F430932

General Info

Members Datasets Scaffolds Average Seq Length
387 184 774 477

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0009120|Ga0495669_0009120_1645_3183
Length 512
Sequence MRIAGAIPGKSKGNGDCHRSESAMSDEKKAPVNPLPLKERVKIQRHHMPEQNPQARAHNFQEVNLGYDPELAKSEALRCIACAKPECVKKCPVGVKVREFVDLVVAGDYLGAVAKVREDNVLPAITGRVCPQEEQCELGCVLNKKGSSLAIGHLERFVADYERKTGKLSLPPMAPPTGKRVAIVGSGPAGLTTAGDLIQKGHGVRVFEALHELGGVLVYGIPEFRLPKEIVRQDIDNLRKMGVEFETNVVVGKTVTVDELLNEEGYSAVFVATGAGLPQFLKIPGENLNGVYSANEFLTRVNLMRAYQFPEYDEPVYDVRGKDIAVFGGGNTAMDAVRTSLRLGAKNAYLIYRRSEKEMPARAEEVQHAKEEGVQFVMLTNPAEFVGEGGWLKAVRCSKMELGEPDASGRRRPVAIAGSEYEIPISMAIVAVGTTANPLVQSSTPDLATNKWGYISADQDSLRTSKKAVFAGGDIVTGGATVILAMEAGRKAAKSIHEWLTTGVWETEKVEA

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.26
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.58
Rhizosphere 96.9
Stem 0
Stem Tuber 0
Unclassified 4.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0009120 3300046684 Bacteria 4180
2 Ga0070658_10038969 3300005327 Bacteria 3833
3 Ga0070683_100002530 3300005329 Bacteria 14582
4 Ga0070683_100023287 3300005329 Bacteria 5539
5 Ga0070683_100083257 3300005329 Bacteria 2997
6 Ga0070670_100000455 3300005331 Bacteria 33101
7 Ga0068869_100001514 3300005334 Bacteria 13778
8 Ga0070680_100004893 3300005336 Bacteria 10087
9 Ga0070680_100110295 3300005336 Bacteria 2290
10 Ga0068868_100000109 3300005338 Bacteria 51371
11 Ga0068868_100002523 3300005338 Bacteria 12714
12 Ga0070689_100004000 3300005340 Bacteria 9909
13 Ga0070671_100000568 3300005355 Bacteria 26214
14 Ga0070667_100000358 3300005367 Bacteria 49704
15 Ga0070667_100015305 3300005367 Bacteria 6340
16 Ga0070709_10021360 3300005434 Bacteria 3769
17 Ga0070709_10023955 3300005434 Bacteria 3591
18 Ga0070709_10070252 3300005434 Bacteria 2256
19 Ga0070714_100000060 3300005435 Bacteria 100913
20 Ga0070714_100022891 3300005435 Bacteria 5127
21 Ga0070714_100143939 3300005435 Bacteria 2142
22 Ga0070713_100000287 3300005436 Bacteria 33358
23 Ga0070713_100001637 3300005436 Bacteria 14372
24 Ga0070710_10020712 3300005437 Bacteria 3416
25 Ga0070711_100001303 3300005439 Bacteria 13567
26 Ga0070711_100004701 3300005439 Bacteria 8086
27 Ga0070711_100006197 3300005439 Bacteria 7194
28 Ga0070711_100008442 3300005439 Bacteria 6310
29 Ga0070711_100077549 3300005439 Bacteria 2358
30 Ga0070700_100000020 3300005441 Bacteria 135275
31 Ga0070708_100092478 3300005445 Bacteria 2756
32 Ga0070663_100005288 3300005455 Bacteria 7656
33 Ga0070681_10021201 3300005458 Bacteria 6511
34 Ga0070681_10052184 3300005458 Bacteria 4078
35 Ga0070679_100124974 3300005530 Unclassified 2555
36 Ga0070684_100077993 3300005535 Unclassified 2927
37 Ga0070684_100095719 3300005535 Bacteria 2646
38 Ga0070684_100107414 3300005535 Bacteria 2500
39 Ga0070684_100118109 3300005535 Bacteria 2383
40 Ga0070684_100208514 3300005535 Bacteria 1781
41 Ga0068853_100000666 3300005539 Bacteria 23631
42 Ga0068853_100063800 3300005539 Bacteria 3191
43 Ga0070672_100002377 3300005543 Bacteria 11911
44 Ga0070665_100021552 3300005548 Bacteria 6479
45 Ga0068855_100001650 3300005563 Bacteria 27943
46 Ga0068855_100004786 3300005563 Bacteria 16523
47 Ga0068855_100022732 3300005563 Bacteria 7513
48 Ga0068855_100026120 3300005563 Bacteria 6986
49 Ga0068855_100087154 3300005563 Bacteria 3609
50 Ga0068857_100000162 3300005577 Bacteria 41565
51 Ga0068857_100003418 3300005577 Bacteria 13239
52 Ga0068857_100052015 3300005577 Bacteria 3635
53 Ga0068856_100000384 3300005614 Bacteria 48515
54 Ga0068856_100001235 3300005614 Bacteria 26818
55 Ga0068856_100014595 3300005614 Bacteria 7590
56 Ga0068856_100015329 3300005614 Bacteria 7407
57 Ga0068856_100060786 3300005614 Bacteria 3732
58 Ga0068852_100000015 3300005616 Bacteria 134085
59 Ga0068852_100000384 3300005616 Bacteria 29626
60 Ga0068852_100014127 3300005616 Bacteria 6133
61 Ga0068852_100033188 3300005616 Bacteria 4284
62 Ga0068852_100058099 3300005616 Bacteria 3349
63 Ga0068852_100071061 3300005616 Bacteria 3055
64 Ga0068852_100080859 3300005616 Unclassified 2883
65 Ga0068864_100000097 3300005618 Bacteria 85717
66 Ga0068864_100000299 3300005618 Bacteria 44047
67 Ga0068861_100085445 3300005719 Bacteria 2478
68 Ga0068851_10008016 3300005834 Bacteria 4872
69 Ga0068851_10021210 3300005834 Bacteria 3154
70 Ga0068863_100020512 3300005841 Bacteria 6317
71 Ga0068858_100000243 3300005842 Bacteria 58808
72 Ga0068858_100002478 3300005842 Bacteria 18628
73 Ga0068860_100000820 3300005843 Bacteria 34781
74 Ga0068862_100015361 3300005844 Bacteria 6361
75 Ga0070717_10077248 3300006028 Bacteria 2788
76 Ga0070715_10001644 3300006163 Bacteria 6621
77 Ga0070715_10002510 3300006163 Bacteria 5651
78 Ga0070716_100000137 3300006173 Bacteria 29476
79 Ga0070716_100011946 3300006173 Bacteria 4387
80 Ga0070716_100119909 3300006173 Bacteria 1645
81 Ga0070712_100000057 3300006175 Bacteria 56727
82 Ga0070712_100000154 3300006175 Bacteria 36911
83 Ga0070712_100000819 3300006175 Bacteria 18452
84 Ga0070712_100030573 3300006175 Bacteria 3621
85 Ga0097621_100002005 3300006237 Bacteria 13899
86 Ga0068871_100033310 3300006358 Unclassified 4079
87 Ga0075428_100019855 3300006844 Bacteria 7439
88 Ga0075428_100156650 3300006844 Bacteria 2474
89 Ga0075431_100008614 3300006847 Bacteria 10214
90 Ga0075434_100001763 3300006871 Bacteria 18616
91 Ga0075429_100016336 3300006880 Bacteria 6434
92 Ga0105240_10000181 3300009093 Bacteria 128067
93 Ga0105240_10000248 3300009093 Bacteria 107354
94 Ga0105240_10001374 3300009093 Bacteria 41830
95 Ga0105240_10006329 3300009093 Bacteria 17430
96 Ga0105240_10007690 3300009093 Bacteria 15596
97 Ga0105240_10008414 3300009093 Bacteria 14761
98 Ga0105240_10029376 3300009093 Bacteria 7163
99 Ga0105240_10057363 3300009093 Unclassified 4866
100 Ga0105240_10408920 3300009093 Bacteria 1527
101 Ga0105245_10000639 3300009098 Bacteria 31834
102 Ga0105245_10000893 3300009098 Bacteria 27163
103 Ga0105245_10003243 3300009098 Bacteria 14577
104 Ga0105247_10001077 3300009101 Bacteria 20358
105 Ga0114129_10003031 3300009147 Bacteria 23551
106 Ga0105241_10000151 3300009174 Bacteria 49731
107 Ga0105241_10000419 3300009174 Bacteria 32055
108 Ga0105241_10002238 3300009174 Bacteria 14542
109 Ga0105241_10004295 3300009174 Bacteria 10539
110 Ga0105241_10018864 3300009174 Bacteria 5082
111 Ga0105241_10027380 3300009174 Unclassified 4245
112 Ga0105242_10000622 3300009176 Bacteria 27824
113 Ga0105248_10038991 3300009177 Bacteria 5319
114 Ga0105248_10075516 3300009177 Unclassified 3788
115 Ga0105237_10003460 3300009545 Bacteria 18736
116 Ga0105237_10018913 3300009545 Bacteria 7121
117 Ga0105238_10000515 3300009551 Bacteria 40589
118 Ga0105238_10002914 3300009551 Bacteria 17089
119 Ga0105238_10021511 3300009551 Bacteria 6569
120 Ga0105238_10032896 3300009551 Bacteria 5279
121 Ga0105238_10105309 3300009551 Bacteria 2802
122 Ga0105239_10001019 3300010375 Bacteria 39135
123 Ga0105239_10003195 3300010375 Bacteria 20278
124 Ga0105239_10057001 3300010375 Bacteria 4286
125 Ga0105239_10280338 3300010375 Bacteria 1876
126 Ga0105246_10006055 3300011119 Bacteria 7383
127 Ga0157371_10030596 3300013102 Bacteria 3883
128 Ga0157370_10000007 3300013104 Bacteria 246747
129 Ga0157370_10108146 3300013104 Bacteria 2600
130 Ga0157369_10000241 3300013105 Bacteria 75794
131 Ga0157369_10002459 3300013105 Bacteria 22215
132 Ga0157369_10006946 3300013105 Bacteria 13066
133 Ga0157369_10008061 3300013105 Bacteria 12080
134 Ga0157369_10010070 3300013105 Bacteria 10794
135 Ga0157369_10012973 3300013105 Bacteria 9442
136 Ga0157369_10115947 3300013105 Unclassified 2844
137 Ga0157369_10173461 3300013105 Bacteria 2271
138 Ga0157369_10232923 3300013105 Bacteria 1925
139 Ga0157374_10001461 3300013296 Bacteria 19993
140 Ga0157374_10012686 3300013296 Bacteria 7339
141 Ga0157374_10021967 3300013296 Bacteria 5686
142 Ga0157374_10033112 3300013296 Bacteria 4713
143 Ga0157374_10110645 3300013296 Bacteria 2642
144 Ga0157378_10004708 3300013297 Bacteria 11961
145 Ga0157378_10013264 3300013297 Bacteria 7205
146 Ga0163162_10004734 3300013306 Bacteria 13125
147 Ga0157372_10000014 3300013307 Bacteria 241589
148 Ga0157372_10009944 3300013307 Bacteria 10117
149 Ga0157372_10020270 3300013307 Bacteria 7171
150 Ga0157372_10136224 3300013307 Unclassified 2828
151 Ga0157372_10375843 3300013307 Bacteria 1656
152 Ga0157375_10000001 3300013308 Bacteria 696576
153 Ga0157375_10002537 3300013308 Bacteria 15843
154 Ga0163163_10001513 3300014325 Bacteria 19642
155 Ga0163163_10049260 3300014325 Bacteria 4145
156 Ga0157379_10002769 3300014968 Bacteria 14781
157 Ga0157376_10003311 3300014969 Bacteria 11096
158 Ga0182007_10010654 3300015262 Bacteria 3620
159 Ga0182007_10013686 3300015262 Bacteria 3084
160 Ga0207692_10004761 3300025898 Bacteria 5393
161 Ga0207710_10000592 3300025900 Bacteria 21334
162 Ga0207685_10039959 3300025905 Bacteria 1745
163 Ga0207705_10067547 3300025909 Bacteria 2587
164 Ga0207654_10000244 3300025911 Bacteria 33004
165 Ga0207654_10000671 3300025911 Bacteria 19240
166 Ga0207654_10000864 3300025911 Bacteria 16800
167 Ga0207654_10116934 3300025911 Unclassified 1668
168 Ga0207654_10132436 3300025911 Bacteria 1579
169 Ga0207707_10051100 3300025912 Bacteria 3600
170 Ga0207707_10185590 3300025912 Bacteria 1815
171 Ga0207695_10000069 3300025913 Bacteria 319955
172 Ga0207695_10000137 3300025913 Bacteria 217180
173 Ga0207695_10000388 3300025913 Bacteria 99669
174 Ga0207695_10001244 3300025913 Bacteria 43560
175 Ga0207695_10033773 3300025913 Bacteria 5573
176 Ga0207695_10044932 3300025913 Bacteria 4693
177 Ga0207695_10105334 3300025913 Bacteria 2808
178 Ga0207671_10000042 3300025914 Bacteria 209966
179 Ga0207671_10001016 3300025914 Bacteria 34326
180 Ga0207693_10000004 3300025915 Bacteria 193261
181 Ga0207693_10002657 3300025915 Bacteria 15530
182 Ga0207693_10006994 3300025915 Bacteria 9317
183 Ga0207693_10011752 3300025915 Bacteria 7078
184 Ga0207663_10001360 3300025916 Bacteria 11334
185 Ga0207663_10007720 3300025916 Bacteria 5600
186 Ga0207657_10001299 3300025919 Bacteria 26510
187 Ga0207657_10050847 3300025919 Bacteria 3604
188 Ga0207652_10042769 3300025921 Bacteria 3857
189 Ga0207694_10000163 3300025924 Bacteria 68244
190 Ga0207694_10000377 3300025924 Bacteria 41494
191 Ga0207694_10001699 3300025924 Bacteria 18419
192 Ga0207687_10000242 3300025927 Bacteria 37275
193 Ga0207687_10012297 3300025927 Bacteria 5596
194 Ga0207700_10000307 3300025928 Bacteria 28738
195 Ga0207700_10001456 3300025928 Bacteria 13436
196 Ga0207664_10000017 3300025929 Bacteria 230967
197 Ga0207664_10001242 3300025929 Bacteria 16867
198 Ga0207644_10008894 3300025931 Bacteria 6578
199 Ga0207670_10002508 3300025936 Bacteria 9639
200 Ga0207665_10000140 3300025939 Bacteria 48624
201 Ga0207665_10030782 3300025939 Bacteria 3548
202 Ga0207665_10096399 3300025939 Bacteria 2057
203 Ga0207691_10005822 3300025940 Bacteria 11922
204 Ga0207711_10001691 3300025941 Bacteria 20308
205 Ga0207689_10000791 3300025942 Bacteria 30420
206 Ga0207661_10006356 3300025944 Bacteria 8358
207 Ga0207661_10089810 3300025944 Bacteria 2557
208 Ga0207679_10011798 3300025945 Bacteria 5676
209 Ga0207667_10001680 3300025949 Bacteria 27877
210 Ga0207667_10006729 3300025949 Bacteria 13884
211 Ga0207667_10015896 3300025949 Bacteria 8523
212 Ga0207667_10044412 3300025949 Bacteria 4708
213 Ga0207640_10021373 3300025981 Bacteria 3857
214 Ga0207658_10000191 3300025986 Bacteria 65752
215 Ga0207658_10047714 3300025986 Bacteria 3136
216 Ga0207677_10000035 3300026023 Bacteria 117469
217 Ga0207677_10000383 3300026023 Bacteria 30519
218 Ga0207703_10000046 3300026035 Bacteria 154474
219 Ga0207639_10000051 3300026041 Bacteria 113927
220 Ga0207639_10000237 3300026041 Bacteria 41281
221 Ga0207678_10036032 3300026067 Unclassified 4307
222 Ga0207708_10000021 3300026075 Bacteria 186005
223 Ga0207702_10002473 3300026078 Bacteria 17478
224 Ga0207702_10002813 3300026078 Bacteria 16283
225 Ga0207702_10002939 3300026078 Bacteria 15937
226 Ga0207702_10060407 3300026078 Bacteria 3232
227 Ga0207641_10000570 3300026088 Bacteria 40965
228 Ga0207676_10000013 3300026095 Bacteria 343067
229 Ga0207676_10024408 3300026095 Bacteria 4473
230 Ga0207676_10064433 3300026095 Bacteria 2915
231 Ga0207674_10001394 3300026116 Bacteria 31142
232 Ga0207674_10001892 3300026116 Bacteria 26644
233 Ga0207674_10096191 3300026116 Bacteria 2946
234 Ga0207698_10000006 3300026142 Bacteria 291847
235 Ga0207698_10000187 3300026142 Bacteria 38242
236 Ga0207698_10005761 3300026142 Bacteria 7689
237 Ga0207698_10043610 3300026142 Bacteria 3362
238 Ga0207698_10050634 3300026142 Bacteria 3170
239 Ga0207698_10070835 3300026142 Bacteria 2764
240 Ga0268265_10000806 3300028380 Bacteria 29787
241 Ga0265318_10010233 3300028577 Bacteria 4096
242 Ga0265336_10001083 3300028666 Bacteria 13171
243 Ga0265338_10001174 3300028800 Bacteria 43228
244 Ga0265338_10004745 3300028800 Bacteria 18182
245 Ga0265338_10021827 3300028800 Bacteria 6654
246 Ga0265338_10025362 3300028800 Bacteria 6019
247 Ga0265338_10050002 3300028800 Bacteria 3783
248 Ga0265338_10055597 3300028800 Unclassified 3519
249 Ga0265760_10004913 3300031090 Bacteria 3825
250 Ga0265330_10000439 3300031235 Bacteria 27772
251 Ga0265330_10001102 3300031235 Bacteria 16262
252 Ga0265330_10005860 3300031235 Bacteria 6094
253 Ga0265330_10007627 3300031235 Bacteria 5261
254 Ga0265332_10041902 3300031238 Bacteria 1980
255 Ga0265328_10003214 3300031239 Bacteria 7254
256 Ga0265320_10053068 3300031240 Bacteria 1960
257 Ga0265325_10000335 3300031241 Bacteria 33298
258 Ga0265325_10000632 3300031241 Bacteria 25614
259 Ga0265325_10012268 3300031241 Bacteria 4903
260 Ga0265325_10031777 3300031241 Bacteria 2822
261 Ga0265325_10060993 3300031241 Bacteria 1914
262 Ga0265340_10003930 3300031247 Bacteria 8368
263 Ga0265340_10004813 3300031247 Bacteria 7514
264 Ga0265340_10022080 3300031247 Bacteria 3257
265 Ga0265340_10027851 3300031247 Bacteria 2846
266 Ga0265340_10028787 3300031247 Bacteria 2793
267 Ga0265339_10000003 3300031249 Bacteria 305994
268 Ga0265339_10025324 3300031249 Unclassified 3405
269 Ga0265339_10039758 3300031249 Bacteria 2617
270 Ga0265327_10011824 3300031251 Bacteria 5964
271 Ga0265316_10000008 3300031344 Bacteria 261948
272 Ga0265316_10000473 3300031344 Bacteria 45865
273 Ga0265316_10001361 3300031344 Bacteria 26314
274 Ga0265316_10021734 3300031344 Bacteria 5427
275 Ga0265316_10024610 3300031344 Bacteria 5039
276 Ga0265316_10026709 3300031344 Bacteria 4796
277 Ga0265316_10033150 3300031344 Bacteria 4209
278 Ga0265316_10062124 3300031344 Bacteria 2899
279 Ga0265316_10103917 3300031344 Bacteria 2156
280 Ga0265313_10002810 3300031595 Bacteria 14681
281 Ga0265313_10014526 3300031595 Bacteria 4647
282 Ga0265313_10036001 3300031595 Bacteria 2487
283 Ga0307508_10014784 3300031616 Bacteria 7117
284 Ga0265314_10000025 3300031711 Bacteria 292548
285 Ga0265314_10016205 3300031711 Bacteria 5899
286 Ga0265314_10038318 3300031711 Bacteria 3464
287 Ga0265342_10000702 3300031712 Bacteria 34961
288 Ga0265342_10001852 3300031712 Bacteria 19125
289 Ga0265342_10001853 3300031712 Bacteria 19121
290 Ga0265342_10002204 3300031712 Bacteria 17105
291 Ga0265342_10022064 3300031712 Bacteria 4054
292 Ga0265342_10061956 3300031712 Bacteria 2203
293 Ga0265342_10094896 3300031712 Bacteria 1706
294 Ga0316576_10035078 3300031727 Bacteria 3579
295 Ga0316576_10043722 3300031727 Bacteria 3233
296 Ga0316578_10026231 3300031728 Bacteria 3284
297 Ga0373934_0004292 3300035086 Bacteria 5259
298 Ga0373923_0016398 3300035111 Bacteria 2814
299 Ga0373932_0006780 3300035112 Bacteria 2716
300 Ga0373936_0012407 3300035113 Bacteria 3241
301 Ga0373954_0000962 3300035118 Bacteria 11283
302 Ga0373954_0013684 3300035118 Bacteria 3615
303 Ga0373956_0011702 3300035119 Bacteria 3619
304 Ga0373943_0007714 3300035170 Bacteria 4832
305 Ga0373946_0002850 3300035171 Bacteria 6126
306 Ga0373955_0002768 3300035172 Bacteria 7688
307 Ga0373961_0000278 3300035241 Bacteria 23100
308 Ga0373935_0001452 3300035692 Bacteria 13139
309 Ga0373935_0005626 3300035692 Bacteria 7396
310 Ga0373927_0001907 3300035695 Bacteria 15406
311 Ga0373947_0012473 3300035725 Bacteria 4872
312 Ga0373947_0152968 3300035725 Bacteria 1487
313 Ga0373937_0000476 3300036401 Bacteria 36914
314 Ga0316582_0014925 3300036647 Bacteria 4425
315 Ga0316584_0174974 3300036712 Bacteria 1590
316 Ga0373925_0004427 3300037068 Bacteria 10612
317 Ga0373925_0051042 3300037068 Bacteria 3086
318 Ga0436360_0483664 3300039438 Bacteria 3303
319 Ga0436361_0632757 3300039447 Bacteria 1850
320 Ga0451577_0001802 3300042876 Bacteria 27407
321 Ga0451577_0037934 3300042876 Bacteria 4335
322 Ga0451577_0165253 3300042876 Bacteria 1993
323 Ga0453683_0014465 3300044673 Bacteria 5121
324 Ga0466963_0000691 3300044694 Bacteria 16409
325 Ga0466963_0005635 3300044694 Bacteria 7349
326 Ga0453684_0000106 3300044712 Bacteria 364365
327 Ga0453684_0000480 3300044712 Bacteria 158630
328 Ga0453684_0000685 3300044712 Bacteria 120661
329 Ga0453684_0000748 3300044712 Bacteria 113352
330 Ga0453684_0004534 3300044712 Bacteria 29139
331 Ga0453684_0007740 3300044712 Bacteria 19617
332 Ga0453684_0114627 3300044712 Bacteria 3267
333 Ga0453684_0145885 3300044712 Bacteria 2819
334 Ga0453684_0190087 3300044712 Bacteria 2402
335 Ga0453684_0208146 3300044712 Bacteria 2275
336 Ga0453684_0231243 3300044712 Bacteria 2134
337 Ga0451576_0000058 3300045051 Bacteria 298769
338 Ga0451576_0000379 3300045051 Bacteria 104282
339 Ga0451576_0038071 3300045051 Bacteria 5091
340 Ga0451576_0058952 3300045051 Bacteria 4009
341 Ga0451576_0092922 3300045051 Bacteria 3137
342 Ga0451576_0121228 3300045051 Bacteria 2722
343 Ga0451576_0198019 3300045051 Bacteria 2098
344 Ga0466967_0000520 3300045976 Bacteria 18746
345 Ga0466967_0004628 3300045976 Bacteria 9329
346 Ga0495629_0020451 3300046459 Bacteria 4727
347 Ga0495580_0000830 3300046472 Bacteria 26783
348 Ga0495580_0001031 3300046472 Bacteria 24463
349 Ga0495580_0005406 3300046472 Bacteria 10558
350 Ga0495580_0010648 3300046472 Bacteria 7145
351 Ga0495580_0017878 3300046472 Bacteria 5288
352 Ga0495586_0142050 3300046535 Bacteria 1348
353 Ga0495587_0000814 3300046536 Bacteria 20755
354 Ga0495658_0010489 3300046683 Bacteria 4635
355 Ga0495600_0049849 3300046809 Bacteria 2732
356 Ga0495604_0000606 3300047317 Bacteria 30859
357 Ga0495684_0068789 3300047471 Unclassified 2692
358 Ga0495602_0002143 3300048088 Bacteria 19927
359 Ga0495602_0045702 3300048088 Bacteria 3961
360 Ga0496102_0042372 3300048905 Bacteria 4124
361 Ga0496102_0058225 3300048905 Bacteria 3530
362 Ga0496109_0033256 3300048912 Bacteria 4638
363 Ga0496109_0294752 3300048912 Unclassified 1529
364 Ga0496110_0014135 3300048913 Bacteria 6620
365 Ga0496111_0024059 3300048914 Bacteria 4283
366 Ga0496112_0270845 3300048915 Bacteria 1646
367 Ga0496113_0044787 3300048916 Bacteria 3279
368 Ga0496114_0000001 3300048917 Bacteria 893286
369 Ga0496115_0017838 3300048918 Bacteria 5436
370 Ga0501036_0094450 3300049572 Bacteria 2527
371 Ga0501041_0120972 3300049577 Bacteria 1627
372 Ga0501042_0060982 3300049578 Bacteria 2695
373 Ga0501048_0078088 3300049582 Bacteria 2336
374 Ga0501067_0004428 3300049583 Bacteria 7742
375 Ga0501068_0027485 3300049584 Bacteria 3360
376 Ga0501075_0172205 3300049591 Bacteria 1652
377 Ga0501077_0002974 3300049593 Bacteria 10167
378 Ga0501080_0000898 3300049742 Bacteria 24388
379 Ga0501081_0168223 3300049743 Bacteria 1582
380 nmdc:mga09592_807_c1 3300050508 Bacteria 24210
381 nmdc:mga06r32_521_c1 3300050510 Bacteria 33157
382 nmdc:mga0n895_41189_c1 3300050512 Unclassified 4489
383 nmdc:mga0a205_16164_c1 3300050515 Bacteria 6987
384 Ga0495619_0019677 3300053085 Bacteria 4294
385 Ga0495619_0019986 3300053085 Bacteria 4261
386 Ga0501082_0000518 3300060353 Bacteria 34335
387 2688067461 2687453257 Bacteria 6784659
388 Ga0495669_0009120
389 Ga0070658_10038969
390 Ga0070683_100002530
391 Ga0070683_100023287
392 Ga0070683_100083257
393 Ga0070670_100000455
394 Ga0068869_100001514
395 Ga0070680_100004893
396 Ga0070680_100110295
397 Ga0068868_100000109
398 Ga0068868_100002523
399 Ga0070689_100004000
400 Ga0070671_100000568
401 Ga0070667_100000358
402 Ga0070667_100015305
403 Ga0070709_10021360
404 Ga0070709_10023955
405 Ga0070709_10070252
406 Ga0070714_100000060
407 Ga0070714_100022891
408 Ga0070714_100143939
409 Ga0070713_100000287
410 Ga0070713_100001637
411 Ga0070710_10020712
412 Ga0070711_100001303
413 Ga0070711_100004701
414 Ga0070711_100006197
415 Ga0070711_100008442
416 Ga0070711_100077549
417 Ga0070700_100000020
418 Ga0070708_100092478
419 Ga0070663_100005288
420 Ga0070681_10021201
421 Ga0070681_10052184
422 Ga0070679_100124974
423 Ga0070684_100077993
424 Ga0070684_100095719
425 Ga0070684_100107414
426 Ga0070684_100118109
427 Ga0070684_100208514
428 Ga0068853_100000666
429 Ga0068853_100063800
430 Ga0070672_100002377
431 Ga0070665_100021552
432 Ga0068855_100001650
433 Ga0068855_100004786
434 Ga0068855_100022732
435 Ga0068855_100026120
436 Ga0068855_100087154
437 Ga0068857_100000162
438 Ga0068857_100003418
439 Ga0068857_100052015
440 Ga0068856_100000384
441 Ga0068856_100001235
442 Ga0068856_100014595
443 Ga0068856_100015329
444 Ga0068856_100060786
445 Ga0068852_100000015
446 Ga0068852_100000384
447 Ga0068852_100014127
448 Ga0068852_100033188
449 Ga0068852_100058099
450 Ga0068852_100071061
451 Ga0068852_100080859
452 Ga0068864_100000097
453 Ga0068864_100000299
454 Ga0068861_100085445
455 Ga0068851_10008016
456 Ga0068851_10021210
457 Ga0068863_100020512
458 Ga0068858_100000243
459 Ga0068858_100002478
460 Ga0068860_100000820
461 Ga0068862_100015361
462 Ga0070717_10077248
463 Ga0070715_10001644
464 Ga0070715_10002510
465 Ga0070716_100000137
466 Ga0070716_100011946
467 Ga0070716_100119909
468 Ga0070712_100000057
469 Ga0070712_100000154
470 Ga0070712_100000819
471 Ga0070712_100030573
472 Ga0097621_100002005
473 Ga0068871_100033310
474 Ga0075428_100019855
475 Ga0075428_100156650
476 Ga0075431_100008614
477 Ga0075434_100001763
478 Ga0075429_100016336
479 Ga0105240_10000181
480 Ga0105240_10000248
481 Ga0105240_10001374
482 Ga0105240_10006329
483 Ga0105240_10007690
484 Ga0105240_10008414
485 Ga0105240_10029376
486 Ga0105240_10057363
487 Ga0105240_10408920
488 Ga0105245_10000639
489 Ga0105245_10000893
490 Ga0105245_10003243
491 Ga0105247_10001077
492 Ga0114129_10003031
493 Ga0105241_10000151
494 Ga0105241_10000419
495 Ga0105241_10002238
496 Ga0105241_10004295
497 Ga0105241_10018864
498 Ga0105241_10027380
499 Ga0105242_10000622
500 Ga0105248_10038991
501 Ga0105248_10075516
502 Ga0105237_10003460
503 Ga0105237_10018913
504 Ga0105238_10000515
505 Ga0105238_10002914
506 Ga0105238_10021511
507 Ga0105238_10032896
508 Ga0105238_10105309
509 Ga0105239_10001019
510 Ga0105239_10003195
511 Ga0105239_10057001
512 Ga0105239_10280338
513 Ga0105246_10006055
514 Ga0157371_10030596
515 Ga0157370_10000007
516 Ga0157370_10108146
517 Ga0157369_10000241
518 Ga0157369_10002459
519 Ga0157369_10006946
520 Ga0157369_10008061
521 Ga0157369_10010070
522 Ga0157369_10012973
523 Ga0157369_10115947
524 Ga0157369_10173461
525 Ga0157369_10232923
526 Ga0157374_10001461
527 Ga0157374_10012686
528 Ga0157374_10021967
529 Ga0157374_10033112
530 Ga0157374_10110645
531 Ga0157378_10004708
532 Ga0157378_10013264
533 Ga0163162_10004734
534 Ga0157372_10000014
535 Ga0157372_10009944
536 Ga0157372_10020270
537 Ga0157372_10136224
538 Ga0157372_10375843
539 Ga0157375_10000001
540 Ga0157375_10002537
541 Ga0163163_10001513
542 Ga0163163_10049260
543 Ga0157379_10002769
544 Ga0157376_10003311
545 Ga0182007_10010654
546 Ga0182007_10013686
547 Ga0207692_10004761
548 Ga0207710_10000592
549 Ga0207685_10039959
550 Ga0207705_10067547
551 Ga0207654_10000244
552 Ga0207654_10000671
553 Ga0207654_10000864
554 Ga0207654_10116934
555 Ga0207654_10132436
556 Ga0207707_10051100
557 Ga0207707_10185590
558 Ga0207695_10000069
559 Ga0207695_10000137
560 Ga0207695_10000388
561 Ga0207695_10001244
562 Ga0207695_10033773
563 Ga0207695_10044932
564 Ga0207695_10105334
565 Ga0207671_10000042
566 Ga0207671_10001016
567 Ga0207693_10000004
568 Ga0207693_10002657
569 Ga0207693_10006994
570 Ga0207693_10011752
571 Ga0207663_10001360
572 Ga0207663_10007720
573 Ga0207657_10001299
574 Ga0207657_10050847
575 Ga0207652_10042769
576 Ga0207694_10000163
577 Ga0207694_10000377
578 Ga0207694_10001699
579 Ga0207687_10000242
580 Ga0207687_10012297
581 Ga0207700_10000307
582 Ga0207700_10001456
583 Ga0207664_10000017
584 Ga0207664_10001242
585 Ga0207644_10008894
586 Ga0207670_10002508
587 Ga0207665_10000140
588 Ga0207665_10030782
589 Ga0207665_10096399
590 Ga0207691_10005822
591 Ga0207711_10001691
592 Ga0207689_10000791
593 Ga0207661_10006356
594 Ga0207661_10089810
595 Ga0207679_10011798
596 Ga0207667_10001680
597 Ga0207667_10006729
598 Ga0207667_10015896
599 Ga0207667_10044412
600 Ga0207640_10021373
601 Ga0207658_10000191
602 Ga0207658_10047714
603 Ga0207677_10000035
604 Ga0207677_10000383
605 Ga0207703_10000046
606 Ga0207639_10000051
607 Ga0207639_10000237
608 Ga0207678_10036032
609 Ga0207708_10000021
610 Ga0207702_10002473
611 Ga0207702_10002813
612 Ga0207702_10002939
613 Ga0207702_10060407
614 Ga0207641_10000570
615 Ga0207676_10000013
616 Ga0207676_10024408
617 Ga0207676_10064433
618 Ga0207674_10001394
619 Ga0207674_10001892
620 Ga0207674_10096191
621 Ga0207698_10000006
622 Ga0207698_10000187
623 Ga0207698_10005761
624 Ga0207698_10043610
625 Ga0207698_10050634
626 Ga0207698_10070835
627 Ga0268265_10000806
628 Ga0265318_10010233
629 Ga0265336_10001083
630 Ga0265338_10001174
631 Ga0265338_10004745
632 Ga0265338_10021827
633 Ga0265338_10025362
634 Ga0265338_10050002
635 Ga0265338_10055597
636 Ga0265760_10004913
637 Ga0265330_10000439
638 Ga0265330_10001102
639 Ga0265330_10005860
640 Ga0265330_10007627
641 Ga0265332_10041902
642 Ga0265328_10003214
643 Ga0265320_10053068
644 Ga0265325_10000335
645 Ga0265325_10000632
646 Ga0265325_10012268
647 Ga0265325_10031777
648 Ga0265325_10060993
649 Ga0265340_10003930
650 Ga0265340_10004813
651 Ga0265340_10022080
652 Ga0265340_10027851
653 Ga0265340_10028787
654 Ga0265339_10000003
655 Ga0265339_10025324
656 Ga0265339_10039758
657 Ga0265327_10011824
658 Ga0265316_10000008
659 Ga0265316_10000473
660 Ga0265316_10001361
661 Ga0265316_10021734
662 Ga0265316_10024610
663 Ga0265316_10026709
664 Ga0265316_10033150
665 Ga0265316_10062124
666 Ga0265316_10103917
667 Ga0265313_10002810
668 Ga0265313_10014526
669 Ga0265313_10036001
670 Ga0307508_10014784
671 Ga0265314_10000025
672 Ga0265314_10016205
673 Ga0265314_10038318
674 Ga0265342_10000702
675 Ga0265342_10001852
676 Ga0265342_10001853
677 Ga0265342_10002204
678 Ga0265342_10022064
679 Ga0265342_10061956
680 Ga0265342_10094896
681 Ga0316576_10035078
682 Ga0316576_10043722
683 Ga0316578_10026231
684 Ga0373934_0004292
685 Ga0373923_0016398
686 Ga0373932_0006780
687 Ga0373936_0012407
688 Ga0373954_0000962
689 Ga0373954_0013684
690 Ga0373956_0011702
691 Ga0373943_0007714
692 Ga0373946_0002850
693 Ga0373955_0002768
694 Ga0373961_0000278
695 Ga0373935_0001452
696 Ga0373935_0005626
697 Ga0373927_0001907
698 Ga0373947_0012473
699 Ga0373947_0152968
700 Ga0373937_0000476
701 Ga0316582_0014925
702 Ga0316584_0174974
703 Ga0373925_0004427
704 Ga0373925_0051042
705 Ga0436360_0483664
706 Ga0436361_0632757
707 Ga0451577_0001802
708 Ga0451577_0037934
709 Ga0451577_0165253
710 Ga0453683_0014465
711 Ga0466963_0000691
712 Ga0466963_0005635
713 Ga0453684_0000106
714 Ga0453684_0000480
715 Ga0453684_0000685
716 Ga0453684_0000748
717 Ga0453684_0004534
718 Ga0453684_0007740
719 Ga0453684_0114627
720 Ga0453684_0145885
721 Ga0453684_0190087
722 Ga0453684_0208146
723 Ga0453684_0231243
724 Ga0451576_0000058
725 Ga0451576_0000379
726 Ga0451576_0038071
727 Ga0451576_0058952
728 Ga0451576_0092922
729 Ga0451576_0121228
730 Ga0451576_0198019
731 Ga0466967_0000520
732 Ga0466967_0004628
733 Ga0495629_0020451
734 Ga0495580_0000830
735 Ga0495580_0001031
736 Ga0495580_0005406
737 Ga0495580_0010648
738 Ga0495580_0017878
739 Ga0495586_0142050
740 Ga0495587_0000814
741 Ga0495658_0010489
742 Ga0495600_0049849
743 Ga0495604_0000606
744 Ga0495684_0068789
745 Ga0495602_0002143
746 Ga0495602_0045702
747 Ga0496102_0042372
748 Ga0496102_0058225
749 Ga0496109_0033256
750 Ga0496109_0294752
751 Ga0496110_0014135
752 Ga0496111_0024059
753 Ga0496112_0270845
754 Ga0496113_0044787
755 Ga0496114_0000001
756 Ga0496115_0017838
757 Ga0501036_0094450
758 Ga0501041_0120972
759 Ga0501042_0060982
760 Ga0501048_0078088
761 Ga0501067_0004428
762 Ga0501068_0027485
763 Ga0501075_0172205
764 Ga0501077_0002974
765 Ga0501080_0000898
766 Ga0501081_0168223
767 nmdc:mga09592_807_c1
768 nmdc:mga06r32_521_c1
769 nmdc:mga0n895_41189_c1
770 nmdc:mga0a205_16164_c1
771 Ga0495619_0019677
772 Ga0495619_0019986
773 Ga0501082_0000518
774 2688067461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

183

220

0.97

PF14691

Fer4_20

Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster

56

167

0.97

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

179

489

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wam-assembly1.cif.gz_A structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh- 0.9692 151 187
4mig-assembly1.cif.gz_A pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9553 151 182
7kho-assembly4.cif.gz_D nica2 variant n462v in complex with (s)-nicotine 0.9531 152 187
4mif-assembly1.cif.gz_D pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9522 151 182
8dq8-assembly1.cif.gz_B the structure of nica2 variant f104l/a107t/s146i/g317d/h368r/l449v/n462s in complex with n-methylmyosmine 0.9513 152 187
ID Description Score Start End Superfamily
af_Q46820_444_536_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9761 287 378 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9667 153 186 3.50.50.60
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9567 151 255 3.40.50.720
af_Q2G0U1_9_153_1.10.1060.10 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.9557 17 138 1.10.1060.10
af_Q46820_444_536_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9557 287 378 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A522BJP0-F1-model_v4 NADPH-dependent glutamate synthase (EC 1.4.1.13) 0.983 15 474 GO:0004355
GO:0051536
AF-A0A352ITX6-F1-model_v4 Glutamate synthase small subunit 0.9776 31 138 GO:0051536
AF-A0A3G9EDD2-F1-model_v4 NADPH-dependent glutamate synthase 0.9766 4 473 GO:0016491
GO:0051536
AF-A0A2T4T244-F1-model_v4 Glutamate synthase (NADPH), homotetrameric 0.9763 4 473 GO:0016491
GO:0051536
AF-A0A518H313-F1-model_v4 Glutamate synthase [NADPH] small chain (EC 1.4.1.13) 0.9758 5 245 GO:0004355
GO:0051536

Map