300039437 Unclassified 1142
306 Ga0439456_171478 3300042013 Unclassified 510
307 Ga0439462_0080593 3300042015 Bacteria 889
308 Ga0439435_0010963 3300042436 Bacteria 2165
309 Ga0495630_0180880 3300046517 Unclassified 1608
310 Ga0495621_0360024 3300046539 Bacteria 612
311 Ga0495633_0115679 3300046558 Unclassified 1243
312 Ga0495633_0119324 3300046558 Unclassified 1222
313 Ga0495669_0044559 3300046684 Bacteria 1976
314 Ga0495669_0642753 3300046684 Unclassified 516
315 Ga0495674_0346265 3300047319 Bacteria 1207
316 Ga0496101_0612691 3300048904 Bacteria 861
317 Ga0496104_0115455 3300048907 Bacteria 2576
318 Ga0496104_0581242 3300048907 Bacteria 1031
319 Ga0496104_0844795 3300048907 Bacteria 821
320 Ga0496105_0550507 3300048908 Bacteria 900
321 Ga0496108_0869189 3300048911 Bacteria 775
322 Ga0496108_1553038 3300048911 Bacteria 549
323 Ga0496114_1164613 3300048917 Bacteria 657
324 Ga0501033_0130815 3300049570 Bacteria 1818
325 Ga0501036_0304255 3300049572 Unclassified 1333
326 Ga0501037_0066575 3300049573 Bacteria 2624
327 Ga0501039_0218252 3300049575 Unclassified 1499
328 Ga0501040_0026807 3300049576 Bacteria 3876
329 Ga0501040_0392805 3300049576 Unclassified 996
330 Ga0501041_0051339 3300049577 Bacteria 2513
331 Ga0501041_0052713 3300049577 Bacteria 2480
332 Ga0501042_0020594 3300049578 Bacteria 4592
333 Ga0501042_0054886 3300049578 Bacteria 2842
334 Ga0501046_0053854 3300049580 Bacteria 3167
335 Ga0501046_0122014 3300049580 Bacteria 1982
336 Ga0501048_0009754 3300049582 Bacteria 7201
337 Ga0501048_0631695 3300049582 Bacteria 769
338 Ga0501068_0014418 3300049584 Bacteria 4519
339 Ga0501068_0149133 3300049584 Bacteria 1469
340 Ga0501071_0042141 3300049587 Bacteria 3269
341 Ga0501072_0122395 3300049588 Bacteria 2073
342 Ga0501072_0133325 3300049588 Unclassified 1981
343 Ga0501074_0031400 3300049590 Bacteria 3848
344 Ga0501075_0004356 3300049591 Bacteria 9572
345 Ga0501075_0143992 3300049591 Bacteria 1817
346 Ga0501076_0018351 3300049592 Bacteria 5332
347 Ga0501076_0243165 3300049592 Bacteria 1472
348 Ga0501077_0317595 3300049593 Bacteria 993
349 Ga0501202_157397 3300049652 Unclassified 599
350 Ga0501217_336178 3300049661 Unclassified 506
351 Ga0501233_054982 3300049668 Bacteria 974
352 Ga0501233_201291 3300049668 Unclassified 580
353 Ga0501225_0358755 3300049705 Unclassified 506
354 Ga0501079_0015376 3300049741 Bacteria 5839
355 Ga0501079_0019553 3300049741 Bacteria 5173
356 Ga0501080_0056506 3300049742 Bacteria 3655
357 Ga0501081_0027332 3300049743 Bacteria 3849
358 Ga0501081_0133289 3300049743 Unclassified 1776
359 Ga0501081_0805460 3300049743 Bacteria 707
360 Ga0501283_035596 3300049779 Bacteria 848
361 Ga0501044_1600449 3300049823 Unclassified 516
362 Ga0501045_0001950 3300049824 Bacteria 13938
363 Ga0501045_0015954 3300049824 Bacteria 5330
364 nmdc:mga05p37_119692_c1 3300050507 Bacteria 3235
365 nmdc:mga05p37_35811_c1 3300050507 Bacteria 6088
366 nmdc:mga05p37_765185_c1 3300050507 Bacteria 1062
367 nmdc:mga09592_377385_c1 3300050508 Bacteria 1226
368 nmdc:mga09592_57722_c1 3300050508 Bacteria 3281
369 nmdc:mga09592_580769_c1 3300050508 Bacteria 961
370 nmdc:mga06r32_1464235_c1 3300050510 Unclassified 624
371 nmdc:mga06r32_218290_c1 3300050510 Bacteria 1895
372 nmdc:mga08y16_1230284_c1 3300050511 Bacteria 718
373 nmdc:mga08y16_1355447_c1 3300050511 Unclassified 676
374 nmdc:mga08y16_1659_c1 3300050511 Bacteria 22568
375 nmdc:mga08y16_202724_c1 3300050511 Unclassified 2056
376 nmdc:mga08y16_282138_c1 3300050511 Unclassified 1713
377 nmdc:mga08y16_45889_c1 3300050511 Bacteria 4577
378 nmdc:mga0n895_159266_c1 3300050512 Bacteria 2288
379 nmdc:mga0rr50_101823_c1 3300050513 Bacteria 2258
380 nmdc:mga0rr50_728034_c1 3300050513 Bacteria 847
381 nmdc:mga08x19_1105249_c1 3300050514 Bacteria 562
382 nmdc:mga08x19_853867_c1 3300050514 Unclassified 647
383 nmdc:mga0a205_627357_c1 3300050515 Unclassified 927
384 nmdc:mga0a205_935204_c1 3300050515 Bacteria 714
385 Ga0501084_0012128 3300054114 Bacteria 7134
386 Ga0501082_0005858 3300060353 Bacteria 10672
387 Ga0530510_0004221 3300061734 Bacteria 9936
388 Ga0530510_0335406 3300061734 Bacteria 1135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_580769_c1 nmdc:mga09592_580769_c1_589_939 114
2 3300035695 Ga0373927_1054156 Ga0373927_1054156_146_523 115
3 3300014326 Ga0157380_10939610 Ga0157380_109396102 119
4 3300005293 Ga0065715_10724573 Ga0065715_107245731 121
5 3300009148 Ga0105243_12188577 Ga0105243_121885771 121
6 3300005331 Ga0070670_100509216 Ga0070670_1005092162 123
7 3300005340 Ga0070689_101412932 Ga0070689_1014129322 123
8 3300005340 Ga0070689_102137167 Ga0070689_1021371671 123
9 3300005354 Ga0070675_100000597 Ga0070675_10000059712 123
10 3300005354 Ga0070675_100661139 Ga0070675_1006611392 123
11 3300005354 Ga0070675_101154088 Ga0070675_1011540882 123
12 3300005355 Ga0070671_100339224 Ga0070671_1003392242 123
13 3300005364 Ga0070673_100213473 Ga0070673_1002134732 123
14 3300005364 Ga0070673_100714719 Ga0070673_1007147192 123
15 3300005365 Ga0070688_100119885 Ga0070688_1001198852 123
16 3300005367 Ga0070667_101997767 Ga0070667_1019977671 123
17 3300005438 Ga0070701_11304419 Ga0070701_113044191 123
18 3300005441 Ga0070700_100329378 Ga0070700_1003293782 123
19 3300005457 Ga0070662_100325074 Ga0070662_1003250742 123
20 3300005518 Ga0070699_100361174 Ga0070699_1003611742 123
21 3300005564 Ga0070664_101247801 Ga0070664_1012478012 123
22 3300005618 Ga0068864_100263218 Ga0068864_1002632182 123
23 3300005719 Ga0068861_100457676 Ga0068861_1004576762 123
24 3300005841 Ga0068863_100078241 Ga0068863_1000782412 123
25 3300005843 Ga0068860_101300764 Ga0068860_1013007641 123
26 3300006237 Ga0097621_100112795 Ga0097621_1001127953 123
27 3300006852 Ga0075433_11611495 Ga0075433_116114952 123
28 3300006871 Ga0075434_101504381 Ga0075434_1015043811 123
29 3300007076 Ga0075435_100171077 Ga0075435_1001710772 123
30 3300009098 Ga0105245_12653273 Ga0105245_126532732 123
31 3300009177 Ga0105248_10457805 Ga0105248_104578053 123
32 3300009177 Ga0105248_10842885 Ga0105248_108428851 123
33 3300009177 Ga0105248_11686993 Ga0105248_116869931 123
34 3300009551 Ga0105238_10234078 Ga0105238_102340782 123
35 3300009553 Ga0105249_11757533 Ga0105249_117575331 123
36 3300011119 Ga0105246_10605110 Ga0105246_106051102 123
37 3300013296 Ga0157374_10878651 Ga0157374_108786512 123
38 3300013306 Ga0163162_10876532 Ga0163162_108765322 123
39 3300013308 Ga0157375_11542735 Ga0157375_115427351 123
40 3300014325 Ga0163163_10761974 Ga0163163_107619742 123
41 3300014325 Ga0163163_12543840 Ga0163163_125438401 123
42 3300014969 Ga0157376_10131384 Ga0157376_101313843 123
43 3300014969 Ga0157376_10350833 Ga0157376_103508332 123
44 3300017792 Ga0163161_10204076 Ga0163161_102040762 123
45 3300017792 Ga0163161_11750664 Ga0163161_117506641 123
46 3300025924 Ga0207694_10816109 Ga0207694_108161092 123
47 3300025926 Ga0207659_10028855 Ga0207659_100288552 123
48 3300025926 Ga0207659_10123823 Ga0207659_101238232 123
49 3300025931 Ga0207644_10301097 Ga0207644_103010972 123
50 3300025937 Ga0207669_10044678 Ga0207669_100446782 123
51 3300025938 Ga0207704_10927879 Ga0207704_109278791 123
52 3300025941 Ga0207711_10451709 Ga0207711_104517091 123
53 3300025942 Ga0207689_11124891 Ga0207689_111248912 123
54 3300025960 Ga0207651_10173314 Ga0207651_101733142 123
55 3300025960 Ga0207651_10236949 Ga0207651_102369492 123
56 3300025961 Ga0207712_10384263 Ga0207712_103842632 123
57 3300025986 Ga0207658_10419353 Ga0207658_104193532 123
58 3300026041 Ga0207639_10703025 Ga0207639_107030252 123
59 3300026088 Ga0207641_10021380 Ga0207641_100213805 123
60 3300026118 Ga0207675_100763115 Ga0207675_1007631152 123
61 3300028381 Ga0268264_10844516 Ga0268264_108445161 123
62 3300046539 Ga0495621_0360024 Ga0495621_0360024_164_538 123
63 3300048907 Ga0496104_0844795 Ga0496104_0844795_283_657 123
64 3300048911 Ga0496108_1553038 Ga0496108_1553038_14_388 123
65 3300049576 Ga0501040_0392805 Ga0501040_0392805_137_520 123
66 3300049577 Ga0501041_0051339 Ga0501041_0051339_1721_2104 123
67 3300049578 Ga0501042_0054886 Ga0501042_0054886_1707_2090 123
68 3300049580 Ga0501046_0122014 Ga0501046_0122014_168_551 123
69 3300049582 Ga0501048_0631695 Ga0501048_0631695_241_624 123
70 3300049584 Ga0501068_0149133 Ga0501068_0149133_182_565 123
71 3300049588 Ga0501072_0122395 Ga0501072_0122395_847_1230 123
72 3300049591 Ga0501075_0143992 Ga0501075_0143992_81_464 123
73 3300049592 Ga0501076_0243165 Ga0501076_0243165_869_1252 123
74 3300049593 Ga0501077_0317595 Ga0501077_0317595_352_735 123
75 3300049741 Ga0501079_0019553 Ga0501079_0019553_1225_1608 123
76 3300049743 Ga0501081_0027332 Ga0501081_0027332_2595_2978 123
77 3300049824 Ga0501045_0015954 Ga0501045_0015954_3675_4058 123
78 3300050511 nmdc:mga08y16_1355447_c1 nmdc:mga08y16_1355447_c1_116_496 123
79 3300050513 nmdc:mga0rr50_728034_c1 nmdc:mga0rr50_728034_c1_335_709 123
80 3300050514 nmdc:mga08x19_1105249_c1 nmdc:mga08x19_1105249_c1_53_427 123
81 3300061734 Ga0530510_0335406 Ga0530510_0335406_664_1050 123
82 3300009011 Ga0105251_10275190 Ga0105251_102751902 124
83 3300005289 Ga0065704_10722619 Ga0065704_107226191 126
84 3300005331 Ga0070670_100752937 Ga0070670_1007529372 126
85 3300005340 Ga0070689_100990203 Ga0070689_1009902031 126
86 3300005354 Ga0070675_100125619 Ga0070675_1001256193 126
87 3300005365 Ga0070688_101707276 Ga0070688_1017072761 126
88 3300005458 Ga0070681_10372410 Ga0070681_103724101 126
89 3300005530 Ga0070679_100290346 Ga0070679_1002903462 126
90 3300005535 Ga0070684_100166520 Ga0070684_1001665203 126
91 3300005564 Ga0070664_100338781 Ga0070664_1003387811 126
92 3300005577 Ga0068857_101553988 Ga0068857_1015539881 126
93 3300005842 Ga0068858_101195184 Ga0068858_1011951841 126
94 3300014745 Ga0157377_10216479 Ga0157377_102164791 126
95 3300025917 Ga0207660_11591494 Ga0207660_115914941 126
96 3300025921 Ga0207652_10763328 Ga0207652_107633282 126
97 3300026035 Ga0207703_10785051 Ga0207703_107850512 126
98 3300026116 Ga0207674_11492528 Ga0207674_114925281 126
99 3300035172 Ga0373955_0643549 Ga0373955_0643549_98_481 126
100 3300035725 Ga0373947_0629528 Ga0373947_0629528_81_464 126
101 3300036401 Ga0373937_0886456 Ga0373937_0886456_259_642 126
102 3300049652 Ga0501202_157397 Ga0501202_157397_149_532 126
103 3300050508 nmdc:mga09592_377385_c1 nmdc:mga09592_377385_c1_789_1169 126
104 3300005293 Ga0065715_10034783 Ga0065715_100347832 127
105 3300005330 Ga0070690_101756313 Ga0070690_1017563131 127
106 3300005335 Ga0070666_10914699 Ga0070666_109146992 127
107 3300005338 Ga0068868_101242646 Ga0068868_1012426462 127
108 3300005340 Ga0070689_101037258 Ga0070689_1010372582 127
109 3300005340 Ga0070689_101905612 Ga0070689_1019056121 127
110 3300005355 Ga0070671_101084085 Ga0070671_1010840851 127
111 3300005356 Ga0070674_100116209 Ga0070674_1001162093 127
112 3300005364 Ga0070673_100146323 Ga0070673_1001463233 127
113 3300005364 Ga0070673_100443401 Ga0070673_1004434012 127
114 3300005364 Ga0070673_100555780 Ga0070673_1005557802 127
115 3300005436 Ga0070713_100142391 Ga0070713_1001423912 127
116 3300005440 Ga0070705_100121728 Ga0070705_1001217281 127
117 3300005456 Ga0070678_100236975 Ga0070678_1002369753 127
118 3300005458 Ga0070681_10295774 Ga0070681_102957741 127
119 3300005459 Ga0068867_100077508 Ga0068867_1000775082 127
120 3300005459 Ga0068867_100219015 Ga0068867_1002190153 127
121 3300005459 Ga0068867_100663253 Ga0068867_1006632531 127
122 3300005467 Ga0070706_101182624 Ga0070706_1011826242 127
123 3300005468 Ga0070707_100082412 Ga0070707_1000824124 127
124 3300005543 Ga0070672_101104395 Ga0070672_1011043951 127
125 3300005548 Ga0070665_100002769 Ga0070665_1000027698 127
126 3300005548 Ga0070665_100326714 Ga0070665_1003267142 127
127 3300005564 Ga0070664_101068081 Ga0070664_1010680811 127
128 3300005578 Ga0068854_100335753 Ga0068854_1003357532 127
129 3300005578 Ga0068854_101681286 Ga0068854_1016812861 127
130 3300005615 Ga0070702_100168624 Ga0070702_1001686242 127
131 3300005616 Ga0068852_102191186 Ga0068852_1021911861 127
132 3300005617 Ga0068859_100191105 Ga0068859_1001911053 127
133 3300005617 Ga0068859_100494249 Ga0068859_1004942492 127
134 3300005618 Ga0068864_102393169 Ga0068864_1023931691 127
135 3300005718 Ga0068866_10242237 Ga0068866_102422372 127
136 3300005840 Ga0068870_10334789 Ga0068870_103347893 127
137 3300005841 Ga0068863_100841725 Ga0068863_1008417251 127
138 3300005842 Ga0068858_100005033 Ga0068858_10000503310 127
139 3300005842 Ga0068858_100148929 Ga0068858_1001489292 127
140 3300005842 Ga0068858_100214068 Ga0068858_1002140682 127
141 3300005842 Ga0068858_100475197 Ga0068858_1004751972 127
142 3300005843 Ga0068860_100613048 Ga0068860_1006130482 127
143 3300006237 Ga0097621_100016199 Ga0097621_1000161995 127
144 3300006237 Ga0097621_100130800 Ga0097621_1001308003 127
145 3300006358 Ga0068871_100023378 Ga0068871_1000233784 127
146 3300006358 Ga0068871_100858381 Ga0068871_1008583811 127
147 3300006844 Ga0075428_100391621 Ga0075428_1003916212 127
148 3300006852 Ga0075433_10668056 Ga0075433_106680562 127
149 3300006871 Ga0075434_100394120 Ga0075434_1003941202 127
150 3300006871 Ga0075434_101026506 Ga0075434_1010265062 127
151 3300006881 Ga0068865_100130009 Ga0068865_1001300092 127
152 3300006881 Ga0068865_100465062 Ga0068865_1004650622 127
153 3300006914 Ga0075436_100750218 Ga0075436_1007502182 127
154 3300006931 Ga0097620_100191098 Ga0097620_1001910983 127
155 3300006931 Ga0097620_100494248 Ga0097620_1004942482 127
156 3300006931 Ga0097620_101277757 Ga0097620_1012777572 127
157 3300007076 Ga0075435_100339773 Ga0075435_1003397733 127
158 3300009094 Ga0111539_10955398 Ga0111539_109553981 127
159 3300009098 Ga0105245_10227856 Ga0105245_102278562 127
160 3300009098 Ga0105245_10870191 Ga0105245_108701912 127
161 3300009098 Ga0105245_12130014 Ga0105245_121300141 127
162 3300009147 Ga0114129_10029025 Ga0114129_100290252 127
163 3300009147 Ga0114129_10040470 Ga0114129_100404703 127
164 3300009176 Ga0105242_10380708 Ga0105242_103807082 127
165 3300009176 Ga0105242_10396034 Ga0105242_103960342 127
166 3300009176 Ga0105242_11032292 Ga0105242_110322922 127
167 3300009176 Ga0105242_11285123 Ga0105242_112851232 127
168 3300009177 Ga0105248_10049791 Ga0105248_100497912 127
169 3300009177 Ga0105248_10108481 Ga0105248_101084812 127
170 3300009177 Ga0105248_10234286 Ga0105248_102342862 127
171 3300009177 Ga0105248_10411152 Ga0105248_104111522 127
172 3300009177 Ga0105248_10705966 Ga0105248_107059662 127
173 3300009177 Ga0105248_10866052 Ga0105248_108660522 127
174 3300009551 Ga0105238_11961278 Ga0105238_119612781 127
175 3300009553 Ga0105249_10488340 Ga0105249_104883402 127
176 3300013296 Ga0157374_11048614 Ga0157374_110486142 127
177 3300013297 Ga0157378_10042101 Ga0157378_100421016 127
178 3300013297 Ga0157378_12332968 Ga0157378_123329682 127
179 3300013306 Ga0163162_10159553 Ga0163162_101595533 127
180 3300013306 Ga0163162_11702798 Ga0163162_117027981 127
181 3300013308 Ga0157375_10120431 Ga0157375_101204312 127
182 3300013308 Ga0157375_11969196 Ga0157375_119691961 127
183 3300014325 Ga0163163_11382071 Ga0163163_113820711 127
184 3300014968 Ga0157379_10016968 Ga0157379_100169685 127
185 3300014968 Ga0157379_10489481 Ga0157379_104894811 127
186 3300021384 Ga0213876_10251089 Ga0213876_102510892 127
187 3300025899 Ga0207642_10588338 Ga0207642_105883382 127
188 3300025903 Ga0207680_10748891 Ga0207680_107488911 127
189 3300025908 Ga0207643_10300407 Ga0207643_103004072 127
190 3300025910 Ga0207684_11069453 Ga0207684_110694532 127
191 3300025912 Ga0207707_10377566 Ga0207707_103775662 127
192 3300025920 Ga0207649_10778542 Ga0207649_107785421 127
193 3300025922 Ga0207646_11023443 Ga0207646_110234432 127
194 3300025927 Ga0207687_10096905 Ga0207687_100969053 127
195 3300025931 Ga0207644_10396893 Ga0207644_103968931 127
196 3300025934 Ga0207686_10166342 Ga0207686_101663423 127
197 3300025934 Ga0207686_10993602 Ga0207686_109936021 127
198 3300025935 Ga0207709_11073985 Ga0207709_110739851 127
199 3300025936 Ga0207670_10539214 Ga0207670_105392142 127
200 3300025937 Ga0207669_10037755 Ga0207669_100377554 127
201 3300025938 Ga0207704_10094381 Ga0207704_100943813 127
202 3300025938 Ga0207704_10825658 Ga0207704_108256582 127
203 3300025940 Ga0207691_10186505 Ga0207691_101865053 127
204 3300025940 Ga0207691_11458797 Ga0207691_114587971 127
205 3300025941 Ga0207711_10016007 Ga0207711_100160073 127
206 3300025941 Ga0207711_10097115 Ga0207711_100971154 127
207 3300025941 Ga0207711_10101008 Ga0207711_101010082 127
208 3300025941 Ga0207711_10356092 Ga0207711_103560922 127
209 3300025941 Ga0207711_10946016 Ga0207711_109460162 127
210 3300025942 Ga0207689_10249341 Ga0207689_102493412 127
211 3300025960 Ga0207651_10050530 Ga0207651_100505304 127
212 3300025960 Ga0207651_10532743 Ga0207651_105327431 127
213 3300025960 Ga0207651_10664946 Ga0207651_106649462 127
214 3300025981 Ga0207640_10039329 Ga0207640_100393292 127
215 3300026023 Ga0207677_10383608 Ga0207677_103836082 127
216 3300026035 Ga0207703_10091498 Ga0207703_100914982 127
217 3300026035 Ga0207703_10117869 Ga0207703_101178692 127
218 3300026035 Ga0207703_10452741 Ga0207703_104527411 127
219 3300026088 Ga0207641_10890978 Ga0207641_108909782 127
220 3300026089 Ga0207648_10020571 Ga0207648_100205718 127
221 3300026089 Ga0207648_10104066 Ga0207648_101040661 127
222 3300026089 Ga0207648_10170681 Ga0207648_101706812 127
223 3300026089 Ga0207648_10266483 Ga0207648_102664832 127
224 3300026089 Ga0207648_10279627 Ga0207648_102796272 127
225 3300026095 Ga0207676_10987819 Ga0207676_109878192 127
226 3300026118 Ga0207675_100387914 Ga0207675_1003879142 127
227 3300026118 Ga0207675_100938679 Ga0207675_1009386791 127
228 3300026121 Ga0207683_10022499 Ga0207683_100224993 127
229 3300027907 Ga0207428_10153839 Ga0207428_101538392 127
230 3300028379 Ga0268266_11290797 Ga0268266_112907972 127
231 3300028380 Ga0268265_10182648 Ga0268265_101826483 127
232 3300028381 Ga0268264_10069148 Ga0268264_100691482 127
233 3300028381 Ga0268264_10168318 Ga0268264_101683183 127
234 3300028381 Ga0268264_10446328 Ga0268264_104463283 127
235 3300031548 Ga0307408_100271747 Ga0307408_1002717471 127
236 3300031852 Ga0307410_10821173 Ga0307410_108211732 127
237 3300032002 Ga0307416_100307384 Ga0307416_1003073842 127
238 3300035117 Ga0373953_0108785 Ga0373953_0108785_590_976 127
239 3300035119 Ga0373956_0317688 Ga0373956_0317688_271_657 127
240 3300036401 Ga0373937_0756915 Ga0373937_0756915_134_520 127
241 3300039437 Ga0436365_1632235 Ga0436365_1632235_66_452 127
242 3300042015 Ga0439462_0080593 Ga0439462_0080593_99_491 127
243 3300046517 Ga0495630_0180880 Ga0495630_0180880_895_1281 127
244 3300046684 Ga0495669_0044559 Ga0495669_0044559_583_969 127
245 3300047319 Ga0495674_0346265 Ga0495674_0346265_653_1039 127
246 3300048904 Ga0496101_0612691 Ga0496101_0612691_110_496 127
247 3300048907 Ga0496104_0115455 Ga0496104_0115455_102_488 127
248 3300048907 Ga0496104_0581242 Ga0496104_0581242_449_835 127
249 3300048908 Ga0496105_0550507 Ga0496105_0550507_497_883 127
250 3300048911 Ga0496108_0869189 Ga0496108_0869189_139_525 127
251 3300048917 Ga0496114_1164613 Ga0496114_1164613_249_635 127
252 3300049661 Ga0501217_336178 Ga0501217_336178_69_455 127
253 3300049668 Ga0501233_054982 Ga0501233_054982_506_892 127
254 3300049779 Ga0501283_035596 Ga0501283_035596_386_772 127
255 3300050507 nmdc:mga05p37_119692_c1 nmdc:mga05p37_119692_c1_864_1259 127
256 3300050507 nmdc:mga05p37_35811_c1 nmdc:mga05p37_35811_c1_2097_2492 127
257 3300050507 nmdc:mga05p37_765185_c1 nmdc:mga05p37_765185_c1_106_501 127
258 3300050508 nmdc:mga09592_57722_c1 nmdc:mga09592_57722_c1_520_915 127
259 3300050510 nmdc:mga06r32_1464235_c1 nmdc:mga06r32_1464235_c1_181_576 127
260 3300050510 nmdc:mga06r32_218290_c1 nmdc:mga06r32_218290_c1_862_1257 127
261 3300050511 nmdc:mga08y16_202724_c1 nmdc:mga08y16_202724_c1_1203_1589 127
262 3300050512 nmdc:mga0n895_159266_c1 nmdc:mga0n895_159266_c1_844_1239 127
263 3300050513 nmdc:mga0rr50_101823_c1 nmdc:mga0rr50_101823_c1_1770_2165 127
264 3300050514 nmdc:mga08x19_853867_c1 nmdc:mga08x19_853867_c1_146_532 127
265 3300050515 nmdc:mga0a205_627357_c1 nmdc:mga0a205_627357_c1_30_425 127
266 3300050515 nmdc:mga0a205_935204_c1 nmdc:mga0a205_935204_c1_243_638 127
267 3300009094 Ga0111539_10084571 Ga0111539_100845714 128
268 3300025933 Ga0207706_10605696 Ga0207706_106056962 128
269 3300027907 Ga0207428_10115049 Ga0207428_101150493 128
270 3300042013 Ga0439456_171478 Ga0439456_171478_51_440 128
271 3300042436 Ga0439435_0010963 Ga0439435_0010963_144_533 128
272 3300049570 Ga0501033_0130815 Ga0501033_0130815_83_472 128
273 3300049572 Ga0501036_0304255 Ga0501036_0304255_463_918 128
274 3300049573 Ga0501037_0066575 Ga0501037_0066575_238_693 128
275 3300049575 Ga0501039_0218252 Ga0501039_0218252_346_801 128
276 3300049576 Ga0501040_0026807 Ga0501040_0026807_3376_3831 128
277 3300049577 Ga0501041_0052713 Ga0501041_0052713_278_733 128
278 3300049578 Ga0501042_0020594 Ga0501042_0020594_1568_2023 128
279 3300049580 Ga0501046_0053854 Ga0501046_0053854_58_447 128
280 3300049582 Ga0501048_0009754 Ga0501048_0009754_6553_7008 128
281 3300049584 Ga0501068_0014418 Ga0501068_0014418_679_1134 128
282 3300049587 Ga0501071_0042141 Ga0501071_0042141_459_914 128
283 3300049588 Ga0501072_0133325 Ga0501072_0133325_1045_1500 128
284 3300049590 Ga0501074_0031400 Ga0501074_0031400_474_929 128
285 3300049591 Ga0501075_0004356 Ga0501075_0004356_191_646 128
286 3300049592 Ga0501076_0018351 Ga0501076_0018351_1143_1598 128
287 3300049741 Ga0501079_0015376 Ga0501079_0015376_5064_5519 128
288 3300049742 Ga0501080_0056506 Ga0501080_0056506_2197_2652 128
289 3300049743 Ga0501081_0133289 Ga0501081_0133289_905_1360 128
290 3300049823 Ga0501044_1600449 Ga0501044_1600449_23_412 128
291 3300049824 Ga0501045_0001950 Ga0501045_0001950_8622_9077 128
292 3300050511 nmdc:mga08y16_45889_c1 nmdc:mga08y16_45889_c1_1443_1832 128
293 3300054114 Ga0501084_0012128 Ga0501084_0012128_321_776 128
294 3300060353 Ga0501082_0005858 Ga0501082_0005858_20_475 128
295 3300061734 Ga0530510_0004221 Ga0530510_0004221_100_489 128
296 3300005290 Ga0065712_10169505 Ga0065712_101695052 129
297 3300005328 Ga0070676_10299363 Ga0070676_102993631 129
298 3300005331 Ga0070670_101192892 Ga0070670_1011928921 129
299 3300005334 Ga0068869_100509374 Ga0068869_1005093742 129
300 3300005335 Ga0070666_10023898 Ga0070666_100238983 129
301 3300005340 Ga0070689_100411496 Ga0070689_1004114961 129
302 3300005347 Ga0070668_100518663 Ga0070668_1005186631 129
303 3300005353 Ga0070669_100066741 Ga0070669_1000667413 129
304 3300005355 Ga0070671_101749842 Ga0070671_1017498421 129
305 3300005456 Ga0070678_100585440 Ga0070678_1005854401 129
306 3300005457 Ga0070662_100015838 Ga0070662_1000158383 129
307 3300005459 Ga0068867_100142894 Ga0068867_1001428942 129
308 3300005544 Ga0070686_100536849 Ga0070686_1005368491 129
309 3300005577 Ga0068857_100890724 Ga0068857_1008907241 129
310 3300005718 Ga0068866_10157579 Ga0068866_101575792 129
311 3300005719 Ga0068861_100339674 Ga0068861_1003396742 129
312 3300005840 Ga0068870_10366467 Ga0068870_103664672 129
313 3300005844 Ga0068862_101263324 Ga0068862_1012633241 129
314 3300006058 Ga0075432_10213305 Ga0075432_102133051 129
315 3300006844 Ga0075428_100647313 Ga0075428_1006473132 129
316 3300013297 Ga0157378_10232554 Ga0157378_102325542 129
317 3300013306 Ga0163162_10965835 Ga0163162_109658351 129
318 3300013308 Ga0157375_10337996 Ga0157375_103379962 129
319 3300014326 Ga0157380_11261525 Ga0157380_112615252 129
320 3300025901 Ga0207688_10098617 Ga0207688_100986172 129
321 3300025903 Ga0207680_10034512 Ga0207680_100345122 129
322 3300025925 Ga0207650_10505507 Ga0207650_105055071 129
323 3300025926 Ga0207659_10201658 Ga0207659_102016581 129
324 3300025931 Ga0207644_10994477 Ga0207644_109944772 129
325 3300025933 Ga0207706_10017124 Ga0207706_100171244 129
326 3300026075 Ga0207708_10016682 Ga0207708_100166825 129
327 3300026116 Ga0207674_10140214 Ga0207674_101402142 129
328 3300026118 Ga0207675_100141811 Ga0207675_1001418113 129
329 3300027876 Ga0209974_10242987 Ga0209974_102429871 129
330 3300027907 Ga0207428_10224640 Ga0207428_102246402 129
331 3300046558 Ga0495633_0115679 Ga0495633_0115679_20_412 129
332 3300046684 Ga0495669_0642753 Ga0495669_0642753_71_463 129
333 3300050511 nmdc:mga08y16_282138_c1 nmdc:mga08y16_282138_c1_103_495 129
334 3300005466 Ga0070685_10866554 Ga0070685_108665541 130
335 3300009147 Ga0114129_13295759 Ga0114129_132957591 130
336 3300025981 Ga0207640_10416926 Ga0207640_104169263 130
337 3300031852 Ga0307410_10540907 Ga0307410_105409072 130
338 3300031903 Ga0307407_10372131 Ga0307407_103721312 130
339 3300031995 Ga0307409_100402497 Ga0307409_1004024971 130
340 3300031995 Ga0307409_100526426 Ga0307409_1005264262 130
341 3300032002 Ga0307416_100365946 Ga0307416_1003659462 130
342 3300032004 Ga0307414_10359227 Ga0307414_103592272 130
343 3300032005 Ga0307411_10028078 Ga0307411_100280784 130
344 3300032005 Ga0307411_10091093 Ga0307411_100910933 130
345 3300046558 Ga0495633_0119324 Ga0495633_0119324_206_604 130
346 3300049668 Ga0501233_201291 Ga0501233_201291_146_544 130
347 3300049705 Ga0501225_0358755 Ga0501225_0358755_14_412 130
348 3300049743 Ga0501081_0805460 Ga0501081_0805460_273_671 130
349 2162886012 MBSR1b_contig_13859647 MBSR1b_0017.00002490 131
350 3300005288 Ga0065714_10226877 Ga0065714_102268772 131
351 3300005290 Ga0065712_10136814 Ga0065712_101368142 131
352 3300005295 Ga0065707_10699135 Ga0065707_106991351 131
353 3300005331 Ga0070670_100000974 Ga0070670_1000009742 131
354 3300005353 Ga0070669_100172554 Ga0070669_1001725541 131
355 3300005354 Ga0070675_100049437 Ga0070675_1000494373 131
356 3300005355 Ga0070671_100670391 Ga0070671_1006703912 131
357 3300005365 Ga0070688_100089424 Ga0070688_1000894242 131
358 3300005457 Ga0070662_101457453 Ga0070662_1014574531 131
359 3300005459 Ga0068867_100798921 Ga0068867_1007989211 131
360 3300005468 Ga0070707_101537655 Ga0070707_1015376552 131
361 3300005471 Ga0070698_100753427 Ga0070698_1007534271 131
362 3300005518 Ga0070699_100386230 Ga0070699_1003862302 131
363 3300005543 Ga0070672_100030154 Ga0070672_1000301542 131
364 3300005564 Ga0070664_100025669 Ga0070664_1000256692 131
365 3300005617 Ga0068859_100061348 Ga0068859_1000613485 131
366 3300005618 Ga0068864_100025999 Ga0068864_1000259995 131
367 3300005840 Ga0068870_10457830 Ga0068870_104578302 131
368 3300005842 Ga0068858_100192394 Ga0068858_1001923941 131
369 3300005844 Ga0068862_101126487 Ga0068862_1011264871 131
370 3300006880 Ga0075429_100755565 Ga0075429_1007555652 131
371 3300006931 Ga0097620_100061351 Ga0097620_1000613515 131
372 3300009553 Ga0105249_13268563 Ga0105249_132685632 131
373 3300014325 Ga0163163_10034296 Ga0163163_100342963 131
374 3300014326 Ga0157380_11629795 Ga0157380_116297951 131
375 3300014968 Ga0157379_11853616 Ga0157379_118536162 131
376 3300025315 Ga0207697_10029325 Ga0207697_100293253 131
377 3300025917 Ga0207660_11132360 Ga0207660_111323602 131
378 3300025922 Ga0207646_11670915 Ga0207646_116709151 131
379 3300025923 Ga0207681_10037922 Ga0207681_100379222 131
380 3300025925 Ga0207650_10004403 Ga0207650_100044037 131
381 3300025940 Ga0207691_10017637 Ga0207691_100176375 131
382 3300025945 Ga0207679_10125394 Ga0207679_101253943 131
383 3300026035 Ga0207703_10244766 Ga0207703_102447661 131
384 3300026088 Ga0207641_10432815 Ga0207641_104328151 131
385 3300026089 Ga0207648_10721158 Ga0207648_107211582 131
386 3300026095 Ga0207676_10343355 Ga0207676_103433552 131
387 3300050511 nmdc:mga08y16_1230284_c1 nmdc:mga08y16_1230284_c1_215_613 131
388 3300050511 nmdc:mga08y16_1659_c1 nmdc:mga08y16_1659_c1_19838_20287 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

20

122

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k5n-assembly1.cif.gz_A crystal structure of e.coli pol ii-abasic dna binary complex 0.7885 36 72
1l1o-assembly1.cif.gz_E structure of the human replication protein a (rpa) trimerization core 0.7597 35 115
2pqa-assembly1.cif.gz_A crystal structure of full-length human rpa 14/32 heterodimer 0.7508 34 115
3k59-assembly1.cif.gz_A crystal structure of e.coli pol ii-normal dna-dctp ternary complex 0.7436 34 74
6knc-assembly1.cif.gz_A pold-pcna-dna (form b) 0.7386 35 113
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.841 42 69 2.30.29.30
af_Q3E8Y7_122_291_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8243 41 71 2.120.10.80
af_Q58135_115_168_3.10.450.750 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7867 42 73 3.10.450.750
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7835 36 95 2.40.50.140
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7759 34 116 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A524HRQ9-F1-model_v4 Uncharacterized protein 0.9718 30 124
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9686 30 122
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.9678 30 124
AF-A0A6I4SV82-F1-model_v4 Uncharacterized protein 0.9672 30 123
AF-A0A2V9CMA3-F1-model_v4 Uncharacterized protein 0.9657 40 124

Feature Viewer

pLDDT pTM Quality
82.79 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map