F430995

General Info

Members Datasets Scaffolds Average Seq Length
388 192 776 398

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10006784|JGI25406J46586_100067845
Length 432
Sequence MTASDFAHRAVADGVRTGTDAGLAAFDSAARKAIATCRRLATFSDEPVFTTRTFLSEAARAVLDDLRGWMARLGMDTRIDAAGNLRGVYEGTSADRPHLLIGSHLDTVPHAGAFDGVLGVVLGIALIETLEGRRFPFAIEVVGFSEEEGVRFGVPFIGSRALVGTLDETLLQQRDAEGHSVAEALRTFGLQPSHLEQARVANAVGYLELHIEQGPVLDTLDAPLGVVSAIVGQTRADVVFAGQAAHAGTTPMAMRRDALAAAAEWITSVESSARGVEGLVATVGRLDVEPGASNVVAGRSRASLDVRHARDEVRRELSDSLRRRAGEIASRRRVEAEWIMKVDQPSVTMDARLTSLLARAVESSGAAVHLMASGAGHDAMIMASSVPAAMLFVRSPGGVSHHPDETVNQADVAAALKATLQFLEDLAVAVDG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.77
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006784 3300003203 Bacteria 5260
2 Ga0065707_10001326 3300005295 Bacteria 9951
3 Ga0065707_10096618 3300005295 Unclassified 3250
4 Ga0070658_10128087 3300005327 Bacteria 2114
5 Ga0070683_100019709 3300005329 Bacteria 5994
6 Ga0070683_100033363 3300005329 Unclassified 4694
7 Ga0070690_100071908 3300005330 Bacteria 2248
8 Ga0070670_100009439 3300005331 Bacteria 8329
9 Ga0068869_100020167 3300005334 Bacteria 4567
10 Ga0070666_10003858 3300005335 Bacteria 9098
11 Ga0070666_10196044 3300005335 Bacteria 1420
12 Ga0068868_100036216 3300005338 Bacteria 3818
13 Ga0070661_100103938 3300005344 Bacteria 2116
14 Ga0070692_10027398 3300005345 Unclassified 2824
15 Ga0070669_100065635 3300005353 Bacteria 2674
16 Ga0070675_100000753 3300005354 Bacteria 22577
17 Ga0070675_100004662 3300005354 Bacteria 10470
18 Ga0070675_100017183 3300005354 Bacteria 5750
19 Ga0070675_100055395 3300005354 Bacteria 3264
20 Ga0070671_100028375 3300005355 Unclassified 4608
21 Ga0070671_100114741 3300005355 Unclassified 2264
22 Ga0070659_100083629 3300005366 Bacteria 2551
23 Ga0070713_100005154 3300005436 Bacteria 8900
24 Ga0070713_100043276 3300005436 Unclassified 3681
25 Ga0070713_100160138 3300005436 Unclassified 2008
26 Ga0070701_10053083 3300005438 Bacteria 2108
27 Ga0070705_100026786 3300005440 Bacteria 3141
28 Ga0070700_100098206 3300005441 Bacteria 1925
29 Ga0070694_100000987 3300005444 Bacteria 16164
30 Ga0070694_100013672 3300005444 Bacteria 5072
31 Ga0070678_100072668 3300005456 Bacteria 2579
32 Ga0070662_100128618 3300005457 Unclassified 1950
33 Ga0070681_10098085 3300005458 Bacteria 2876
34 Ga0068867_100003360 3300005459 Bacteria 11269
35 Ga0068867_100103653 3300005459 Bacteria 2176
36 Ga0070706_100022840 3300005467 Bacteria 5761
37 Ga0070698_100021413 3300005471 Bacteria 6771
38 Ga0070698_100035612 3300005471 Bacteria 5145
39 Ga0070698_100100701 3300005471 Bacteria 2862
40 Ga0070699_100002049 3300005518 Bacteria 18217
41 Ga0070699_100012040 3300005518 Bacteria 7468
42 Ga0070684_100007782 3300005535 Bacteria 8357
43 Ga0070684_100113922 3300005535 Bacteria 2427
44 Ga0070672_100032201 3300005543 Bacteria 3955
45 Ga0070672_100076740 3300005543 Unclassified 2670
46 Ga0070672_100125480 3300005543 Bacteria 2105
47 Ga0070695_100000400 3300005545 Bacteria 22435
48 Ga0070696_100001013 3300005546 Bacteria 18213
49 Ga0070696_100005998 3300005546 Bacteria 8111
50 Ga0070665_100044497 3300005548 Unclassified 4458
51 Ga0070704_100004947 3300005549 Bacteria 7735
52 Ga0070704_100043313 3300005549 Unclassified 3120
53 Ga0070704_100052909 3300005549 Bacteria 2867
54 Ga0068855_100023326 3300005563 Bacteria 7410
55 Ga0068855_100051190 3300005563 Bacteria 4865
56 Ga0068857_100001045 3300005577 Bacteria 21421
57 Ga0068856_100024534 3300005614 Bacteria 5871
58 Ga0068856_100164907 3300005614 Bacteria 2227
59 Ga0068859_100024367 3300005617 Bacteria 6071
60 Ga0068859_100095920 3300005617 Bacteria 3019
61 Ga0068859_100334302 3300005617 Unclassified 1609
62 Ga0068864_100004741 3300005618 Bacteria 11136
63 Ga0068864_100033457 3300005618 Bacteria 4370
64 Ga0068864_100091413 3300005618 Bacteria 2685
65 Ga0068861_100135292 3300005719 Bacteria 2005
66 Ga0068870_10000958 3300005840 Bacteria 11339
67 Ga0068863_100022055 3300005841 Bacteria 6081
68 Ga0068863_100035063 3300005841 Bacteria 4779
69 Ga0068863_100053505 3300005841 Bacteria 3827
70 Ga0068858_100005875 3300005842 Bacteria 11983
71 Ga0068858_100012135 3300005842 Bacteria 8123
72 Ga0068858_100036934 3300005842 Bacteria 4529
73 Ga0068858_100062295 3300005842 Bacteria 3449
74 Ga0068858_100113913 3300005842 Unclassified 2526
75 Ga0068858_100120114 3300005842 Unclassified 2457
76 Ga0068858_100129820 3300005842 Bacteria 2362
77 Ga0068860_100007203 3300005843 Bacteria 11120
78 Ga0068860_100007872 3300005843 Bacteria 10639
79 Ga0068860_100159884 3300005843 Bacteria 2172
80 Ga0068862_100010263 3300005844 Bacteria 7728
81 Ga0081539_10000190 3300005985 Bacteria 142511
82 Ga0081539_10002496 3300005985 Bacteria 25819
83 Ga0081539_10003234 3300005985 Bacteria 20533
84 Ga0081539_10068648 3300005985 Unclassified 1911
85 Ga0097621_100002738 3300006237 Bacteria 12061
86 Ga0097621_100030505 3300006237 Unclassified 4269
87 Ga0097621_100080672 3300006237 Bacteria 2707
88 Ga0068871_100007940 3300006358 Bacteria 7609
89 Ga0068871_100090588 3300006358 Bacteria 2547
90 Ga0068871_100164411 3300006358 Bacteria 1899
91 Ga0075428_100001600 3300006844 Bacteria 24218
92 Ga0075428_100043407 3300006844 Bacteria 4942
93 Ga0075428_100155466 3300006844 Unclassified 2485
94 Ga0075430_100021918 3300006846 Bacteria 5429
95 Ga0075431_100008497 3300006847 Bacteria 10279
96 Ga0075431_100028918 3300006847 Bacteria 5699
97 Ga0075431_100051603 3300006847 Bacteria 4241
98 Ga0075431_100110842 3300006847 Bacteria 2832
99 Ga0075433_10038968 3300006852 Bacteria 4107
100 Ga0075433_10106481 3300006852 Unclassified 2485
101 Ga0075434_100167148 3300006871 Bacteria 2220
102 Ga0075429_100107427 3300006880 Bacteria 2439
103 Ga0068865_100028831 3300006881 Bacteria 3678
104 Ga0068865_100199604 3300006881 Bacteria 1552
105 Ga0097620_100024367 3300006931 Bacteria 6071
106 Ga0097620_100095923 3300006931 Bacteria 3019
107 Ga0097620_100334250 3300006931 Unclassified 1609
108 Ga0075435_100016334 3300007076 Bacteria 5596
109 Ga0075435_100033899 3300007076 Bacteria 4041
110 Ga0075435_100126396 3300007076 Bacteria 2137
111 Ga0099795_10013001 3300007788 Bacteria 2542
112 Ga0111539_10000538 3300009094 Bacteria 48180
113 Ga0111539_10029393 3300009094 Bacteria 6693
114 Ga0111539_10037152 3300009094 Bacteria 5883
115 Ga0111539_10074631 3300009094 Bacteria 3996
116 Ga0111539_10153119 3300009094 Bacteria 2699
117 Ga0105245_10001010 3300009098 Bacteria 25528
118 Ga0105245_10002657 3300009098 Bacteria 16090
119 Ga0105245_10020366 3300009098 Bacteria 5817
120 Ga0105245_10025163 3300009098 Bacteria 5234
121 Ga0105245_10138767 3300009098 Unclassified 2288
122 Ga0105247_10102709 3300009101 Bacteria 1829
123 Ga0114129_10003782 3300009147 Bacteria 21339
124 Ga0114129_10004240 3300009147 Bacteria 20251
125 Ga0114129_10015336 3300009147 Bacteria 10903
126 Ga0114129_10034807 3300009147 Bacteria 7116
127 Ga0114129_10054616 3300009147 Bacteria 5600
128 Ga0114129_10081719 3300009147 Bacteria 4491
129 Ga0114129_10111733 3300009147 Bacteria 3770
130 Ga0114129_10466261 3300009147 Bacteria 1655
131 Ga0105243_10015341 3300009148 Bacteria 5796
132 Ga0105243_10021732 3300009148 Bacteria 4872
133 Ga0105243_10026923 3300009148 Bacteria 4404
134 Ga0105241_10009329 3300009174 Bacteria 7212
135 Ga0105242_10001360 3300009176 Bacteria 19285
136 Ga0105242_10064783 3300009176 Bacteria 3013
137 Ga0105242_10067945 3300009176 Bacteria 2948
138 Ga0105242_10068846 3300009176 Unclassified 2930
139 Ga0105248_10015001 3300009177 Bacteria 8531
140 Ga0105248_10036773 3300009177 Bacteria 5475
141 Ga0105248_10043737 3300009177 Bacteria 5023
142 Ga0105248_10059006 3300009177 Bacteria 4310
143 Ga0105248_10210718 3300009177 Bacteria 2189
144 Ga0105237_10014825 3300009545 Bacteria 8134
145 Ga0105237_10018165 3300009545 Bacteria 7281
146 Ga0105237_10059146 3300009545 Bacteria 3834
147 Ga0105238_10016452 3300009551 Bacteria 7487
148 Ga0105238_10059873 3300009551 Unclassified 3814
149 Ga0105238_10087657 3300009551 Bacteria 3099
150 Ga0105238_10095546 3300009551 Bacteria 2959
151 Ga0105238_10104161 3300009551 Bacteria 2818
152 Ga0105249_10020798 3300009553 Bacteria 5868
153 Ga0105239_10023144 3300010375 Bacteria 6847
154 Ga0105239_10024872 3300010375 Bacteria 6595
155 Ga0105239_10033429 3300010375 Bacteria 5648
156 Ga0105239_10101701 3300010375 Bacteria 3179
157 Ga0157370_10219458 3300013104 Bacteria 1761
158 Ga0157369_10096996 3300013105 Bacteria 3145
159 Ga0157374_10005876 3300013296 Bacteria 10367
160 Ga0157374_10006789 3300013296 Bacteria 9730
161 Ga0157374_10074049 3300013296 Unclassified 3215
162 Ga0157378_10060036 3300013297 Bacteria 3393
163 Ga0163162_10002784 3300013306 Bacteria 16620
164 Ga0163162_10019597 3300013306 Bacteria 6639
165 Ga0157372_10113920 3300013307 Bacteria 3100
166 Ga0157375_10037961 3300013308 Bacteria 4621
167 Ga0157375_10074987 3300013308 Bacteria 3406
168 Ga0157375_10119444 3300013308 Bacteria 2744
169 Ga0157375_10275380 3300013308 Bacteria 1845
170 Ga0163163_10005643 3300014325 Bacteria 10845
171 Ga0163163_10027803 3300014325 Bacteria 5423
172 Ga0163163_10060695 3300014325 Bacteria 3745
173 Ga0163163_10084657 3300014325 Bacteria 3177
174 Ga0163163_10120969 3300014325 Bacteria 2652
175 Ga0163163_10121128 3300014325 Bacteria 2650
176 Ga0163163_10146504 3300014325 Bacteria 2405
177 Ga0157380_10013689 3300014326 Bacteria 5922
178 Ga0157380_10088199 3300014326 Bacteria 2552
179 Ga0157379_10078046 3300014968 Unclassified 2966
180 Ga0157379_10116606 3300014968 Unclassified 2402
181 Ga0157379_10119631 3300014968 Bacteria 2369
182 Ga0157379_10136695 3300014968 Bacteria 2208
183 Ga0157379_10244175 3300014968 Bacteria 1629
184 Ga0157376_10015573 3300014969 Bacteria 5749
185 Ga0157376_10112911 3300014969 Bacteria 2395
186 Ga0157376_10161989 3300014969 Bacteria 2029
187 Ga0157376_10224685 3300014969 Bacteria 1741
188 Ga0213875_10016616 3300021388 Bacteria 3566
189 Ga0207680_10019866 3300025903 Bacteria 3603
190 Ga0207643_10002708 3300025908 Bacteria 9579
191 Ga0207643_10012657 3300025908 Bacteria 4557
192 Ga0207654_10014833 3300025911 Unclassified 4034
193 Ga0207707_10030051 3300025912 Bacteria 4751
194 Ga0207671_10025366 3300025914 Bacteria 4453
195 Ga0207681_10007835 3300025923 Bacteria 6540
196 Ga0207681_10056050 3300025923 Bacteria 2687
197 Ga0207681_10136321 3300025923 Bacteria 1822
198 Ga0207694_10005023 3300025924 Bacteria 10235
199 Ga0207694_10020003 3300025924 Bacteria 5063
200 Ga0207694_10184431 3300025924 Bacteria 1693
201 Ga0207650_10099407 3300025925 Bacteria 2237
202 Ga0207650_10111815 3300025925 Unclassified 2115
203 Ga0207659_10006683 3300025926 Bacteria 7083
204 Ga0207659_10067307 3300025926 Bacteria 2601
205 Ga0207687_10001674 3300025927 Bacteria 15301
206 Ga0207687_10004772 3300025927 Bacteria 9017
207 Ga0207687_10018134 3300025927 Unclassified 4644
208 Ga0207687_10043162 3300025927 Bacteria 3106
209 Ga0207700_10015509 3300025928 Bacteria 5030
210 Ga0207700_10072786 3300025928 Bacteria 2652
211 Ga0207700_10095736 3300025928 Unclassified 2355
212 Ga0207644_10077932 3300025931 Bacteria 2442
213 Ga0207644_10141376 3300025931 Bacteria 1854
214 Ga0207690_10060656 3300025932 Bacteria 2568
215 Ga0207686_10017421 3300025934 Unclassified 4049
216 Ga0207686_10042506 3300025934 Unclassified 2779
217 Ga0207686_10067943 3300025934 Bacteria 2282
218 Ga0207709_10033961 3300025935 Bacteria 3001
219 Ga0207709_10100715 3300025935 Bacteria 1909
220 Ga0207670_10003662 3300025936 Bacteria 8150
221 Ga0207669_10025124 3300025937 Unclassified 3213
222 Ga0207704_10029933 3300025938 Bacteria 3045
223 Ga0207704_10173974 3300025938 Bacteria 1548
224 Ga0207691_10045603 3300025940 Bacteria 4029
225 Ga0207691_10058522 3300025940 Unclassified 3505
226 Ga0207691_10139835 3300025940 Bacteria 2134
227 Ga0207711_10000490 3300025941 Bacteria 40819
228 Ga0207711_10006471 3300025941 Bacteria 9859
229 Ga0207711_10089465 3300025941 Bacteria 2705
230 Ga0207711_10124648 3300025941 Bacteria 2303
231 Ga0207689_10012614 3300025942 Bacteria 7219
232 Ga0207689_10067525 3300025942 Bacteria 2938
233 Ga0207661_10016818 3300025944 Bacteria 5400
234 Ga0207661_10031830 3300025944 Bacteria 4080
235 Ga0207667_10050240 3300025949 Unclassified 4400
236 Ga0207651_10004043 3300025960 Bacteria 7303
237 Ga0207651_10025797 3300025960 Bacteria 3659
238 Ga0207668_10049983 3300025972 Unclassified 2878
239 Ga0207677_10015377 3300026023 Bacteria 4500
240 Ga0207677_10040906 3300026023 Bacteria 3061
241 Ga0207703_10014548 3300026035 Bacteria 6139
242 Ga0207703_10050437 3300026035 Bacteria 3368
243 Ga0207703_10058623 3300026035 Unclassified 3143
244 Ga0207703_10099008 3300026035 Unclassified 2467
245 Ga0207708_10036666 3300026075 Bacteria 3734
246 Ga0207708_10103303 3300026075 Bacteria 2207
247 Ga0207702_10213553 3300026078 Unclassified 1795
248 Ga0207641_10004685 3300026088 Bacteria 11794
249 Ga0207641_10019965 3300026088 Bacteria 5500
250 Ga0207641_10026910 3300026088 Bacteria 4749
251 Ga0207641_10152907 3300026088 Bacteria 2091
252 Ga0207641_10226404 3300026088 Bacteria 1736
253 Ga0207648_10006065 3300026089 Bacteria 12050
254 Ga0207648_10059984 3300026089 Bacteria 3318
255 Ga0207676_10006922 3300026095 Bacteria 8035
256 Ga0207676_10014241 3300026095 Bacteria 5716
257 Ga0207674_10003344 3300026116 Bacteria 19689
258 Ga0207674_10009778 3300026116 Bacteria 10924
259 Ga0207674_10056504 3300026116 Bacteria 3985
260 Ga0207675_100020997 3300026118 Bacteria 6087
261 Ga0207675_100082548 3300026118 Bacteria 3014
262 Ga0207698_10151806 3300026142 Bacteria 2012
263 Ga0207428_10000413 3300027907 Bacteria 53087
264 Ga0207428_10011530 3300027907 Bacteria 7807
265 Ga0265357_1000226 3300028023 Bacteria 2766
266 Ga0268266_10002600 3300028379 Bacteria 19128
267 Ga0268266_10054980 3300028379 Bacteria 3421
268 Ga0268265_10187848 3300028380 Bacteria 1781
269 Ga0268264_10064703 3300028381 Bacteria 3078
270 Ga0268264_10121625 3300028381 Unclassified 2301
271 Ga0265318_10033665 3300028577 Bacteria 1977
272 Ga0265336_10009077 3300028666 Bacteria 3453
273 Ga0265338_10001153 3300028800 Bacteria 43711
274 Ga0265330_10000369 3300031235 Bacteria 31708
275 Ga0265330_10000604 3300031235 Bacteria 23312
276 Ga0265328_10002233 3300031239 Bacteria 8731
277 Ga0265320_10044867 3300031240 Bacteria 2175
278 Ga0265325_10000130 3300031241 Bacteria 51864
279 Ga0265325_10051527 3300031241 Bacteria 2116
280 Ga0265325_10073503 3300031241 Bacteria 1711
281 Ga0265325_10077507 3300031241 Unclassified 1657
282 Ga0265340_10023742 3300031247 Bacteria 3124
283 Ga0265340_10051545 3300031247 Bacteria 1992
284 Ga0265339_10043070 3300031249 Bacteria 2498
285 Ga0265339_10046153 3300031249 Bacteria 2396
286 Ga0265331_10015934 3300031250 Bacteria 3957
287 Ga0265331_10018869 3300031250 Bacteria 3566
288 Ga0265316_10000737 3300031344 Bacteria 36149
289 Ga0265316_10107912 3300031344 Bacteria 2111
290 Ga0265313_10000616 3300031595 Bacteria 36914
291 Ga0265313_10009029 3300031595 Bacteria 6535
292 Ga0265314_10000656 3300031711 Bacteria 42378
293 Ga0265314_10001387 3300031711 Bacteria 27158
294 Ga0265314_10003138 3300031711 Bacteria 16218
295 Ga0265314_10003198 3300031711 Bacteria 16041
296 Ga0265314_10018427 3300031711 Bacteria 5443
297 Ga0265342_10000269 3300031712 Bacteria 58369
298 Ga0265342_10007107 3300031712 Bacteria 8244
299 Ga0265342_10008761 3300031712 Bacteria 7216
300 Ga0307407_10040122 3300031903 Bacteria 2608
301 Ga0307510_10041580 3300033180 Bacteria 5022
302 Ga0373934_0001813 3300035086 Bacteria 7844
303 Ga0373923_0017762 3300035111 Bacteria 2726
304 Ga0373939_0024947 3300035114 Bacteria 1671
305 Ga0373954_0009167 3300035118 Bacteria 4353
306 Ga0373955_0155088 3300035172 Bacteria 1349
307 Ga0373931_0062670 3300035691 Bacteria 2008
308 Ga0373927_0134910 3300035695 Bacteria 1613
309 Ga0373937_0002446 3300036401 Bacteria 15426
310 Ga0373925_0232744 3300037068 Bacteria 1474
311 Ga0436364_0092195 3300037853 Bacteria 6760
312 Ga0436364_0148563 3300037853 Bacteria 7315
313 Ga0436364_1393410 3300037853 Bacteria 1525
314 Ga0436365_1459202 3300039437 Bacteria 4955
315 Ga0451853_2794969 3300041512 Bacteria 2518
316 Ga0451577_0077162 3300042876 Bacteria 2971
317 Ga0466966_0044799 3300044684 Unclassified 2831
318 Ga0451576_0282989 3300045051 Bacteria 1734
319 Ga0495638_0127189 3300046460 Bacteria 1501
320 Ga0495653_0106683 3300046463 Bacteria 2020
321 Ga0495650_0001650 3300046471 Bacteria 20636
322 Ga0495580_0005462 3300046472 Bacteria 10506
323 Ga0495580_0008737 3300046472 Bacteria 8026
324 Ga0495580_0033366 3300046472 Bacteria 3710
325 Ga0495580_0069123 3300046472 Bacteria 2468
326 Ga0495664_0158476 3300046477 Bacteria 1373
327 Ga0495594_0094631 3300046499 Bacteria 1677
328 Ga0495643_0001528 3300046522 Bacteria 20803
329 Ga0495666_0039408 3300046526 Bacteria 2294
330 Ga0495642_0021671 3300046528 Bacteria 2528
331 Ga0495587_0003818 3300046536 Bacteria 9996
332 Ga0495587_0012121 3300046536 Bacteria 5443
333 Ga0495598_0003194 3300046537 Unclassified 3456
334 Ga0495621_0010044 3300046539 Bacteria 2889
335 Ga0495621_0010967 3300046539 Unclassified 2788
336 Ga0495621_0024620 3300046539 Bacteria 2013
337 Ga0495621_0048250 3300046539 Bacteria 1516
338 Ga0495645_0033106 3300046543 Bacteria 3770
339 Ga0495667_0038700 3300046559 Bacteria 3175
340 Ga0495667_0050611 3300046559 Bacteria 2742
341 Ga0495656_0075071 3300046615 Bacteria 1512
342 Ga0495656_0105277 3300046615 Bacteria 1311
343 Ga0495635_0049311 3300046663 Bacteria 2902
344 Ga0495659_0001932 3300046664 Bacteria 6829
345 Ga0495659_0012897 3300046664 Bacteria 2715
346 Ga0495599_0050357 3300046678 Bacteria 2610
347 Ga0495623_0062723 3300046679 Bacteria 2329
348 Ga0495669_0085714 3300046684 Bacteria 1450
349 Ga0495604_0031669 3300047317 Unclassified 4195
350 Ga0495604_0135716 3300047317 Bacteria 1763
351 Ga0495636_0009207 3300047318 Bacteria 3886
352 Ga0495674_0014290 3300047319 Bacteria 7433
353 Ga0495680_0137857 3300047322 Bacteria 1787
354 Ga0495675_0005537 3300047444 Bacteria 7702
355 Ga0495677_0024161 3300047445 Bacteria 2205
356 Ga0495684_0027595 3300047471 Bacteria 4359
357 Ga0495684_0031911 3300047471 Bacteria 4044
358 Ga0495602_0013475 3300048088 Bacteria 8356
359 Ga0495602_0051186 3300048088 Bacteria 3681
360 Ga0496103_0079284 3300048906 Unclassified 2063
361 Ga0496104_0118585 3300048907 Bacteria 2541
362 Ga0496114_0240090 3300048917 Unclassified 1593
363 Ga0496126_0000100 3300048929 Bacteria 203706
364 nmdc:mga05p37_122804_c1 3300050507 Bacteria 3190
365 nmdc:mga05p37_17498_c1 3300050507 Bacteria 8652
366 nmdc:mga05p37_224503_c1 3300050507 Bacteria 2265
367 nmdc:mga05p37_278967_c1 3300050507 Bacteria 1994
368 nmdc:mga05p37_3161_c1 3300050507 Bacteria 19166
369 nmdc:mga05p37_53310_c1 3300050507 Bacteria 4974
370 nmdc:mga09592_151849_c1 3300050508 Bacteria 1998
371 nmdc:mga09592_236990_c1 3300050508 Bacteria 1581
372 nmdc:mga09592_245409_c1 3300050508 Bacteria 1552
373 nmdc:mga0qj67_16744_c1 3300050509 Bacteria 5566
374 nmdc:mga0qj67_86797_c1 3300050509 Bacteria 2511
375 nmdc:mga06r32_147775_c1 3300050510 Bacteria 2328
376 nmdc:mga06r32_57473_c1 3300050510 Bacteria 3737
377 nmdc:mga06r32_71912_c1 3300050510 Bacteria 3348
378 nmdc:mga08y16_2135_c1 3300050511 Bacteria 20269
379 nmdc:mga08y16_52791_c1 3300050511 Bacteria 4252
380 nmdc:mga08y16_82257_c1 3300050511 Unclassified 3357
381 nmdc:mga0n895_160747_c1 3300050512 Unclassified 2278
382 nmdc:mga0n895_88509_c1 3300050512 Bacteria 3096
383 nmdc:mga0rr50_57811_c1 3300050513 Bacteria 2903
384 nmdc:mga0rr50_64544_c1 3300050513 Bacteria 2770
385 nmdc:mga0rr50_86570_c1 3300050513 Bacteria 2431
386 nmdc:mga0a205_1155_c1 3300050515 Bacteria 21970
387 nmdc:mga0a205_576_c1 3300050515 Bacteria 29062
388 nmdc:mga0a205_61973_c1 3300050515 Bacteria 3614
389 JGI25406J46586_10006784
390 Ga0065707_10001326
391 Ga0065707_10096618
392 Ga0070658_10128087
393 Ga0070683_100019709
394 Ga0070683_100033363
395 Ga0070690_100071908
396 Ga0070670_100009439
397 Ga0068869_100020167
398 Ga0070666_10003858
399 Ga0070666_10196044
400 Ga0068868_100036216
401 Ga0070661_100103938
402 Ga0070692_10027398
403 Ga0070669_100065635
404 Ga0070675_100000753
405 Ga0070675_100004662
406 Ga0070675_100017183
407 Ga0070675_100055395
408 Ga0070671_100028375
409 Ga0070671_100114741
410 Ga0070659_100083629
411 Ga0070713_100005154
412 Ga0070713_100043276
413 Ga0070713_100160138
414 Ga0070701_10053083
415 Ga0070705_100026786
416 Ga0070700_100098206
417 Ga0070694_100000987
418 Ga0070694_100013672
419 Ga0070678_100072668
420 Ga0070662_100128618
421 Ga0070681_10098085
422 Ga0068867_100003360
423 Ga0068867_100103653
424 Ga0070706_100022840
425 Ga0070698_100021413
426 Ga0070698_100035612
427 Ga0070698_100100701
428 Ga0070699_100002049
429 Ga0070699_100012040
430 Ga0070684_100007782
431 Ga0070684_100113922
432 Ga0070672_100032201
433 Ga0070672_100076740
434 Ga0070672_100125480
435 Ga0070695_100000400
436 Ga0070696_100001013
437 Ga0070696_100005998
438 Ga0070665_100044497
439 Ga0070704_100004947
440 Ga0070704_100043313
441 Ga0070704_100052909
442 Ga0068855_100023326
443 Ga0068855_100051190
444 Ga0068857_100001045
445 Ga0068856_100024534
446 Ga0068856_100164907
447 Ga0068859_100024367
448 Ga0068859_100095920
449 Ga0068859_100334302
450 Ga0068864_100004741
451 Ga0068864_100033457
452 Ga0068864_100091413
453 Ga0068861_100135292
454 Ga0068870_10000958
455 Ga0068863_100022055
456 Ga0068863_100035063
457 Ga0068863_100053505
458 Ga0068858_100005875
459 Ga0068858_100012135
460 Ga0068858_100036934
461 Ga0068858_100062295
462 Ga0068858_100113913
463 Ga0068858_100120114
464 Ga0068858_100129820
465 Ga0068860_100007203
466 Ga0068860_100007872
467 Ga0068860_100159884
468 Ga0068862_100010263
469 Ga0081539_10000190
470 Ga0081539_10002496
471 Ga0081539_10003234
472 Ga0081539_10068648
473 Ga0097621_100002738
474 Ga0097621_100030505
475 Ga0097621_100080672
476 Ga0068871_100007940
477 Ga0068871_100090588
478 Ga0068871_100164411
479 Ga0075428_100001600
480 Ga0075428_100043407
481 Ga0075428_100155466
482 Ga0075430_100021918
483 Ga0075431_100008497
484 Ga0075431_100028918
485 Ga0075431_100051603
486 Ga0075431_100110842
487 Ga0075433_10038968
488 Ga0075433_10106481
489 Ga0075434_100167148
490 Ga0075429_100107427
491 Ga0068865_100028831
492 Ga0068865_100199604
493 Ga0097620_100024367
494 Ga0097620_100095923
495 Ga0097620_100334250
496 Ga0075435_100016334
497 Ga0075435_100033899
498 Ga0075435_100126396
499 Ga0099795_10013001
500 Ga0111539_10000538
501 Ga0111539_10029393
502 Ga0111539_10037152
503 Ga0111539_10074631
504 Ga0111539_10153119
505 Ga0105245_10001010
506 Ga0105245_10002657
507 Ga0105245_10020366
508 Ga0105245_10025163
509 Ga0105245_10138767
510 Ga0105247_10102709
511 Ga0114129_10003782
512 Ga0114129_10004240
513 Ga0114129_10015336
514 Ga0114129_10034807
515 Ga0114129_10054616
516 Ga0114129_10081719
517 Ga0114129_10111733
518 Ga0114129_10466261
519 Ga0105243_10015341
520 Ga0105243_10021732
521 Ga0105243_10026923
522 Ga0105241_10009329
523 Ga0105242_10001360
524 Ga0105242_10064783
525 Ga0105242_10067945
526 Ga0105242_10068846
527 Ga0105248_10015001
528 Ga0105248_10036773
529 Ga0105248_10043737
530 Ga0105248_10059006
531 Ga0105248_10210718
532 Ga0105237_10014825
533 Ga0105237_10018165
534 Ga0105237_10059146
535 Ga0105238_10016452
536 Ga0105238_10059873
537 Ga0105238_10087657
538 Ga0105238_10095546
539 Ga0105238_10104161
540 Ga0105249_10020798
541 Ga0105239_10023144
542 Ga0105239_10024872
543 Ga0105239_10033429
544 Ga0105239_10101701
545 Ga0157370_10219458
546 Ga0157369_10096996
547 Ga0157374_10005876
548 Ga0157374_10006789
549 Ga0157374_10074049
550 Ga0157378_10060036
551 Ga0163162_10002784
552 Ga0163162_10019597
553 Ga0157372_10113920
554 Ga0157375_10037961
555 Ga0157375_10074987
556 Ga0157375_10119444
557 Ga0157375_10275380
558 Ga0163163_10005643
559 Ga0163163_10027803
560 Ga0163163_10060695
561 Ga0163163_10084657
562 Ga0163163_10120969
563 Ga0163163_10121128
564 Ga0163163_10146504
565 Ga0157380_10013689
566 Ga0157380_10088199
567 Ga0157379_10078046
568 Ga0157379_10116606
569 Ga0157379_10119631
570 Ga0157379_10136695
571 Ga0157379_10244175
572 Ga0157376_10015573
573 Ga0157376_10112911
574 Ga0157376_10161989
575 Ga0157376_10224685
576 Ga0213875_10016616
577 Ga0207680_10019866
578 Ga0207643_10002708
579 Ga0207643_10012657
580 Ga0207654_10014833
581 Ga0207707_10030051
582 Ga0207671_10025366
583 Ga0207681_10007835
584 Ga0207681_10056050
585 Ga0207681_10136321
586 Ga0207694_10005023
587 Ga0207694_10020003
588 Ga0207694_10184431
589 Ga0207650_10099407
590 Ga0207650_10111815
591 Ga0207659_10006683
592 Ga0207659_10067307
593 Ga0207687_10001674
594 Ga0207687_10004772
595 Ga0207687_10018134
596 Ga0207687_10043162
597 Ga0207700_10015509
598 Ga0207700_10072786
599 Ga0207700_10095736
600 Ga0207644_10077932
601 Ga0207644_10141376
602 Ga0207690_10060656
603 Ga0207686_10017421
604 Ga0207686_10042506
605 Ga0207686_10067943
606 Ga0207709_10033961
607 Ga0207709_10100715
608 Ga0207670_10003662
609 Ga0207669_10025124
610 Ga0207704_10029933
611 Ga0207704_10173974
612 Ga0207691_10045603
613 Ga0207691_10058522
614 Ga0207691_10139835
615 Ga0207711_10000490
616 Ga0207711_10006471
617 Ga0207711_10089465
618 Ga0207711_10124648
619 Ga0207689_10012614
620 Ga0207689_10067525
621 Ga0207661_10016818
622 Ga0207661_10031830
623 Ga0207667_10050240
624 Ga0207651_10004043
625 Ga0207651_10025797
626 Ga0207668_10049983
627 Ga0207677_10015377
628 Ga0207677_10040906
629 Ga0207703_10014548
630 Ga0207703_10050437
631 Ga0207703_10058623
632 Ga0207703_10099008
633 Ga0207708_10036666
634 Ga0207708_10103303
635 Ga0207702_10213553
636 Ga0207641_10004685
637 Ga0207641_10019965
638 Ga0207641_10026910
639 Ga0207641_10152907
640 Ga0207641_10226404
641 Ga0207648_10006065
642 Ga0207648_10059984
643 Ga0207676_10006922
644 Ga0207676_10014241
645 Ga0207674_10003344
646 Ga0207674_10009778
647 Ga0207674_10056504
648 Ga0207675_100020997
649 Ga0207675_100082548
650 Ga0207698_10151806
651 Ga0207428_10000413
652 Ga0207428_10011530
653 Ga0265357_1000226
654 Ga0268266_10002600
655 Ga0268266_10054980
656 Ga0268265_10187848
657 Ga0268264_10064703
658 Ga0268264_10121625
659 Ga0265318_10033665
660 Ga0265336_10009077
661 Ga0265338_10001153
662 Ga0265330_10000369
663 Ga0265330_10000604
664 Ga0265328_10002233
665 Ga0265320_10044867
666 Ga0265325_10000130
667 Ga0265325_10051527
668 Ga0265325_10073503
669 Ga0265325_10077507
670 Ga0265340_10023742
671 Ga0265340_10051545
672 Ga0265339_10043070
673 Ga0265339_10046153
674 Ga0265331_10015934
675 Ga0265331_10018869
676 Ga0265316_10000737
677 Ga0265316_10107912
678 Ga0265313_10000616
679 Ga0265313_10009029
680 Ga0265314_10000656
681 Ga0265314_10001387
682 Ga0265314_10003138
683 Ga0265314_10003198
684 Ga0265314_10018427
685 Ga0265342_10000269
686 Ga0265342_10007107
687 Ga0265342_10008761
688 Ga0307407_10040122
689 Ga0307510_10041580
690 Ga0373934_0001813
691 Ga0373923_0017762
692 Ga0373939_0024947
693 Ga0373954_0009167
694 Ga0373955_0155088
695 Ga0373931_0062670
696 Ga0373927_0134910
697 Ga0373937_0002446
698 Ga0373925_0232744
699 Ga0436364_0092195
700 Ga0436364_0148563
701 Ga0436364_1393410
702 Ga0436365_1459202
703 Ga0451853_2794969
704 Ga0451577_0077162
705 Ga0466966_0044799
706 Ga0451576_0282989
707 Ga0495638_0127189
708 Ga0495653_0106683
709 Ga0495650_0001650
710 Ga0495580_0005462
711 Ga0495580_0008737
712 Ga0495580_0033366
713 Ga0495580_0069123
714 Ga0495664_0158476
715 Ga0495594_0094631
716 Ga0495643_0001528
717 Ga0495666_0039408
718 Ga0495642_0021671
719 Ga0495587_0003818
720 Ga0495587_0012121
721 Ga0495598_0003194
722 Ga0495621_0010044
723 Ga0495621_0010967
724 Ga0495621_0024620
725 Ga0495621_0048250
726 Ga0495645_0033106
727 Ga0495667_0038700
728 Ga0495667_0050611
729 Ga0495656_0075071
730 Ga0495656_0105277
731 Ga0495635_0049311
732 Ga0495659_0001932
733 Ga0495659_0012897
734 Ga0495599_0050357
735 Ga0495623_0062723
736 Ga0495669_0085714
737 Ga0495604_0031669
738 Ga0495604_0135716
739 Ga0495636_0009207
740 Ga0495674_0014290
741 Ga0495680_0137857
742 Ga0495675_0005537
743 Ga0495677_0024161
744 Ga0495684_0027595
745 Ga0495684_0031911
746 Ga0495602_0013475
747 Ga0495602_0051186
748 Ga0496103_0079284
749 Ga0496104_0118585
750 Ga0496114_0240090
751 Ga0496126_0000100
752 nmdc:mga05p37_122804_c1
753 nmdc:mga05p37_17498_c1
754 nmdc:mga05p37_224503_c1
755 nmdc:mga05p37_278967_c1
756 nmdc:mga05p37_3161_c1
757 nmdc:mga05p37_53310_c1
758 nmdc:mga09592_151849_c1
759 nmdc:mga09592_236990_c1
760 nmdc:mga09592_245409_c1
761 nmdc:mga0qj67_16744_c1
762 nmdc:mga0qj67_86797_c1
763 nmdc:mga06r32_147775_c1
764 nmdc:mga06r32_57473_c1
765 nmdc:mga06r32_71912_c1
766 nmdc:mga08y16_2135_c1
767 nmdc:mga08y16_52791_c1
768 nmdc:mga08y16_82257_c1
769 nmdc:mga0n895_160747_c1
770 nmdc:mga0n895_88509_c1
771 nmdc:mga0rr50_57811_c1
772 nmdc:mga0rr50_64544_c1
773 nmdc:mga0rr50_86570_c1
774 nmdc:mga0a205_1155_c1
775 nmdc:mga0a205_576_c1
776 nmdc:mga0a205_61973_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

100

425

0.91

PF07687

M20_dimer

Peptidase dimerisation domain

229

333

0.91

PF04389

Peptidase_M28

Peptidase family M28

84

176

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n5f-assembly1.cif.gz_B crystal structure of l-n-carbamoylase from geobacillus stearothermophilus cect43 0.9661 30 427
5thw-assembly2.cif.gz_D crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia multivorans 0.9476 30 427
5tp4-assembly1.cif.gz_A crystal structure of a hydantoinase/carbamoylase family amidase from burkholderia ambifaria 0.9466 30 427
3n5f-assembly1.cif.gz_B crystal structure of l-n-carbamoylase from geobacillus stearothermophilus cect43 0.9452 30 427
2imo-assembly1.cif.gz_B crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6 0.945 23 426
ID Description Score Start End Superfamily
5i4mA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9792 232 342 3.30.70.360
3n5fB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9787 232 345 3.30.70.360
af_Q655X8_256_387_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9768 232 342 3.40.630.10
af_C0P5R8_269_385_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9737 233 345 3.40.630.10
3n5fB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9703 232 345 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A7H4N1W2-F1-model_v4 N-carbamoyl-L-amino acid hydrolase 0.9848 227 426 GO:0016813
AF-A0A838QTM3-F1-model_v4 Allantoate amidohydrolase 0.9825 27 427 GO:0016813
GO:0046872
AF-A0A7W4P507-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9807 52 221 GO:0016813
AF-A0A1X1MR19-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9745 26 427 GO:0016813
GO:0046872
AF-A0A2H6BB60-F1-model_v4 Allantoate amidohydrolase 0.9732 30 425 GO:0016813
GO:0046872

Map