F430940

General Info

Members Datasets Scaffolds Average Seq Length
387 294 774 86

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_1492897|Ga0496110_1492897_110_406
Length 98
Sequence MQVEADRSVCPACGAGRLERFPVLHHMICAYVGPQYDFSPTDFARAGGERTCPKCRRSVVLGDPACEIVGISARCVRCRKEMTVSPIDTKLLGTVCGC

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
176 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
177 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
178 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
268 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
272 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
273 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
274 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
275 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
276 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
277 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
278 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
279 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
280 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
281 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
282 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
283 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
284 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
285 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
286 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
287 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
288 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
289 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
290 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
291 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
292 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
293 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
294 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.06
Metatranscriptomes 0
Isolates 5.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.56
Nodule 5.94
Rhizoplane 8.27
Rhizosphere 75.71
Stem 0
Stem Tuber 0
Unclassified 21.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_1492897 3300048913 Unclassified 586
2 JGI24743J22301_10002215 3300001991 Bacteria 2885
3 JGI24745J21846_1005247 3300002073 Bacteria 1411
4 JGI24744J21845_10048117 3300002077 Unclassified 789
5 Ga0070683_100124132 3300005329 Bacteria 2440
6 Ga0070690_100215290 3300005330 Unclassified 1343
7 Ga0070690_101189095 3300005330 Bacteria 608
8 Ga0070670_100147322 3300005331 Bacteria 2037
9 Ga0070666_10135780 3300005335 Bacteria 1711
10 Ga0070682_100045764 3300005337 Bacteria 2714
11 Ga0068868_100012570 3300005338 Bacteria 6191
12 Ga0070689_100603942 3300005340 Unclassified 950
13 Ga0070691_10042469 3300005341 Bacteria 2152
14 Ga0070687_100013608 3300005343 Bacteria 3630
15 Ga0070687_101131713 3300005343 Unclassified 574
16 Ga0070661_100489275 3300005344 Bacteria 983
17 Ga0070692_10023242 3300005345 Bacteria 3036
18 Ga0070668_100069304 3300005347 Bacteria 2743
19 Ga0070669_100106482 3300005353 Bacteria 2123
20 Ga0070675_100114739 3300005354 Bacteria 2283
21 Ga0070671_100235751 3300005355 Bacteria 1553
22 Ga0070671_100252402 3300005355 Bacteria 1498
23 Ga0070674_101481975 3300005356 Bacteria 609
24 Ga0070688_100028502 3300005365 Bacteria 3334
25 Ga0070659_100054489 3300005366 Bacteria 3150
26 Ga0070667_100174503 3300005367 Bacteria 1899
27 Ga0070714_100941931 3300005435 Bacteria 839
28 Ga0070713_100128497 3300005436 Bacteria 2232
29 Ga0070713_100265675 3300005436 Bacteria 1569
30 Ga0070710_10024415 3300005437 Bacteria 3189
31 Ga0070710_10169886 3300005437 Bacteria 1358
32 Ga0070701_10043768 3300005438 Bacteria 2292
33 Ga0070711_100081037 3300005439 Bacteria 2312
34 Ga0070711_100368436 3300005439 Bacteria 1159
35 Ga0070700_100012181 3300005441 Bacteria 4789
36 Ga0070700_100051988 3300005441 Bacteria 2553
37 Ga0070700_100709833 3300005441 Unclassified 800
38 Ga0070694_100142235 3300005444 Bacteria 1744
39 Ga0070663_100036306 3300005455 Bacteria 3424
40 Ga0070678_100071770 3300005456 Bacteria 2593
41 Ga0070662_100268792 3300005457 Bacteria 1376
42 Ga0070681_11251943 3300005458 Unclassified 664
43 Ga0068867_100067343 3300005459 Bacteria 2669
44 Ga0070685_10027171 3300005466 Bacteria 3161
45 Ga0070707_100381275 3300005468 Bacteria 1370
46 Ga0070679_101221151 3300005530 Unclassified 697
47 Ga0070684_100057068 3300005535 Bacteria 3408
48 Ga0070697_100246710 3300005536 Unclassified 1526
49 Ga0070672_100099244 3300005543 Bacteria 2360
50 Ga0070686_100019872 3300005544 Bacteria 3968
51 Ga0070686_100082087 3300005544 Bacteria 2137
52 Ga0070693_100248106 3300005547 Bacteria 1179
53 Ga0070665_100039041 3300005548 Bacteria 4774
54 Ga0070704_100012943 3300005549 Bacteria 5161
55 Ga0070664_100030830 3300005564 Bacteria 4476
56 Ga0070664_100096579 3300005564 Bacteria 2565
57 Ga0068856_100106949 3300005614 Bacteria 2793
58 Ga0070702_100011302 3300005615 Bacteria 4436
59 Ga0068852_100014690 3300005616 Bacteria 6039
60 Ga0068859_100077777 3300005617 Bacteria 3358
61 Ga0068859_102282333 3300005617 Unclassified 597
62 Ga0068864_100100285 3300005618 Bacteria 2566
63 Ga0068864_101302736 3300005618 Unclassified 727
64 Ga0068866_10440524 3300005718 Unclassified 850
65 Ga0068861_100029799 3300005719 Bacteria 3994
66 Ga0068861_101863249 3300005719 Bacteria 598
67 Ga0068870_10007116 3300005840 Bacteria 4975
68 Ga0068863_100026035 3300005841 Bacteria 5581
69 Ga0068858_100039704 3300005842 Bacteria 4363
70 Ga0068858_100994508 3300005842 Unclassified 822
71 Ga0068862_100209673 3300005844 Unclassified 1760
72 Ga0081455_10010062 3300005937 Bacteria 9654
73 Ga0081455_10013168 3300005937 Bacteria 8195
74 Ga0081540_1051646 3300005983 Bacteria 2031
75 Ga0070717_11570310 3300006028 Bacteria 596
76 Ga0075365_10008843 3300006038 Bacteria 5746
77 Ga0075365_10032989 3300006038 Bacteria 3333
78 Ga0075365_10129946 3300006038 Bacteria 1743
79 Ga0075365_10155796 3300006038 Bacteria 1590
80 Ga0075368_10001593 3300006042 Bacteria 7286
81 Ga0075363_100003567 3300006048 Bacteria 6653
82 Ga0075363_100266306 3300006048 Bacteria 989
83 Ga0075364_10001482 3300006051 Bacteria 12783
84 Ga0075364_10593158 3300006051 Bacteria 757
85 Ga0070715_10050952 3300006163 Bacteria 1779
86 Ga0070716_101130004 3300006173 Bacteria 626
87 Ga0070712_100000152 3300006175 Bacteria 36965
88 Ga0075362_10008682 3300006177 Bacteria 3901
89 Ga0075362_10064651 3300006177 Bacteria 1660
90 Ga0075362_10365437 3300006177 Unclassified 724
91 Ga0075367_10000587 3300006178 Bacteria 13944
92 Ga0075367_10030409 3300006178 Bacteria 3097
93 Ga0075367_10096425 3300006178 Bacteria 1804
94 Ga0075367_10918627 3300006178 Unclassified 558
95 Ga0075366_10127641 3300006195 Bacteria 1534
96 Ga0097621_100063473 3300006237 Bacteria 3036
97 Ga0068871_100021044 3300006358 Bacteria 5006
98 Ga0075428_100036900 3300006844 Bacteria 5382
99 Ga0075428_100107114 3300006844 Bacteria 3046
100 Ga0075430_100017127 3300006846 Bacteria 6171
101 Ga0075431_100030010 3300006847 Bacteria 5599
102 Ga0075431_100176873 3300006847 Bacteria 2191
103 Ga0075434_100539045 3300006871 Bacteria 1187
104 Ga0075429_100057765 3300006880 Bacteria 3378
105 Ga0075429_100860144 3300006880 Unclassified 794
106 Ga0068865_100022705 3300006881 Bacteria 4097
107 Ga0097620_100077777 3300006931 Bacteria 3358
108 Ga0097620_102282019 3300006931 Unclassified 597
109 Ga0075435_100295367 3300007076 Bacteria 1385
110 Ga0099795_10000287 3300007788 Bacteria 9029
111 Ga0105240_11582108 3300009093 Unclassified 686
112 Ga0111539_10085189 3300009094 Bacteria 3715
113 Ga0111539_10107744 3300009094 Bacteria 3270
114 Ga0105245_10048362 3300009098 Bacteria 3804
115 Ga0105247_10036722 3300009101 Unclassified 2987
116 Ga0114129_10547658 3300009147 Unclassified 1505
117 Ga0114129_12605949 3300009147 Unclassified 603
118 Ga0114129_13127283 3300009147 Unclassified 540
119 Ga0105243_10014393 3300009148 Bacteria 5988
120 Ga0105242_10079120 3300009176 Bacteria 2745
121 Ga0105248_10096934 3300009177 Bacteria 3323
122 Ga0105248_10335342 3300009177 Unclassified 1703
123 Ga0105237_10206608 3300009545 Bacteria 1964
124 Ga0105238_10670823 3300009551 Unclassified 1048
125 Ga0105249_10060672 3300009553 Bacteria 3470
126 Ga0099796_10016575 3300010159 Bacteria 2178
127 Ga0105239_10088430 3300010375 Unclassified 3416
128 Ga0105239_11186304 3300010375 Bacteria 880
129 Ga0105246_10020763 3300011119 Bacteria 4217
130 Ga0105246_11501380 3300011119 Bacteria 633
131 Ga0157374_10123025 3300013296 Bacteria 2506
132 Ga0157378_10084823 3300013297 Bacteria 2868
133 Ga0157372_11798082 3300013307 Unclassified 705
134 Ga0157375_10025567 3300013308 Bacteria 5489
135 Ga0163163_10026657 3300014325 Bacteria 5527
136 Ga0157380_10264460 3300014326 Bacteria 1564
137 Ga0157380_13190906 3300014326 Unclassified 523
138 Ga0157377_10004321 3300014745 Bacteria 6525
139 Ga0157379_10025709 3300014968 Bacteria 5233
140 Ga0157376_10151083 3300014969 Bacteria 2094
141 Ga0163161_10039792 3300017792 Bacteria 3377
142 Ga0207710_10054693 3300025900 Bacteria 1798
143 Ga0207688_10003214 3300025901 Bacteria 8920
144 Ga0207680_10019445 3300025903 Bacteria 3633
145 Ga0207685_10161024 3300025905 Bacteria 1025
146 Ga0207699_10312533 3300025906 Bacteria 1100
147 Ga0207645_10245402 3300025907 Bacteria 1184
148 Ga0207643_10002847 3300025908 Bacteria 9345
149 Ga0207695_11091448 3300025913 Unclassified 678
150 Ga0207693_10038508 3300025915 Bacteria 3765
151 Ga0207663_10141466 3300025916 Bacteria 1677
152 Ga0207663_10291764 3300025916 Bacteria 1215
153 Ga0207662_10023964 3300025918 Bacteria 3511
154 Ga0207662_10191832 3300025918 Bacteria 1319
155 Ga0207649_11198463 3300025920 Unclassified 600
156 Ga0207646_10316522 3300025922 Bacteria 1410
157 Ga0207681_10052849 3300025923 Bacteria 2756
158 Ga0207650_10260795 3300025925 Bacteria 1406
159 Ga0207687_10047797 3300025927 Bacteria 2968
160 Ga0207700_10093239 3300025928 Bacteria 2383
161 Ga0207700_10527521 3300025928 Unclassified 1047
162 Ga0207664_10168332 3300025929 Bacteria 1874
163 Ga0207644_10218450 3300025931 Bacteria 1510
164 Ga0207690_10292899 3300025932 Bacteria 1271
165 Ga0207706_10004780 3300025933 Bacteria 12684
166 Ga0207706_10325878 3300025933 Bacteria 1336
167 Ga0207709_10180382 3300025935 Bacteria 1491
168 Ga0207670_10164414 3300025936 Bacteria 1659
169 Ga0207669_11546101 3300025937 Unclassified 566
170 Ga0207704_10023601 3300025938 Bacteria 3318
171 Ga0207665_11676438 3300025939 Bacteria 503
172 Ga0207691_10033683 3300025940 Bacteria 4770
173 Ga0207689_10846042 3300025942 Unclassified 772
174 Ga0207661_10110522 3300025944 Bacteria 2324
175 Ga0207679_10058495 3300025945 Bacteria 2857
176 Ga0207679_10192039 3300025945 Bacteria 1699
177 Ga0207712_10081762 3300025961 Bacteria 2353
178 Ga0207712_11400541 3300025961 Unclassified 626
179 Ga0207640_10249699 3300025981 Bacteria 1376
180 Ga0207658_10698737 3300025986 Unclassified 916
181 Ga0207677_11906214 3300026023 Unclassified 552
182 Ga0207678_10014033 3300026067 Bacteria 7045
183 Ga0207708_10002701 3300026075 Bacteria 13034
184 Ga0207702_10594828 3300026078 Bacteria 1085
185 Ga0207702_10837577 3300026078 Unclassified 910
186 Ga0207648_10014026 3300026089 Bacteria 7424
187 Ga0207676_10098162 3300026095 Bacteria 2421
188 Ga0207676_11657056 3300026095 Unclassified 638
189 Ga0207675_100017215 3300026118 Bacteria 6749
190 Ga0207683_10021101 3300026121 Bacteria 5575
191 Ga0207683_10944319 3300026121 Bacteria 801
192 Ga0207698_10023812 3300026142 Bacteria 4285
193 Ga0209813_10012770 3300027866 Bacteria 2228
194 Ga0207428_10693946 3300027907 Unclassified 728
195 Ga0268266_10405657 3300028379 Bacteria 1289
196 Ga0268265_10041954 3300028380 Bacteria 3391
197 Ga0268265_10183893 3300028380 Unclassified 1798
198 Ga0268264_10169246 3300028381 Bacteria 1975
199 Ga0268264_11751938 3300028381 Unclassified 631
200 Ga0307408_100193838 3300031548 Bacteria 1639
201 Ga0307405_10714892 3300031731 Unclassified 831
202 Ga0307406_10516901 3300031901 Bacteria 971
203 Ga0307412_11308418 3300031911 Unclassified 653
204 Ga0307416_101310007 3300032002 Bacteria 830
205 Ga0373934_0062884 3300035086 Bacteria 1480
206 Ga0373944_0253238 3300035089 Bacteria 650
207 Ga0373945_0124232 3300035116 Bacteria 1028
208 Ga0373945_0134324 3300035116 Bacteria 993
209 Ga0373953_0137722 3300035117 Bacteria 1043
210 Ga0373954_0617347 3300035118 Bacteria 537
211 Ga0373956_0004416 3300035119 Bacteria 5630
212 Ga0373957_0017890 3300035120 Bacteria 2475
213 Ga0373943_0020404 3300035170 Bacteria 3054
214 Ga0373943_0602477 3300035170 Unclassified 647
215 Ga0373931_1192374 3300035691 Unclassified 521
216 Ga0373935_0024507 3300035692 Bacteria 3714
217 Ga0373935_0326832 3300035692 Bacteria 1089
218 Ga0373935_0390442 3300035692 Bacteria 998
219 Ga0373927_0030702 3300035695 Bacteria 3505
220 Ga0373927_0068045 3300035695 Bacteria 2304
221 Ga0373947_0276214 3300035725 Bacteria 1116
222 Ga0373947_0412879 3300035725 Bacteria 911
223 Ga0373937_0025565 3300036401 Bacteria 5331
224 Ga0373925_0033161 3300037068 Bacteria 3806
225 Ga0373925_0779456 3300037068 Bacteria 788
226 Ga0373925_1295588 3300037068 Unclassified 598
227 Ga0395905_1174478 3300037471 Bacteria 671
228 Ga0395901_0638752 3300038443 Unclassified 1069
229 Ga0451793_0470824 3300041452 Unclassified 1151
230 Ga0451793_1132453 3300041452 Unclassified 877
231 Ga0451795_0050364 3300041456 Bacteria 1749
232 Ga0451841_0607119 3300041498 Bacteria 804
233 Ga0451851_0069736 3300041507 Bacteria 1551
234 Ga0439440_0074860 3300042993 Unclassified 887
235 Ga0495603_0064613 3300046455 Bacteria 2157
236 Ga0495603_0702876 3300046455 Unclassified 578
237 Ga0495629_0434784 3300046459 Bacteria 890
238 Ga0495638_0005882 3300046460 Bacteria 9018
239 Ga0495641_0036635 3300046461 Bacteria 2304
240 Ga0495651_0016818 3300046462 Bacteria 5665
241 Ga0495582_0141731 3300046473 Bacteria 1362
242 Ga0495582_0389751 3300046473 Bacteria 803
243 Ga0495639_0013718 3300046475 Bacteria 3503
244 Ga0495662_0119781 3300046476 Bacteria 1292
245 Ga0495662_0432805 3300046476 Bacteria 646
246 Ga0495584_0114072 3300046491 Bacteria 1367
247 Ga0495584_0709715 3300046491 Unclassified 513
248 Ga0495594_0339706 3300046499 Bacteria 855
249 Ga0495594_0575128 3300046499 Unclassified 639
250 Ga0495607_0088209 3300046501 Bacteria 1686
251 Ga0495608_0030811 3300046511 Bacteria 3628
252 Ga0495618_0010923 3300046514 Bacteria 5499
253 Ga0495620_0107297 3300046515 Bacteria 1109
254 Ga0495620_0386835 3300046515 Unclassified 530
255 Ga0495628_0051959 3300046516 Bacteria 3238
256 Ga0495630_0048910 3300046517 Bacteria 3165
257 Ga0495637_0045695 3300046520 Bacteria 1856
258 Ga0495644_0278887 3300046523 Bacteria 652
259 Ga0495666_0054937 3300046526 Bacteria 1909
260 Ga0495652_0109140 3300046529 Bacteria 2228
261 Ga0495652_1055794 3300046529 Bacteria 529
262 Ga0495633_0032243 3300046558 Bacteria 2533
263 Ga0495667_0039439 3300046559 Bacteria 3140
264 Ga0495656_0802444 3300046615 Unclassified 509
265 Ga0495634_0040936 3300046642 Bacteria 3148
266 Ga0495611_0468215 3300046648 Bacteria 574
267 Ga0495659_0049025 3300046664 Bacteria 1532
268 Ga0495659_0138718 3300046664 Unclassified 969
269 Ga0495588_0161423 3300046674 Bacteria 1185
270 Ga0495657_0047033 3300046675 Bacteria 2919
271 Ga0495623_0013324 3300046679 Bacteria 5333
272 Ga0495646_0057093 3300046680 Bacteria 2338
273 Ga0495647_0028465 3300046681 Bacteria 2060
274 Ga0495658_0029345 3300046683 Bacteria 2977
275 Ga0495613_0060280 3300046689 Bacteria 2780
276 Ga0495613_0516016 3300046689 Bacteria 803
277 Ga0495624_0240629 3300046690 Bacteria 1095
278 Ga0495624_0284316 3300046690 Bacteria 998
279 Ga0495604_0607688 3300047317 Unclassified 701
280 Ga0495674_0028433 3300047319 Bacteria 5096
281 Ga0495674_0201066 3300047319 Bacteria 1653
282 Ga0495676_0050196 3300047321 Bacteria 3347
283 Ga0495676_0659663 3300047321 Bacteria 678
284 Ga0495675_0004861 3300047444 Bacteria 8174
285 Ga0495679_032333 3300047446 Bacteria 1679
286 Ga0495593_0377547 3300047673 Bacteria 709
287 Ga0495602_0021100 3300048088 Bacteria 6420
288 Ga0495602_0396429 3300048088 Bacteria 985
289 Ga0496100_0019696 3300048903 Bacteria 4031
290 Ga0496101_0039266 3300048904 Bacteria 3365
291 Ga0496101_0579375 3300048904 Unclassified 887
292 Ga0496102_0067821 3300048905 Bacteria 3272
293 Ga0496102_1911560 3300048905 Bacteria 510
294 Ga0496103_0043397 3300048906 Bacteria 2769
295 Ga0496104_0138035 3300048907 Unclassified 2342
296 Ga0496105_0017883 3300048908 Bacteria 5688
297 Ga0496105_0087213 3300048908 Unclassified 2579
298 Ga0496105_1281013 3300048908 Bacteria 536
299 Ga0496106_0003241 3300048909 Bacteria 12172
300 Ga0496107_0017165 3300048910 Bacteria 5091
301 Ga0496107_0347525 3300048910 Bacteria 1104
302 Ga0496107_0921032 3300048910 Unclassified 637
303 Ga0496108_0072890 3300048911 Bacteria 2899
304 Ga0496108_0384388 3300048911 Bacteria 1226
305 Ga0496109_0025569 3300048912 Bacteria 5262
306 Ga0496109_1251328 3300048912 Unclassified 678
307 Ga0496109_2047886 3300048912 Unclassified 504
308 Ga0496110_0002010 3300048913 Bacteria 15144
309 Ga0496111_0006830 3300048914 Bacteria 7442
310 Ga0496112_0024610 3300048915 Bacteria 5769
311 Ga0496112_1387516 3300048915 Bacteria 617
312 Ga0496113_0072367 3300048916 Bacteria 2623
313 Ga0496113_0281115 3300048916 Bacteria 1331
314 Ga0496114_0127641 3300048917 Unclassified 2193
315 Ga0496115_0007587 3300048918 Bacteria 7988
316 Ga0496115_0679762 3300048918 Unclassified 811
317 Ga0501041_0128860 3300049577 Unclassified 1576
318 Ga0501046_0066845 3300049580 Bacteria 2801
319 Ga0501048_0273239 3300049582 Unclassified 1201
320 Ga0501069_0461200 3300049585 Unclassified 756
321 Ga0501070_0558522 3300049586 Unclassified 916
322 Ga0501072_1284588 3300049588 Unclassified 567
323 Ga0501074_0499692 3300049590 Unclassified 862
324 Ga0501076_0695634 3300049592 Unclassified 839
325 Ga0501077_0441284 3300049593 Unclassified 833
326 Ga0501080_0778871 3300049742 Unclassified 840
327 Ga0501083_0420738 3300049744 Unclassified 869
328 nmdc:mga03683_10406_c1 3300050489 Bacteria 3336
329 nmdc:mga03683_3599_c1 3300050489 Bacteria 5025
330 nmdc:mga03n38_277784_c1 3300050490 Bacteria 893
331 nmdc:mga03n38_928810_c1 3300050490 Unclassified 512
332 nmdc:mga03n38_93513_c1 3300050490 Bacteria 1436
333 nmdc:mga00v17_21455_c1 3300050491 Bacteria 3713
334 nmdc:mga0yw44_110749_c1 3300050492 Bacteria 1759
335 nmdc:mga0yw44_477857_c1 3300050492 Bacteria 845
336 nmdc:mga0yw44_502919_c1 3300050492 Unclassified 822
337 nmdc:mga0yw44_58088_c1 3300050492 Bacteria 2362
338 nmdc:mga0yw44_78228_c1 3300050492 Bacteria 2068
339 nmdc:mga0k408_46628_c1 3300050493 Unclassified 2503
340 nmdc:mga06z11_13125_c1 3300050494 Bacteria 3627
341 nmdc:mga05p37_2256264_c1 3300050507 Unclassified 503
342 nmdc:mga09592_211829_c1 3300050508 Bacteria 1679
343 nmdc:mga09592_661011_c1 3300050508 Bacteria 892
344 nmdc:mga06r32_121301_c1 3300050510 Bacteria 2579
345 nmdc:mga06r32_45925_c1 3300050510 Bacteria 4166
346 nmdc:mga08y16_462490_c1 3300050511 Bacteria 1293
347 nmdc:mga08y16_926461_c1 3300050511 Bacteria 856
348 nmdc:mga0n895_220549_c1 3300050512 Bacteria 1925
349 nmdc:mga0rr50_1090727_c1 3300050513 Bacteria 679
350 nmdc:mga0sz30_42954_c2 3300050516 Bacteria 1112
351 Ga0495601_0035640 3300053077 Bacteria 3107
352 Ga0495612_0083250 3300053078 Unclassified 1346
353 Ga0495655_0055808 3300053083 Unclassified 1061
354 Ga0495655_0169812 3300053083 Bacteria 697
355 Ga0495595_0007751 3300053084 Bacteria 4396
356 Ga0495619_0054311 3300053085 Bacteria 2651
357 Ga0500650_0506023 3300053098 Unclassified 513
358 Ga0500642_0082334 3300053130 Bacteria 1480
359 Ga0500577_0123956 3300053142 Bacteria 1077
360 Ga0500588_0106953 3300053146 Bacteria 972
361 Ga0500636_0127532 3300053177 Bacteria 1421
362 Ga0501084_1008584 3300054114 Unclassified 699
363 Ga0501082_0068238 3300060353 Bacteria 3062
364 Ga0530510_0174750 3300061734 Unclassified 1591
365 2508697232 2508501042 Bacteria 8719808
366 2515629064 2515154112 Bacteria 8294334
367 2874595293 2874590934 Bacteria 8299676
368 2876775229 2876771140 Bacteria 8287509
369 2876824044 2876818435 Bacteria 8274608
370 2879080672 2879074833 Bacteria 8279565
371 2879134742 2879127579 Bacteria 8294491
372 2879144202 2879142872 Bacteria 8267021
373 2935654640 2935648319 Bacteria 8801166
374 2935663583 2935656913 Bacteria 8965014
375 2935981519 2935975950 Bacteria 8347125
376 2935990882 2935984226 Bacteria 8302647
377 2936017739 2936011229 Bacteria 8801034
378 2936026178 2936019824 Bacteria 8804134
379 2936036971 2936028420 Bacteria 8965941
380 2936053077 2936046547 Bacteria 8903709
381 2936059318 2936055302 Bacteria 8785755
382 8016633647 8016630954 Bacteria 9217207
383 8019627045 8019619141 Bacteria 9218857
384 8019635500 8019629233 Bacteria 8687553
385 8019663308 8019659431 Bacteria 8577854
386 8019672926 8019668869 Bacteria 8791617
387 8019683216 8019678201 Bacteria 8863603
388 Ga0496110_1492897
389 JGI24743J22301_10002215
390 JGI24745J21846_1005247
391 JGI24744J21845_10048117
392 Ga0070683_100124132
393 Ga0070690_100215290
394 Ga0070690_101189095
395 Ga0070670_100147322
396 Ga0070666_10135780
397 Ga0070682_100045764
398 Ga0068868_100012570
399 Ga0070689_100603942
400 Ga0070691_10042469
401 Ga0070687_100013608
402 Ga0070687_101131713
403 Ga0070661_100489275
404 Ga0070692_10023242
405 Ga0070668_100069304
406 Ga0070669_100106482
407 Ga0070675_100114739
408 Ga0070671_100235751
409 Ga0070671_100252402
410 Ga0070674_101481975
411 Ga0070688_100028502
412 Ga0070659_100054489
413 Ga0070667_100174503
414 Ga0070714_100941931
415 Ga0070713_100128497
416 Ga0070713_100265675
417 Ga0070710_10024415
418 Ga0070710_10169886
419 Ga0070701_10043768
420 Ga0070711_100081037
421 Ga0070711_100368436
422 Ga0070700_100012181
423 Ga0070700_100051988
424 Ga0070700_100709833
425 Ga0070694_100142235
426 Ga0070663_100036306
427 Ga0070678_100071770
428 Ga0070662_100268792
429 Ga0070681_11251943
430 Ga0068867_100067343
431 Ga0070685_10027171
432 Ga0070707_100381275
433 Ga0070679_101221151
434 Ga0070684_100057068
435 Ga0070697_100246710
436 Ga0070672_100099244
437 Ga0070686_100019872
438 Ga0070686_100082087
439 Ga0070693_100248106
440 Ga0070665_100039041
441 Ga0070704_100012943
442 Ga0070664_100030830
443 Ga0070664_100096579
444 Ga0068856_100106949
445 Ga0070702_100011302
446 Ga0068852_100014690
447 Ga0068859_100077777
448 Ga0068859_102282333
449 Ga0068864_100100285
450 Ga0068864_101302736
451 Ga0068866_10440524
452 Ga0068861_100029799
453 Ga0068861_101863249
454 Ga0068870_10007116
455 Ga0068863_100026035
456 Ga0068858_100039704
457 Ga0068858_100994508
458 Ga0068862_100209673
459 Ga0081455_10010062
460 Ga0081455_10013168
461 Ga0081540_1051646
462 Ga0070717_11570310
463 Ga0075365_10008843
464 Ga0075365_10032989
465 Ga0075365_10129946
466 Ga0075365_10155796
467 Ga0075368_10001593
468 Ga0075363_100003567
469 Ga0075363_100266306
470 Ga0075364_10001482
471 Ga0075364_10593158
472 Ga0070715_10050952
473 Ga0070716_101130004
474 Ga0070712_100000152
475 Ga0075362_10008682
476 Ga0075362_10064651
477 Ga0075362_10365437
478 Ga0075367_10000587
479 Ga0075367_10030409
480 Ga0075367_10096425
481 Ga0075367_10918627
482 Ga0075366_10127641
483 Ga0097621_100063473
484 Ga0068871_100021044
485 Ga0075428_100036900
486 Ga0075428_100107114
487 Ga0075430_100017127
488 Ga0075431_100030010
489 Ga0075431_100176873
490 Ga0075434_100539045
491 Ga0075429_100057765
492 Ga0075429_100860144
493 Ga0068865_100022705
494 Ga0097620_100077777
495 Ga0097620_102282019
496 Ga0075435_100295367
497 Ga0099795_10000287
498 Ga0105240_11582108
499 Ga0111539_10085189
500 Ga0111539_10107744
501 Ga0105245_10048362
502 Ga0105247_10036722
503 Ga0114129_10547658
504 Ga0114129_12605949
505 Ga0114129_13127283
506 Ga0105243_10014393
507 Ga0105242_10079120
508 Ga0105248_10096934
509 Ga0105248_10335342
510 Ga0105237_10206608
511 Ga0105238_10670823
512 Ga0105249_10060672
513 Ga0099796_10016575
514 Ga0105239_10088430
515 Ga0105239_11186304
516 Ga0105246_10020763
517 Ga0105246_11501380
518 Ga0157374_10123025
519 Ga0157378_10084823
520 Ga0157372_11798082
521 Ga0157375_10025567
522 Ga0163163_10026657
523 Ga0157380_10264460
524 Ga0157380_13190906
525 Ga0157377_10004321
526 Ga0157379_10025709
527 Ga0157376_10151083
528 Ga0163161_10039792
529 Ga0207710_10054693
530 Ga0207688_10003214
531 Ga0207680_10019445
532 Ga0207685_10161024
533 Ga0207699_10312533
534 Ga0207645_10245402
535 Ga0207643_10002847
536 Ga0207695_11091448
537 Ga0207693_10038508
538 Ga0207663_10141466
539 Ga0207663_10291764
540 Ga0207662_10023964
541 Ga0207662_10191832
542 Ga0207649_11198463
543 Ga0207646_10316522
544 Ga0207681_10052849
545 Ga0207650_10260795
546 Ga0207687_10047797
547 Ga0207700_10093239
548 Ga0207700_10527521
549 Ga0207664_10168332
550 Ga0207644_10218450
551 Ga0207690_10292899
552 Ga0207706_10004780
553 Ga0207706_10325878
554 Ga0207709_10180382
555 Ga0207670_10164414
556 Ga0207669_11546101
557 Ga0207704_10023601
558 Ga0207665_11676438
559 Ga0207691_10033683
560 Ga0207689_10846042
561 Ga0207661_10110522
562 Ga0207679_10058495
563 Ga0207679_10192039
564 Ga0207712_10081762
565 Ga0207712_11400541
566 Ga0207640_10249699
567 Ga0207658_10698737
568 Ga0207677_11906214
569 Ga0207678_10014033
570 Ga0207708_10002701
571 Ga0207702_10594828
572 Ga0207702_10837577
573 Ga0207648_10014026
574 Ga0207676_10098162
575 Ga0207676_11657056
576 Ga0207675_100017215
577 Ga0207683_10021101
578 Ga0207683_10944319
579 Ga0207698_10023812
580 Ga0209813_10012770
581 Ga0207428_10693946
582 Ga0268266_10405657
583 Ga0268265_10041954
584 Ga0268265_10183893
585 Ga0268264_10169246
586 Ga0268264_11751938
587 Ga0307408_100193838
588 Ga0307405_10714892
589 Ga0307406_10516901
590 Ga0307412_11308418
591 Ga0307416_101310007
592 Ga0373934_0062884
593 Ga0373944_0253238
594 Ga0373945_0124232
595 Ga0373945_0134324
596 Ga0373953_0137722
597 Ga0373954_0617347
598 Ga0373956_0004416
599 Ga0373957_0017890
600 Ga0373943_0020404
601 Ga0373943_0602477
602 Ga0373931_1192374
603 Ga0373935_0024507
604 Ga0373935_0326832
605 Ga0373935_0390442
606 Ga0373927_0030702
607 Ga0373927_0068045
608 Ga0373947_0276214
609 Ga0373947_0412879
610 Ga0373937_0025565
611 Ga0373925_0033161
612 Ga0373925_0779456
613 Ga0373925_1295588
614 Ga0395905_1174478
615 Ga0395901_0638752
616 Ga0451793_0470824
617 Ga0451793_1132453
618 Ga0451795_0050364
619 Ga0451841_0607119
620 Ga0451851_0069736
621 Ga0439440_0074860
622 Ga0495603_0064613
623 Ga0495603_0702876
624 Ga0495629_0434784
625 Ga0495638_0005882
626 Ga0495641_0036635
627 Ga0495651_0016818
628 Ga0495582_0141731
629 Ga0495582_0389751
630 Ga0495639_0013718
631 Ga0495662_0119781
632 Ga0495662_0432805
633 Ga0495584_0114072
634 Ga0495584_0709715
635 Ga0495594_0339706
636 Ga0495594_0575128
637 Ga0495607_0088209
638 Ga0495608_0030811
639 Ga0495618_0010923
640 Ga0495620_0107297
641 Ga0495620_0386835
642 Ga0495628_0051959
643 Ga0495630_0048910
644 Ga0495637_0045695
645 Ga0495644_0278887
646 Ga0495666_0054937
647 Ga0495652_0109140
648 Ga0495652_1055794
649 Ga0495633_0032243
650 Ga0495667_0039439
651 Ga0495656_0802444
652 Ga0495634_0040936
653 Ga0495611_0468215
654 Ga0495659_0049025
655 Ga0495659_0138718
656 Ga0495588_0161423
657 Ga0495657_0047033
658 Ga0495623_0013324
659 Ga0495646_0057093
660 Ga0495647_0028465
661 Ga0495658_0029345
662 Ga0495613_0060280
663 Ga0495613_0516016
664 Ga0495624_0240629
665 Ga0495624_0284316
666 Ga0495604_0607688
667 Ga0495674_0028433
668 Ga0495674_0201066
669 Ga0495676_0050196
670 Ga0495676_0659663
671 Ga0495675_0004861
672 Ga0495679_032333
673 Ga0495593_0377547
674 Ga0495602_0021100
675 Ga0495602_0396429
676 Ga0496100_0019696
677 Ga0496101_0039266
678 Ga0496101_0579375
679 Ga0496102_0067821
680 Ga0496102_1911560
681 Ga0496103_0043397
682 Ga0496104_0138035
683 Ga0496105_0017883
684 Ga0496105_0087213
685 Ga0496105_1281013
686 Ga0496106_0003241
687 Ga0496107_0017165
688 Ga0496107_0347525
689 Ga0496107_0921032
690 Ga0496108_0072890
691 Ga0496108_0384388
692 Ga0496109_0025569
693 Ga0496109_1251328
694 Ga0496109_2047886
695 Ga0496110_0002010
696 Ga0496111_0006830
697 Ga0496112_0024610
698 Ga0496112_1387516
699 Ga0496113_0072367
700 Ga0496113_0281115
701 Ga0496114_0127641
702 Ga0496115_0007587
703 Ga0496115_0679762
704 Ga0501041_0128860
705 Ga0501046_0066845
706 Ga0501048_0273239
707 Ga0501069_0461200
708 Ga0501070_0558522
709 Ga0501072_1284588
710 Ga0501074_0499692
711 Ga0501076_0695634
712 Ga0501077_0441284
713 Ga0501080_0778871
714 Ga0501083_0420738
715 nmdc:mga03683_10406_c1
716 nmdc:mga03683_3599_c1
717 nmdc:mga03n38_277784_c1
718 nmdc:mga03n38_928810_c1
719 nmdc:mga03n38_93513_c1
720 nmdc:mga00v17_21455_c1
721 nmdc:mga0yw44_110749_c1
722 nmdc:mga0yw44_477857_c1
723 nmdc:mga0yw44_502919_c1
724 nmdc:mga0yw44_58088_c1
725 nmdc:mga0yw44_78228_c1
726 nmdc:mga0k408_46628_c1
727 nmdc:mga06z11_13125_c1
728 nmdc:mga05p37_2256264_c1
729 nmdc:mga09592_211829_c1
730 nmdc:mga09592_661011_c1
731 nmdc:mga06r32_121301_c1
732 nmdc:mga06r32_45925_c1
733 nmdc:mga08y16_462490_c1
734 nmdc:mga08y16_926461_c1
735 nmdc:mga0n895_220549_c1
736 nmdc:mga0rr50_1090727_c1
737 nmdc:mga0sz30_42954_c2
738 Ga0495601_0035640
739 Ga0495612_0083250
740 Ga0495655_0055808
741 Ga0495655_0169812
742 Ga0495595_0007751
743 Ga0495619_0054311
744 Ga0500650_0506023
745 Ga0500642_0082334
746 Ga0500577_0123956
747 Ga0500588_0106953
748 Ga0500636_0127532
749 Ga0501084_1008584
750 Ga0501082_0068238
751 Ga0530510_0174750
752 2508697232
753 2515629064
754 2874595293
755 2876775229
756 2876824044
757 2879080672
758 2879134742
759 2879144202
760 2935654640
761 2935663583
762 2935981519
763 2935990882
764 2936017739
765 2936026178
766 2936036971
767 2936053077
768 2936059318
769 8016633647
770 8019627045
771 8019635500
772 8019663308
773 8019672926
774 8019683216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kjz-assembly1.cif.gz_A structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant 0.7088 17 68
1kk0-assembly1.cif.gz_A structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi 0.708 17 68
1kk2-assembly1.cif.gz_A structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+ 0.703 17 68
1kk3-assembly1.cif.gz_A structure of the wild-type large gamma subunit of initiation factor eif2 from pyrococcus abyssi complexed with gdp-mg2+ 0.7 17 68
1kk1-assembly1.cif.gz_A structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdpnp-mg2+ 0.6982 17 68
ID Description Score Start End Superfamily
af_Q8JFR5_3_109_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7049 66 80 2.60.40.10
1kk1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6982 17 68 3.40.50.300
af_Q19787_126_170_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.6696 67 83 3.30.160.60
1b71A02 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.6609 19 65 2.20.28.10
af_K7LIV3_36_78_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.5989 64 84 3.30.160.60
ID Description Score Start End GO Terms
AF-A0A853HVH9-F1-model_v4 deleted 0.946 7 77
AF-A0A844T8S6-F1-model_v4 Thaumarchaeal output domain-containing protein 0.9361 2 84
AF-A0A2W7BX42-F1-model_v4 Thaumarchaeal output domain-containing protein 0.9317 1 83
AF-A0A3S8R8C2-F1-model_v4 Thaumarchaeal output domain-containing protein 0.9186 7 77
AF-A0A559S230-F1-model_v4 Thaumarchaeal output domain-containing protein 0.9181 7 77

Map