F430793

General Info

Members Datasets Scaffolds Average Seq Length
387 205 387 203

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10046040|Ga0075433_100460402
Length 233
Sequence MKKVRVPFPLFSLQNEIPIRKEEITMKSLPVITMGLLVIGVSVFGCSQQMSGQRDEGWVTLLDGSNPKTLDNWNRIGDANWRAEGDVIVADKGKGGHLVSKNSYKDFQIRAEFWADHTTNSGIFIRISDPKTIGAKSAYEVNIYDQRPEPEYGTGAIVNFAKVSPMPKAGGKWNTYEITAKGPQLTVVLNGIKTVDIQHGQFPEGPFSLQFGNLDKGAPGGPIKWRKVQIKPL

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 1.03
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11577384 3300004799 Bacteria 726
2 Ga0058861_11470621 3300004800 Bacteria 707
3 Ga0058860_11959220 3300004801 Bacteria 704
4 Ga0065712_10001163 3300005290 Bacteria 6613
5 Ga0065715_10091728 3300005293 Bacteria 5581
6 Ga0065707_10088361 3300005295 Bacteria 4682
7 Ga0065707_10148557 3300005295 Bacteria 1680
8 Ga0065707_10382252 3300005295 Unclassified 865
9 Ga0070690_100001896 3300005330 Bacteria 11099
10 Ga0070690_100265561 3300005330 Bacteria 1219
11 Ga0068869_100008055 3300005334 Bacteria 6771
12 Ga0070666_10265706 3300005335 Bacteria 1217
13 Ga0070666_10515727 3300005335 Bacteria 867
14 Ga0070680_100004727 3300005336 Bacteria 10250
15 Ga0070682_100010351 3300005337 Bacteria 5292
16 Ga0068868_100003521 3300005338 Bacteria 10906
17 Ga0070660_100262545 3300005339 Bacteria 1410
18 Ga0070689_100001050 3300005340 Bacteria 17346
19 Ga0070689_100880707 3300005340 Bacteria 791
20 Ga0070691_10010106 3300005341 Bacteria 4302
21 Ga0070691_10158851 3300005341 Bacteria 1164
22 Ga0070687_100001005 3300005343 Bacteria 9608
23 Ga0070687_100293107 3300005343 Bacteria 1029
24 Ga0070692_10004173 3300005345 Bacteria 5987
25 Ga0070669_100279454 3300005353 Bacteria 1337
26 Ga0070669_100325668 3300005353 Bacteria 1242
27 Ga0070675_100234697 3300005354 Bacteria 1601
28 Ga0070675_100334916 3300005354 Bacteria 1339
29 Ga0070671_100074327 3300005355 Bacteria 2840
30 Ga0070671_100203139 3300005355 Bacteria 1681
31 Ga0070671_100383571 3300005355 Bacteria 1201
32 Ga0070659_100850961 3300005366 Unclassified 795
33 Ga0070667_100167990 3300005367 Bacteria 1935
34 Ga0070703_10147959 3300005406 Bacteria 879
35 Ga0070701_10008402 3300005438 Bacteria 4465
36 Ga0070711_100128032 3300005439 Bacteria 1887
37 Ga0070705_100001217 3300005440 Bacteria 13950
38 Ga0070705_100034843 3300005440 Bacteria 2817
39 Ga0070705_100148555 3300005440 Bacteria 1552
40 Ga0070705_100149199 3300005440 Bacteria 1549
41 Ga0070700_100020415 3300005441 Bacteria 3837
42 Ga0070694_100001759 3300005444 Bacteria 12807
43 Ga0070694_100043197 3300005444 Bacteria 3013
44 Ga0070694_100078162 3300005444 Unclassified 2294
45 Ga0070708_100248288 3300005445 Bacteria 1671
46 Ga0070708_100890722 3300005445 Bacteria 836
47 Ga0070662_100006146 3300005457 Bacteria 7722
48 Ga0070662_100696829 3300005457 Bacteria 859
49 Ga0068867_100001927 3300005459 Bacteria 14454
50 Ga0070707_100014003 3300005468 Bacteria 7515
51 Ga0070707_100536647 3300005468 Bacteria 1132
52 Ga0070699_100016611 3300005518 Bacteria 6318
53 Ga0070679_100014870 3300005530 Bacteria 7477
54 Ga0070697_100002971 3300005536 Bacteria 13038
55 Ga0068853_100337788 3300005539 Bacteria 1399
56 Ga0070672_100078089 3300005543 Bacteria 2648
57 Ga0070672_100122439 3300005543 Bacteria 2130
58 Ga0070686_100005731 3300005544 Bacteria 6884
59 Ga0070686_100339573 3300005544 Bacteria 1125
60 Ga0070695_100001196 3300005545 Bacteria 14285
61 Ga0070695_100033975 3300005545 Bacteria 3193
62 Ga0070695_100133646 3300005545 Unclassified 1712
63 Ga0070696_100000077 3300005546 Bacteria 48139
64 Ga0070696_100005007 3300005546 Bacteria 8854
65 Ga0070696_100078189 3300005546 Bacteria 2338
66 Ga0070696_100260435 3300005546 Bacteria 1315
67 Ga0070693_100000848 3300005547 Bacteria 13625
68 Ga0070693_100727209 3300005547 Bacteria 729
69 Ga0070704_100001029 3300005549 Bacteria 14361
70 Ga0070704_100142738 3300005549 Bacteria 1872
71 Ga0070704_100154587 3300005549 Bacteria 1808
72 Ga0068855_100002124 3300005563 Bacteria 24517
73 Ga0068856_100004104 3300005614 Bacteria 14556
74 Ga0070702_100000323 3300005615 Bacteria 16623
75 Ga0070702_100630219 3300005615 Unclassified 808
76 Ga0068859_100006422 3300005617 Bacteria 11929
77 Ga0068859_101785246 3300005617 Bacteria 679
78 Ga0068866_10002341 3300005718 Bacteria 7850
79 Ga0068861_100003264 3300005719 Bacteria 10726
80 Ga0068870_10024899 3300005840 Bacteria 2965
81 Ga0068863_100358631 3300005841 Bacteria 1421
82 Ga0068858_100127151 3300005842 Bacteria 2387
83 Ga0068860_100015325 3300005843 Bacteria 7488
84 Ga0068860_100682988 3300005843 Bacteria 1036
85 Ga0068862_100011120 3300005844 Bacteria 7431
86 Ga0068862_100290236 3300005844 Bacteria 1502
87 Ga0081455_10001451 3300005937 Bacteria 29326
88 Ga0081538_10021796 3300005981 Bacteria 4662
89 Ga0075432_10044066 3300006058 Bacteria 1564
90 Ga0070716_100009831 3300006173 Bacteria 4779
91 Ga0070716_100098736 3300006173 Bacteria 1785
92 Ga0070716_100151596 3300006173 Unclassified 1492
93 Ga0070712_100206334 3300006175 Bacteria 1547
94 Ga0075366_10154058 3300006195 Bacteria 1392
95 Ga0097621_100001582 3300006237 Bacteria 15576
96 Ga0068871_100005950 3300006358 Bacteria 8585
97 Ga0075428_100000333 3300006844 Bacteria 46836
98 Ga0075428_100264257 3300006844 Bacteria 1852
99 Ga0075428_100649082 3300006844 Bacteria 1125
100 Ga0075430_100068045 3300006846 Unclassified 2988
101 Ga0075430_100654074 3300006846 Bacteria 867
102 Ga0075430_100751964 3300006846 Unclassified 803
103 Ga0075431_100054123 3300006847 Bacteria 4138
104 Ga0075431_100162778 3300006847 Bacteria 2294
105 Ga0075431_100370401 3300006847 Unclassified 1437
106 Ga0075431_100441938 3300006847 Bacteria 1297
107 Ga0075431_100628551 3300006847 Bacteria 1056
108 Ga0075433_10004173 3300006852 Bacteria 11217
109 Ga0075433_10020589 3300006852 Bacteria 5520
110 Ga0075433_10046040 3300006852 Bacteria 3792
111 Ga0075433_10200633 3300006852 Unclassified 1773
112 Ga0075434_100000283 3300006871 Bacteria 36124
113 Ga0075434_100000430 3300006871 Bacteria 31085
114 Ga0075434_100000758 3300006871 Bacteria 25478
115 Ga0075434_100054072 3300006871 Bacteria 3989
116 Ga0075434_100091198 3300006871 Bacteria 3049
117 Ga0075434_100094195 3300006871 Bacteria 2999
118 Ga0075434_100375082 3300006871 Bacteria 1444
119 Ga0075429_100000477 3300006880 Bacteria 29899
120 Ga0075429_100002725 3300006880 Bacteria 14908
121 Ga0075429_100129275 3300006880 Unclassified 2209
122 Ga0068865_100038970 3300006881 Bacteria 3220
123 Ga0075436_100006608 3300006914 Bacteria 7947
124 Ga0075436_100056337 3300006914 Bacteria 2715
125 Ga0075436_100154695 3300006914 Bacteria 1615
126 Ga0075436_100173460 3300006914 Bacteria 1522
127 Ga0075436_100187113 3300006914 Bacteria 1464
128 Ga0097620_100006422 3300006931 Bacteria 11929
129 Ga0075435_100017371 3300007076 Bacteria 5445
130 Ga0075435_100023326 3300007076 Bacteria 4783
131 Ga0075435_100283883 3300007076 Bacteria 1413
132 Ga0075435_100361632 3300007076 Unclassified 1245
133 Ga0099794_10005575 3300007265 Bacteria 5058
134 Ga0099794_10081027 3300007265 Bacteria 1601
135 Ga0111539_10010515 3300009094 Bacteria 11648
136 Ga0111539_10053550 3300009094 Bacteria 4803
137 Ga0111539_10139705 3300009094 Bacteria 2836
138 Ga0111539_11256669 3300009094 Unclassified 859
139 Ga0105245_10001913 3300009098 Bacteria 18907
140 Ga0105245_10076619 3300009098 Bacteria 3047
141 Ga0114129_10001303 3300009147 Bacteria 33282
142 Ga0114129_10003446 3300009147 Bacteria 22243
143 Ga0114129_10126590 3300009147 Bacteria 3512
144 Ga0114129_10168232 3300009147 Unclassified 2990
145 Ga0114129_10211418 3300009147 Bacteria 2622
146 Ga0114129_10217951 3300009147 Bacteria 2576
147 Ga0114129_10317260 3300009147 Unclassified 2073
148 Ga0105243_10002363 3300009148 Bacteria 15791
149 Ga0105243_10426801 3300009148 Bacteria 1238
150 Ga0105241_10012167 3300009174 Bacteria 6316
151 Ga0105242_10005151 3300009176 Bacteria 10082
152 Ga0105242_10031879 3300009176 Bacteria 4213
153 Ga0105237_10808592 3300009545 Bacteria 944
154 Ga0105249_10005837 3300009553 Bacteria 10653
155 Ga0105249_10413462 3300009553 Bacteria 1381
156 Ga0105239_10012333 3300010375 Bacteria 9519
157 Ga0105246_10415494 3300011119 Unclassified 1121
158 Ga0157378_10004930 3300013297 Bacteria 11697
159 Ga0157378_10463205 3300013297 Bacteria 1260
160 Ga0163162_10033330 3300013306 Bacteria 5117
161 Ga0157375_10630908 3300013308 Bacteria 1229
162 Ga0157375_11078726 3300013308 Bacteria 939
163 Ga0157377_10052692 3300014745 Bacteria 2298
164 Ga0157376_10002639 3300014969 Bacteria 12199
165 Ga0207697_10034238 3300025315 Bacteria 2079
166 Ga0207642_10002611 3300025899 Bacteria 5610
167 Ga0207688_10392953 3300025901 Bacteria 859
168 Ga0207685_10018530 3300025905 Bacteria 2275
169 Ga0207643_10031303 3300025908 Bacteria 2965
170 Ga0207684_10192401 3300025910 Bacteria 1760
171 Ga0207693_10063205 3300025915 Bacteria 2900
172 Ga0207662_10000837 3300025918 Bacteria 14164
173 Ga0207657_10290229 3300025919 Bacteria 1297
174 Ga0207649_10906986 3300025920 Unclassified 691
175 Ga0207646_10014592 3300025922 Bacteria 7451
176 Ga0207646_10462048 3300025922 Bacteria 1145
177 Ga0207681_10035278 3300025923 Bacteria 3294
178 Ga0207659_10199965 3300025926 Bacteria 1595
179 Ga0207659_10312386 3300025926 Bacteria 1294
180 Ga0207687_10023729 3300025927 Bacteria 4091
181 Ga0207644_10626199 3300025931 Bacteria 894
182 Ga0207690_10088113 3300025932 Unclassified 2186
183 Ga0207690_10729700 3300025932 Unclassified 816
184 Ga0207706_10313095 3300025933 Bacteria 1366
185 Ga0207706_10859008 3300025933 Bacteria 768
186 Ga0207686_10013925 3300025934 Bacteria 4462
187 Ga0207686_10123726 3300025934 Bacteria 1764
188 Ga0207709_10001762 3300025935 Bacteria 14545
189 Ga0207670_10003076 3300025936 Bacteria 8811
190 Ga0207704_10012950 3300025938 Bacteria 4156
191 Ga0207665_10017478 3300025939 Bacteria 4713
192 Ga0207665_10278351 3300025939 Bacteria 1244
193 Ga0207691_10751380 3300025940 Unclassified 821
194 Ga0207689_10000500 3300025942 Bacteria 37039
195 Ga0207667_10091307 3300025949 Bacteria 3146
196 Ga0207712_10017558 3300025961 Bacteria 4649
197 Ga0207677_10030988 3300026023 Bacteria 3421
198 Ga0207703_10019496 3300026035 Bacteria 5301
199 Ga0207639_10294812 3300026041 Bacteria 1431
200 Ga0207708_10002007 3300026075 Bacteria 14983
201 Ga0207641_10398296 3300026088 Bacteria 1321
202 Ga0207641_10828942 3300026088 Unclassified 916
203 Ga0207648_10000691 3300026089 Bacteria 37799
204 Ga0207675_100000807 3300026118 Bacteria 31139
205 Ga0207683_10081001 3300026121 Bacteria 2881
206 Ga0209588_1001734 3300027671 Bacteria 5770
207 Ga0207428_10007757 3300027907 Bacteria 9768
208 Ga0207428_10230040 3300027907 Bacteria 1388
209 Ga0268265_11364301 3300028380 Bacteria 710
210 Ga0268264_10006775 3300028381 Bacteria 9623
211 Ga0268264_11148232 3300028381 Bacteria 786
212 Ga0307408_100138996 3300031548 Unclassified 1904
213 Ga0307408_100249612 3300031548 Unclassified 1463
214 Ga0307407_10383766 3300031903 Unclassified 1004
215 Ga0307412_10319177 3300031911 Bacteria 1235
216 Ga0307412_11230747 3300031911 Bacteria 671
217 Ga0307409_100068438 3300031995 Bacteria 2808
218 Ga0307416_100147191 3300032002 Unclassified 2153
219 Ga0307416_100198840 3300032002 Unclassified 1899
220 Ga0307411_10096290 3300032005 Bacteria 2080
221 Ga0373948_0020626 3300034817 Bacteria 1256
222 Ga0373959_0049023 3300034820 Bacteria 907
223 Ga0373938_0007887 3300034957 Bacteria 1887
224 Ga0373929_0113657 3300035085 Unclassified 695
225 Ga0373944_0012595 3300035089 Bacteria 2333
226 Ga0373944_0124411 3300035089 Unclassified 891
227 Ga0373923_0015287 3300035111 Bacteria 2896
228 Ga0373932_0037149 3300035112 Unclassified 1387
229 Ga0373932_0048994 3300035112 Bacteria 1247
230 Ga0373936_0011360 3300035113 Bacteria 3370
231 Ga0373936_0042315 3300035113 Unclassified 1828
232 Ga0373941_0009007 3300035115 Bacteria 2502
233 Ga0373960_0035488 3300035121 Bacteria 1416
234 Ga0373960_0094221 3300035121 Bacteria 962
235 Ga0373943_0014131 3300035170 Bacteria 3610
236 Ga0373943_0085372 3300035170 Bacteria 1625
237 Ga0373946_0004348 3300035171 Bacteria 5072
238 Ga0373961_0060936 3300035241 Bacteria 1145
239 Ga0373931_0002890 3300035691 Bacteria 7658
240 Ga0373931_0024136 3300035691 Bacteria 3077
241 Ga0373931_0025666 3300035691 Bacteria 2993
242 Ga0373931_0055335 3300035691 Unclassified 2123
243 Ga0373931_0153339 3300035691 Bacteria 1345
244 Ga0373931_0458000 3300035691 Unclassified 817
245 Ga0373927_0026039 3300035695 Bacteria 3823
246 Ga0373947_0067858 3300035725 Bacteria 2179
247 Ga0373947_0122600 3300035725 Unclassified 1652
248 Ga0373925_0066498 3300037068 Bacteria 2717
249 Ga0373925_0470431 3300037068 Unclassified 1030
250 Ga0451577_0335379 3300042876 Unclassified 1371
251 Ga0451577_0811709 3300042876 Unclassified 845
252 Ga0453684_0243468 3300044712 Bacteria 2069
253 Ga0453684_0385610 3300044712 Bacteria 1572
254 Ga0451576_0067622 3300045051 Bacteria 3720
255 Ga0451576_0078357 3300045051 Bacteria 3439
256 Ga0451576_0184761 3300045051 Unclassified 2177
257 Ga0451576_0702614 3300045051 Bacteria 1062
258 Ga0451576_1137003 3300045051 Bacteria 816
259 Ga0495603_0034893 3300046455 Bacteria 3023
260 Ga0495603_0388368 3300046455 Unclassified 800
261 Ga0495580_0002475 3300046472 Bacteria 16114
262 Ga0495580_0071786 3300046472 Bacteria 2418
263 Ga0495582_0080002 3300046473 Bacteria 1814
264 Ga0495594_0030022 3300046499 Bacteria 2940
265 Ga0495594_0274716 3300046499 Unclassified 960
266 Ga0495630_0048100 3300046517 Bacteria 3192
267 Ga0495666_0202796 3300046526 Bacteria 911
268 Ga0495665_0034222 3300046531 Bacteria 2717
269 Ga0495586_0038705 3300046535 Bacteria 2562
270 Ga0495588_0003824 3300046674 Bacteria 6597
271 Ga0495647_0000325 3300046681 Bacteria 13424
272 Ga0495669_0032357 3300046684 Bacteria 2299
273 Ga0495581_0005621 3300047315 Bacteria 7266
274 Ga0495636_0033960 3300047318 Bacteria 2098
275 Ga0495676_0096395 3300047321 Bacteria 2199
276 Ga0496104_0267578 3300048907 Bacteria 1622
277 Ga0496110_0184756 3300048913 Bacteria 1893
278 Ga0496112_0038882 3300048915 Unclassified 4648
279 Ga0496113_0231026 3300048916 Unclassified 1475
280 Ga0501031_0258289 3300049568 Bacteria 1132
281 Ga0501031_0302817 3300049568 Unclassified 1036
282 Ga0501031_0686554 3300049568 Bacteria 657
283 Ga0501037_0030779 3300049573 Unclassified 3964
284 Ga0501038_0009480 3300049574 Bacteria 8930
285 Ga0501039_0016291 3300049575 Bacteria 5694
286 Ga0501040_0020272 3300049576 Unclassified 4430
287 Ga0501040_0120125 3300049576 Bacteria 1844
288 Ga0501040_0205895 3300049576 Unclassified 1398
289 Ga0501040_0244271 3300049576 Bacteria 1280
290 Ga0501041_0005809 3300049577 Bacteria 7213
291 Ga0501042_0781765 3300049578 Bacteria 695
292 Ga0501046_0500012 3300049580 Bacteria 871
293 Ga0501048_0701053 3300049582 Bacteria 727
294 Ga0501069_0148983 3300049585 Bacteria 1344
295 Ga0501069_0369986 3300049585 Unclassified 846
296 Ga0501070_0425599 3300049586 Unclassified 1072
297 Ga0501070_1068583 3300049586 Bacteria 624
298 Ga0501071_0003510 3300049587 Bacteria 9805
299 Ga0501072_0016790 3300049588 Bacteria 5621
300 Ga0501072_0534884 3300049588 Unclassified 926
301 Ga0501073_0364487 3300049589 Bacteria 998
302 Ga0501073_0443842 3300049589 Bacteria 897
303 Ga0501074_0108732 3300049590 Unclassified 1984
304 Ga0501075_0002762 3300049591 Bacteria 11762
305 Ga0501075_0106947 3300049591 Bacteria 2126
306 Ga0501075_0237375 3300049591 Unclassified 1390
307 Ga0501076_0004360 3300049592 Bacteria 10046
308 Ga0501076_0301740 3300049592 Bacteria 1313
309 Ga0501077_0011950 3300049593 Bacteria 5431
310 Ga0501077_0012826 3300049593 Bacteria 5253
311 Ga0501077_0038098 3300049593 Bacteria 3061
312 Ga0501077_0481656 3300049593 Unclassified 795
313 Ga0501079_0008055 3300049741 Bacteria 7983
314 Ga0501079_0358433 3300049741 Bacteria 1143
315 Ga0501080_0003078 3300049742 Bacteria 14729
316 Ga0501080_0185175 3300049742 Bacteria 1915
317 Ga0501081_0007823 3300049743 Bacteria 6929
318 Ga0501081_0091738 3300049743 Bacteria 2137
319 Ga0501081_0357464 3300049743 Unclassified 1077
320 Ga0501045_0013848 3300049824 Bacteria 5703
321 Ga0501045_0382946 3300049824 Bacteria 1047
322 nmdc:mga0k408_197700_c1 3300050493 Unclassified 1200
323 nmdc:mga05p37_1125_c1 3300050507 Bacteria 30729
324 nmdc:mga05p37_12793_c1 3300050507 Bacteria 10030
325 nmdc:mga05p37_136020_c1 3300050507 Bacteria 3013
326 nmdc:mga05p37_148631_c1 3300050507 Bacteria 2868
327 nmdc:mga05p37_1506102_c1 3300050507 Bacteria 669
328 nmdc:mga05p37_1535454_c1 3300050507 Bacteria 661
329 nmdc:mga05p37_33117_c1 3300050507 Bacteria 6329
330 nmdc:mga05p37_42888_c1 3300050507 Bacteria 5562
331 nmdc:mga05p37_64107_c1 3300050507 Bacteria 4522
332 nmdc:mga05p37_846843_c1 3300050507 Unclassified 994
333 nmdc:mga09592_233822_c1 3300050508 Bacteria 1592
334 nmdc:mga09592_5250_c1 3300050508 Bacteria 10522
335 nmdc:mga09592_54266_c1 3300050508 Bacteria 3386
336 nmdc:mga09592_617_c1 3300050508 Bacteria 27114
337 nmdc:mga09592_63463_c1 3300050508 Bacteria 3127
338 nmdc:mga0qj67_162365_c1 3300050509 Bacteria 1813
339 nmdc:mga0qj67_267715_c1 3300050509 Bacteria 1386
340 nmdc:mga06r32_103587_c1 3300050510 Bacteria 2794
341 nmdc:mga06r32_198207_c1 3300050510 Bacteria 1995
342 nmdc:mga06r32_315141_c1 3300050510 Bacteria 1550
343 nmdc:mga06r32_46033_c1 3300050510 Unclassified 4162
344 nmdc:mga06r32_522426_c1 3300050510 Bacteria 1163
345 nmdc:mga06r32_759613_c1 3300050510 Bacteria 932
346 nmdc:mga06r32_89123_c1 3300050510 Bacteria 3012
347 nmdc:mga08y16_100508_c1 3300050511 Bacteria 3011
348 nmdc:mga08y16_158274_c1 3300050511 Bacteria 2354
349 nmdc:mga08y16_23092_c1 3300050511 Bacteria 6568
350 nmdc:mga08y16_962231_c1 3300050511 Bacteria 836
351 nmdc:mga0n895_10200_c1 3300050512 Bacteria 8277
352 nmdc:mga0n895_145480_c1 3300050512 Bacteria 2400
353 nmdc:mga0n895_156517_c1 3300050512 Bacteria 2309
354 nmdc:mga0n895_3486_c1 3300050512 Bacteria 12698
355 nmdc:mga0n895_392395_c1 3300050512 Bacteria 1404
356 nmdc:mga0n895_478586_c1 3300050512 Bacteria 1256
357 nmdc:mga0n895_757654_c1 3300050512 Unclassified 964
358 nmdc:mga0n895_94671_c1 3300050512 Bacteria 2991
359 nmdc:mga0rr50_125789_c1 3300050513 Bacteria 2047
360 nmdc:mga0rr50_15345_c1 3300050513 Bacteria 5054
361 nmdc:mga0rr50_167039_c1 3300050513 Unclassified 1790
362 nmdc:mga0rr50_1817_c1 3300050513 Bacteria 11802
363 nmdc:mga0rr50_243210_c1 3300050513 Bacteria 1492
364 nmdc:mga0rr50_523404_c1 3300050513 Bacteria 1009
365 nmdc:mga08x19_100266_c1 3300050514 Bacteria 1921
366 nmdc:mga08x19_16428_c1 3300050514 Bacteria 4516
367 nmdc:mga08x19_179826_c1 3300050514 Bacteria 1443
368 nmdc:mga08x19_230959_c1 3300050514 Bacteria 1273
369 nmdc:mga08x19_294157_c1 3300050514 Bacteria 1127
370 nmdc:mga08x19_442883_c1 3300050514 Bacteria 914
371 nmdc:mga08x19_75995_c1 3300050514 Bacteria 2197
372 nmdc:mga0a205_12968_c1 3300050515 Bacteria 7735
373 nmdc:mga0a205_19504_c1 3300050515 Bacteria 6394
374 nmdc:mga0a205_207035_c2 3300050515 Unclassified 1508
375 nmdc:mga0a205_26199_c1 3300050515 Bacteria 5557
376 nmdc:mga0a205_450549_c1 3300050515 Bacteria 1147
377 nmdc:mga0a205_49573_c1 3300050515 Bacteria 4054
378 nmdc:mga0a205_838_c2 3300050515 Bacteria 8005
379 Ga0501084_0003766 3300054114 Bacteria 12332
380 Ga0501084_0642490 3300054114 Unclassified 896
381 Ga0590077_015067 3300059426 Bacteria 1614
382 Ga0501082_0003627 3300060353 Bacteria 13486
383 Ga0501082_0195381 3300060353 Bacteria 1760
384 Ga0501082_0517743 3300060353 Bacteria 1043
385 Ga0530510_0000443 3300061734 Bacteria 26727
386 Ga0530510_0086519 3300061734 Unclassified 2283
387 Ga0530510_0378434 3300061734 Bacteria 1065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0369986 Ga0501069_0369986_22_522 163
2 3300031548 Ga0307408_100249612 Ga0307408_1002496123 170
3 3300049586 Ga0501070_1068583 Ga0501070_1068583_87_608 170
4 3300049743 Ga0501081_0091738 Ga0501081_0091738_1527_2075 179
5 3300046499 Ga0495594_0274716 Ga0495594_0274716_82_684 181
6 3300049576 Ga0501040_0244271 Ga0501040_0244271_506_1117 182
7 3300049582 Ga0501048_0701053 Ga0501048_0701053_36_656 183
8 3300049568 Ga0501031_0258289 Ga0501031_0258289_51_668 184
9 3300049576 Ga0501040_0120125 Ga0501040_0120125_219_836 184
10 3300049589 Ga0501073_0443842 Ga0501073_0443842_255_872 184
11 3300049591 Ga0501075_0106947 Ga0501075_0106947_1267_1884 184
12 3300061734 Ga0530510_0378434 Ga0530510_0378434_184_801 184
13 3300005355 Ga0070671_100383571 Ga0070671_1003835712 188
14 3300005546 Ga0070696_100260435 Ga0070696_1002604352 188
15 3300005549 Ga0070704_100154587 Ga0070704_1001545874 188
16 3300005841 Ga0068863_100358631 Ga0068863_1003586312 188
17 3300005843 Ga0068860_100682988 Ga0068860_1006829881 188
18 3300005844 Ga0068862_100290236 Ga0068862_1002902364 188
19 3300026088 Ga0207641_10398296 Ga0207641_103982962 188
20 3300028380 Ga0268265_11364301 Ga0268265_113643011 188
21 3300028381 Ga0268264_11148232 Ga0268264_111482322 188
22 3300048907 Ga0496104_0267578 Ga0496104_0267578_341_958 188
23 3300005366 Ga0070659_100850961 Ga0070659_1008509611 189
24 3300005544 Ga0070686_100339573 Ga0070686_1003395731 189
25 3300005549 Ga0070704_100142738 Ga0070704_1001427382 189
26 3300005615 Ga0070702_100630219 Ga0070702_1006302191 189
27 3300005617 Ga0068859_101785246 Ga0068859_1017852461 189
28 3300009094 Ga0111539_11256669 Ga0111539_112566691 189
29 3300009553 Ga0105249_10413462 Ga0105249_104134621 189
30 3300025932 Ga0207690_10729700 Ga0207690_107297001 189
31 3300035115 Ga0373941_0009007 Ga0373941_0009007_662_1276 189
32 3300035121 Ga0373960_0035488 Ga0373960_0035488_21_635 189
33 3300035691 Ga0373931_0025666 Ga0373931_0025666_1082_1696 189
34 3300046684 Ga0495669_0032357 Ga0495669_0032357_951_1526 189
35 3300005295 Ga0065707_10148557 Ga0065707_101485572 191
36 3300006847 Ga0075431_100054123 Ga0075431_1000541232 191
37 3300009147 Ga0114129_10126590 Ga0114129_101265903 191
38 3300050507 nmdc:mga05p37_64107_c1 nmdc:mga05p37_64107_c1_779_1459 191
39 3300050510 nmdc:mga06r32_89123_c1 nmdc:mga06r32_89123_c1_475_1155 191
40 3300050512 nmdc:mga0n895_478586_c1 nmdc:mga0n895_478586_c1_288_968 191
41 3300045051 Ga0451576_0702614 Ga0451576_0702614_105_722 192
42 3300006852 Ga0075433_10004173 Ga0075433_100041737 193
43 3300006871 Ga0075434_100000430 Ga0075434_10000043010 193
44 3300006880 Ga0075429_100002725 Ga0075429_1000027255 193
45 3300009147 Ga0114129_10003446 Ga0114129_100034467 193
46 3300050507 nmdc:mga05p37_42888_c1 nmdc:mga05p37_42888_c1_1427_2047 193
47 3300050508 nmdc:mga09592_5250_c1 nmdc:mga09592_5250_c1_347_967 193
48 3300050512 nmdc:mga0n895_3486_c1 nmdc:mga0n895_3486_c1_6688_7308 193
49 3300050513 nmdc:mga0rr50_1817_c1 nmdc:mga0rr50_1817_c1_355_975 193
50 3300050515 nmdc:mga0a205_838_c2 nmdc:mga0a205_838_c2_3998_4618 193
51 3300006058 Ga0075432_10044066 Ga0075432_100440662 194
52 3300006844 Ga0075428_100649082 Ga0075428_1006490822 194
53 3300006847 Ga0075431_100441938 Ga0075431_1004419382 194
54 3300009147 Ga0114129_10211418 Ga0114129_102114183 194
55 3300049585 Ga0501069_0148983 Ga0501069_0148983_248_844 194
56 3300050507 nmdc:mga05p37_136020_c1 nmdc:mga05p37_136020_c1_127_723 194
57 3300050507 nmdc:mga05p37_148631_c1 nmdc:mga05p37_148631_c1_1093_1719 194
58 3300050510 nmdc:mga06r32_522426_c1 nmdc:mga06r32_522426_c1_213_839 194
59 3300050513 nmdc:mga0rr50_523404_c1 nmdc:mga0rr50_523404_c1_189_785 194
60 3300050514 nmdc:mga08x19_100266_c1 nmdc:mga08x19_100266_c1_980_1576 194
61 3300050514 nmdc:mga08x19_75995_c1 nmdc:mga08x19_75995_c1_921_1517 194
62 3300005343 Ga0070687_100293107 Ga0070687_1002931072 195
63 3300006846 Ga0075430_100751964 Ga0075430_1007519641 195
64 3300035691 Ga0373931_0458000 Ga0373931_0458000_15_617 195
65 3300045051 Ga0451576_0067622 Ga0451576_0067622_3099_3701 195
66 3300049580 Ga0501046_0500012 Ga0501046_0500012_202_801 195
67 3300050515 nmdc:mga0a205_450549_c1 nmdc:mga0a205_450549_c1_199_801 195
68 3300005353 Ga0070669_100325668 Ga0070669_1003256683 196
69 3300009147 Ga0114129_10317260 Ga0114129_103172602 196
70 3300013297 Ga0157378_10463205 Ga0157378_104632052 196
71 3300035691 Ga0373931_0153339 Ga0373931_0153339_703_1299 196
72 3300045051 Ga0451576_0184761 Ga0451576_0184761_264_869 196
73 3300045051 Ga0451576_1137003 Ga0451576_1137003_45_641 196
74 3300046455 Ga0495603_0388368 Ga0495603_0388368_171_773 196
75 3300046472 Ga0495580_0002475 Ga0495580_0002475_2821_3417 196
76 3300050507 nmdc:mga05p37_846843_c1 nmdc:mga05p37_846843_c1_130_732 196
77 3300050513 nmdc:mga0rr50_243210_c1 nmdc:mga0rr50_243210_c1_452_1078 196
78 3300050514 nmdc:mga08x19_442883_c1 nmdc:mga08x19_442883_c1_91_693 196
79 3300050515 nmdc:mga0a205_12968_c1 nmdc:mga0a205_12968_c1_3896_4498 196
80 3300060353 Ga0501082_0195381 Ga0501082_0195381_104_721 196
81 3300061734 Ga0530510_0000443 Ga0530510_0000443_10164_10781 196
82 3300005330 Ga0070690_100265561 Ga0070690_1002655612 197
83 3300006846 Ga0075430_100068045 Ga0075430_1000680452 197
84 3300006871 Ga0075434_100094195 Ga0075434_1000941954 197
85 3300006880 Ga0075429_100129275 Ga0075429_1001292752 197
86 3300009094 Ga0111539_10010515 Ga0111539_100105152 197
87 3300027907 Ga0207428_10230040 Ga0207428_102300401 197
88 3300035085 Ga0373929_0113657 Ga0373929_0113657_47_658 197
89 3300049743 Ga0501081_0357464 Ga0501081_0357464_194_802 197
90 3300050507 nmdc:mga05p37_12793_c1 nmdc:mga05p37_12793_c1_8864_9484 197
91 3300050510 nmdc:mga06r32_46033_c1 nmdc:mga06r32_46033_c1_1668_2288 197
92 3300050511 nmdc:mga08y16_23092_c1 nmdc:mga08y16_23092_c1_4649_5269 197
93 3300050511 nmdc:mga08y16_962231_c1 nmdc:mga08y16_962231_c1_204_824 197
94 3300050512 nmdc:mga0n895_392395_c1 nmdc:mga0n895_392395_c1_595_1200 197
95 3300054114 Ga0501084_0642490 Ga0501084_0642490_248_856 197
96 3300005440 Ga0070705_100149199 Ga0070705_1001491992 198
97 3300005518 Ga0070699_100016611 Ga0070699_1000166115 198
98 3300006173 Ga0070716_100151596 Ga0070716_1001515962 198
99 3300006847 Ga0075431_100162778 Ga0075431_1001627782 198
100 3300006871 Ga0075434_100000283 Ga0075434_10000028333 198
101 3300007076 Ga0075435_100017371 Ga0075435_1000173712 198
102 3300049741 Ga0501079_0358433 Ga0501079_0358433_487_1101 198
103 3300050510 nmdc:mga06r32_198207_c1 nmdc:mga06r32_198207_c1_1016_1618 198
104 3300050512 nmdc:mga0n895_145480_c1 nmdc:mga0n895_145480_c1_1122_1730 198
105 3300050513 nmdc:mga0rr50_125789_c1 nmdc:mga0rr50_125789_c1_670_1278 198
106 3300005340 Ga0070689_100880707 Ga0070689_1008807071 199
107 3300005440 Ga0070705_100034843 Ga0070705_1000348434 199
108 3300005444 Ga0070694_100043197 Ga0070694_1000431973 199
109 3300005536 Ga0070697_100002971 Ga0070697_1000029714 199
110 3300005545 Ga0070695_100033975 Ga0070695_1000339753 199
111 3300005546 Ga0070696_100005007 Ga0070696_1000050073 199
112 3300006173 Ga0070716_100098736 Ga0070716_1000987362 199
113 3300006195 Ga0075366_10154058 Ga0075366_101540582 199
114 3300006914 Ga0075436_100006608 Ga0075436_1000066087 199
115 3300006914 Ga0075436_100056337 Ga0075436_1000563374 199
116 3300006914 Ga0075436_100187113 Ga0075436_1001871132 199
117 3300025939 Ga0207665_10278351 Ga0207665_102783512 199
118 3300050493 nmdc:mga0k408_197700_c1 nmdc:mga0k408_197700_c1_532_1134 199
119 3300050514 nmdc:mga08x19_16428_c1 nmdc:mga08x19_16428_c1_2021_2635 199
120 3300035089 Ga0373944_0012595 Ga0373944_0012595_778_1386 201
121 3300035089 Ga0373944_0124411 Ga0373944_0124411_105_713 201
122 3300035111 Ga0373923_0015287 Ga0373923_0015287_1910_2518 201
123 3300035113 Ga0373936_0011360 Ga0373936_0011360_206_814 201
124 3300035113 Ga0373936_0042315 Ga0373936_0042315_922_1530 201
125 3300035170 Ga0373943_0014131 Ga0373943_0014131_2053_2661 201
126 3300035170 Ga0373943_0085372 Ga0373943_0085372_907_1515 201
127 3300035171 Ga0373946_0004348 Ga0373946_0004348_2014_2622 201
128 3300035695 Ga0373927_0026039 Ga0373927_0026039_2820_3428 201
129 3300035725 Ga0373947_0067858 Ga0373947_0067858_1087_1695 201
130 3300035725 Ga0373947_0122600 Ga0373947_0122600_844_1452 201
131 3300037068 Ga0373925_0066498 Ga0373925_0066498_303_911 201
132 3300037068 Ga0373925_0470431 Ga0373925_0470431_195_803 201
133 3300046455 Ga0495603_0034893 Ga0495603_0034893_396_1004 201
134 3300046472 Ga0495580_0071786 Ga0495580_0071786_419_1027 201
135 3300046473 Ga0495582_0080002 Ga0495582_0080002_783_1391 201
136 3300046499 Ga0495594_0030022 Ga0495594_0030022_1825_2433 201
137 3300046517 Ga0495630_0048100 Ga0495630_0048100_23_631 201
138 3300046526 Ga0495666_0202796 Ga0495666_0202796_204_812 201
139 3300046531 Ga0495665_0034222 Ga0495665_0034222_1934_2542 201
140 3300046535 Ga0495586_0038705 Ga0495586_0038705_1806_2414 201
141 3300046674 Ga0495588_0003824 Ga0495588_0003824_3981_4589 201
142 3300046681 Ga0495647_0000325 Ga0495647_0000325_6877_7485 201
143 3300047315 Ga0495581_0005621 Ga0495581_0005621_101_709 201
144 3300047321 Ga0495676_0096395 Ga0495676_0096395_546_1154 201
145 3300005341 Ga0070691_10010106 Ga0070691_100101063 202
146 3300005444 Ga0070694_100078162 Ga0070694_1000781622 202
147 3300005545 Ga0070695_100133646 Ga0070695_1001336462 202
148 3300009098 Ga0105245_10076619 Ga0105245_100766193 202
149 3300009176 Ga0105242_10031879 Ga0105242_100318794 202
150 3300025934 Ga0207686_10123726 Ga0207686_101237262 202
151 3300031548 Ga0307408_100138996 Ga0307408_1001389962 202
152 3300031911 Ga0307412_11230747 Ga0307412_112307471 202
153 3300031995 Ga0307409_100068438 Ga0307409_1000684383 202
154 3300042876 Ga0451577_0811709 Ga0451577_0811709_146_763 202
155 3300045051 Ga0451576_0078357 Ga0451576_0078357_1633_2250 202
156 3300049576 Ga0501040_0205895 Ga0501040_0205895_760_1380 202
157 3300049578 Ga0501042_0781765 Ga0501042_0781765_26_646 202
158 3300049588 Ga0501072_0534884 Ga0501072_0534884_190_807 202
159 3300049591 Ga0501075_0237375 Ga0501075_0237375_500_1117 202
160 3300049593 Ga0501077_0038098 Ga0501077_0038098_1755_2372 202
161 3300049593 Ga0501077_0481656 Ga0501077_0481656_150_767 202
162 3300060353 Ga0501082_0517743 Ga0501082_0517743_411_1028 202
163 3300005295 Ga0065707_10382252 Ga0065707_103822521 203
164 3300005543 Ga0070672_100122439 Ga0070672_1001224393 203
165 3300005937 Ga0081455_10001451 Ga0081455_1000145111 203
166 3300006914 Ga0075436_100154695 Ga0075436_1001546952 203
167 3300009094 Ga0111539_10139705 Ga0111539_101397052 203
168 3300009147 Ga0114129_10217951 Ga0114129_102179513 203
169 3300035112 Ga0373932_0037149 Ga0373932_0037149_22_639 203
170 3300035691 Ga0373931_0055335 Ga0373931_0055335_1072_1689 203
171 3300049568 Ga0501031_0302817 Ga0501031_0302817_144_776 203
172 3300049589 Ga0501073_0364487 Ga0501073_0364487_176_799 203
173 3300049592 Ga0501076_0301740 Ga0501076_0301740_656_1279 203
174 3300049742 Ga0501080_0185175 Ga0501080_0185175_1209_1832 203
175 3300050507 nmdc:mga05p37_1535454_c1 nmdc:mga05p37_1535454_c1_15_632 203
176 3300050508 nmdc:mga09592_63463_c1 nmdc:mga09592_63463_c1_1495_2112 203
177 3300050511 nmdc:mga08y16_100508_c1 nmdc:mga08y16_100508_c1_800_1417 203
178 3300050512 nmdc:mga0n895_156517_c1 nmdc:mga0n895_156517_c1_274_891 203
179 3300050514 nmdc:mga08x19_230959_c1 nmdc:mga08x19_230959_c1_351_965 203
180 3300059426 Ga0590077_015067 Ga0590077_015067_46_669 203
181 3300004799 Ga0058863_11577384 Ga0058863_115773841 204
182 3300004800 Ga0058861_11470621 Ga0058861_114706211 204
183 3300004801 Ga0058860_11959220 Ga0058860_119592201 204
184 3300005290 Ga0065712_10001163 Ga0065712_100011635 204
185 3300005293 Ga0065715_10091728 Ga0065715_100917281 204
186 3300005295 Ga0065707_10088361 Ga0065707_100883614 204
187 3300005330 Ga0070690_100001896 Ga0070690_1000018967 204
188 3300005334 Ga0068869_100008055 Ga0068869_1000080552 204
189 3300005335 Ga0070666_10265706 Ga0070666_102657062 204
190 3300005335 Ga0070666_10515727 Ga0070666_105157272 204
191 3300005336 Ga0070680_100004727 Ga0070680_1000047276 204
192 3300005337 Ga0070682_100010351 Ga0070682_1000103512 204
193 3300005338 Ga0068868_100003521 Ga0068868_1000035212 204
194 3300005339 Ga0070660_100262545 Ga0070660_1002625452 204
195 3300005340 Ga0070689_100001050 Ga0070689_10000105010 204
196 3300005341 Ga0070691_10158851 Ga0070691_101588512 204
197 3300005343 Ga0070687_100001005 Ga0070687_1000010058 204
198 3300005345 Ga0070692_10004173 Ga0070692_100041736 204
199 3300005353 Ga0070669_100279454 Ga0070669_1002794541 204
200 3300005354 Ga0070675_100234697 Ga0070675_1002346972 204
201 3300005354 Ga0070675_100334916 Ga0070675_1003349162 204
202 3300005355 Ga0070671_100074327 Ga0070671_1000743271 204
203 3300005355 Ga0070671_100203139 Ga0070671_1002031391 204
204 3300005367 Ga0070667_100167990 Ga0070667_1001679901 204
205 3300005406 Ga0070703_10147959 Ga0070703_101479591 204
206 3300005438 Ga0070701_10008402 Ga0070701_100084022 204
207 3300005439 Ga0070711_100128032 Ga0070711_1001280322 204
208 3300005440 Ga0070705_100001217 Ga0070705_1000012172 204
209 3300005440 Ga0070705_100148555 Ga0070705_1001485551 204
210 3300005441 Ga0070700_100020415 Ga0070700_1000204152 204
211 3300005444 Ga0070694_100001759 Ga0070694_1000017598 204
212 3300005445 Ga0070708_100248288 Ga0070708_1002482883 204
213 3300005445 Ga0070708_100890722 Ga0070708_1008907221 204
214 3300005457 Ga0070662_100006146 Ga0070662_1000061467 204
215 3300005457 Ga0070662_100696829 Ga0070662_1006968291 204
216 3300005459 Ga0068867_100001927 Ga0068867_1000019277 204
217 3300005468 Ga0070707_100014003 Ga0070707_1000140032 204
218 3300005468 Ga0070707_100536647 Ga0070707_1005366472 204
219 3300005530 Ga0070679_100014870 Ga0070679_1000148703 204
220 3300005539 Ga0068853_100337788 Ga0068853_1003377882 204
221 3300005543 Ga0070672_100078089 Ga0070672_1000780894 204
222 3300005544 Ga0070686_100005731 Ga0070686_1000057312 204
223 3300005545 Ga0070695_100001196 Ga0070695_1000011968 204
224 3300005546 Ga0070696_100000077 Ga0070696_10000007742 204
225 3300005546 Ga0070696_100078189 Ga0070696_1000781892 204
226 3300005547 Ga0070693_100000848 Ga0070693_1000008489 204
227 3300005547 Ga0070693_100727209 Ga0070693_1007272091 204
228 3300005549 Ga0070704_100001029 Ga0070704_1000010299 204
229 3300005563 Ga0068855_100002124 Ga0068855_1000021247 204
230 3300005614 Ga0068856_100004104 Ga0068856_10000410411 204
231 3300005615 Ga0070702_100000323 Ga0070702_10000032312 204
232 3300005617 Ga0068859_100006422 Ga0068859_1000064227 204
233 3300005718 Ga0068866_10002341 Ga0068866_100023412 204
234 3300005719 Ga0068861_100003264 Ga0068861_1000032647 204
235 3300005840 Ga0068870_10024899 Ga0068870_100248992 204
236 3300005842 Ga0068858_100127151 Ga0068858_1001271513 204
237 3300005843 Ga0068860_100015325 Ga0068860_1000153258 204
238 3300005844 Ga0068862_100011120 Ga0068862_1000111208 204
239 3300005981 Ga0081538_10021796 Ga0081538_100217964 204
240 3300006173 Ga0070716_100009831 Ga0070716_1000098312 204
241 3300006175 Ga0070712_100206334 Ga0070712_1002063343 204
242 3300006237 Ga0097621_100001582 Ga0097621_1000015828 204
243 3300006358 Ga0068871_100005950 Ga0068871_1000059504 204
244 3300006844 Ga0075428_100000333 Ga0075428_1000003334 204
245 3300006844 Ga0075428_100264257 Ga0075428_1002642572 204
246 3300006846 Ga0075430_100654074 Ga0075430_1006540741 204
247 3300006847 Ga0075431_100370401 Ga0075431_1003704012 204
248 3300006847 Ga0075431_100628551 Ga0075431_1006285511 204
249 3300006852 Ga0075433_10020589 Ga0075433_100205895 204
250 3300006852 Ga0075433_10046040 Ga0075433_100460402 204
251 3300006852 Ga0075433_10200633 Ga0075433_102006333 204
252 3300006871 Ga0075434_100000758 Ga0075434_10000075821 204
253 3300006871 Ga0075434_100054072 Ga0075434_1000540723 204
254 3300006871 Ga0075434_100091198 Ga0075434_1000911982 204
255 3300006871 Ga0075434_100375082 Ga0075434_1003750822 204
256 3300006880 Ga0075429_100000477 Ga0075429_10000047729 204
257 3300006881 Ga0068865_100038970 Ga0068865_1000389702 204
258 3300006914 Ga0075436_100173460 Ga0075436_1001734602 204
259 3300006931 Ga0097620_100006422 Ga0097620_1000064227 204
260 3300007076 Ga0075435_100023326 Ga0075435_1000233263 204
261 3300007076 Ga0075435_100283883 Ga0075435_1002838831 204
262 3300007076 Ga0075435_100361632 Ga0075435_1003616321 204
263 3300007265 Ga0099794_10005575 Ga0099794_100055752 204
264 3300007265 Ga0099794_10081027 Ga0099794_100810272 204
265 3300009094 Ga0111539_10053550 Ga0111539_100535502 204
266 3300009098 Ga0105245_10001913 Ga0105245_100019139 204
267 3300009147 Ga0114129_10001303 Ga0114129_100013036 204
268 3300009147 Ga0114129_10168232 Ga0114129_101682323 204
269 3300009148 Ga0105243_10002363 Ga0105243_100023639 204
270 3300009148 Ga0105243_10426801 Ga0105243_104268011 204
271 3300009174 Ga0105241_10012167 Ga0105241_100121673 204
272 3300009176 Ga0105242_10005151 Ga0105242_100051519 204
273 3300009545 Ga0105237_10808592 Ga0105237_108085921 204
274 3300009553 Ga0105249_10005837 Ga0105249_100058374 204
275 3300010375 Ga0105239_10012333 Ga0105239_100123339 204
276 3300011119 Ga0105246_10415494 Ga0105246_104154942 204
277 3300013297 Ga0157378_10004930 Ga0157378_1000493011 204
278 3300013306 Ga0163162_10033330 Ga0163162_100333303 204
279 3300013308 Ga0157375_10630908 Ga0157375_106309081 204
280 3300013308 Ga0157375_11078726 Ga0157375_110787261 204
281 3300014745 Ga0157377_10052692 Ga0157377_100526922 204
282 3300014969 Ga0157376_10002639 Ga0157376_100026397 204
283 3300025315 Ga0207697_10034238 Ga0207697_100342381 204
284 3300025899 Ga0207642_10002611 Ga0207642_100026117 204
285 3300025901 Ga0207688_10392953 Ga0207688_103929531 204
286 3300025905 Ga0207685_10018530 Ga0207685_100185302 204
287 3300025908 Ga0207643_10031303 Ga0207643_100313033 204
288 3300025910 Ga0207684_10192401 Ga0207684_101924012 204
289 3300025915 Ga0207693_10063205 Ga0207693_100632051 204
290 3300025918 Ga0207662_10000837 Ga0207662_1000083714 204
291 3300025919 Ga0207657_10290229 Ga0207657_102902292 204
292 3300025920 Ga0207649_10906986 Ga0207649_109069861 204
293 3300025922 Ga0207646_10014592 Ga0207646_100145922 204
294 3300025922 Ga0207646_10462048 Ga0207646_104620482 204
295 3300025923 Ga0207681_10035278 Ga0207681_100352782 204
296 3300025926 Ga0207659_10199965 Ga0207659_101999652 204
297 3300025926 Ga0207659_10312386 Ga0207659_103123862 204
298 3300025927 Ga0207687_10023729 Ga0207687_100237292 204
299 3300025931 Ga0207644_10626199 Ga0207644_106261991 204
300 3300025932 Ga0207690_10088113 Ga0207690_100881132 204
301 3300025933 Ga0207706_10313095 Ga0207706_103130952 204
302 3300025933 Ga0207706_10859008 Ga0207706_108590082 204
303 3300025934 Ga0207686_10013925 Ga0207686_100139252 204
304 3300025935 Ga0207709_10001762 Ga0207709_100017622 204
305 3300025936 Ga0207670_10003076 Ga0207670_100030765 204
306 3300025938 Ga0207704_10012950 Ga0207704_100129503 204
307 3300025939 Ga0207665_10017478 Ga0207665_100174786 204
308 3300025940 Ga0207691_10751380 Ga0207691_107513801 204
309 3300025942 Ga0207689_10000500 Ga0207689_1000050013 204
310 3300025949 Ga0207667_10091307 Ga0207667_100913072 204
311 3300025961 Ga0207712_10017558 Ga0207712_100175582 204
312 3300026023 Ga0207677_10030988 Ga0207677_100309884 204
313 3300026035 Ga0207703_10019496 Ga0207703_100194963 204
314 3300026041 Ga0207639_10294812 Ga0207639_102948122 204
315 3300026075 Ga0207708_10002007 Ga0207708_1000200715 204
316 3300026088 Ga0207641_10828942 Ga0207641_108289422 204
317 3300026089 Ga0207648_10000691 Ga0207648_1000069126 204
318 3300026118 Ga0207675_100000807 Ga0207675_1000008078 204
319 3300026121 Ga0207683_10081001 Ga0207683_100810011 204
320 3300027671 Ga0209588_1001734 Ga0209588_10017343 204
321 3300027907 Ga0207428_10007757 Ga0207428_100077577 204
322 3300028381 Ga0268264_10006775 Ga0268264_100067752 204
323 3300031903 Ga0307407_10383766 Ga0307407_103837662 204
324 3300031911 Ga0307412_10319177 Ga0307412_103191772 204
325 3300032002 Ga0307416_100147191 Ga0307416_1001471911 204
326 3300032002 Ga0307416_100198840 Ga0307416_1001988403 204
327 3300032005 Ga0307411_10096290 Ga0307411_100962903 204
328 3300034817 Ga0373948_0020626 Ga0373948_0020626_335_949 204
329 3300034820 Ga0373959_0049023 Ga0373959_0049023_145_759 204
330 3300034957 Ga0373938_0007887 Ga0373938_0007887_312_929 204
331 3300035112 Ga0373932_0048994 Ga0373932_0048994_615_1229 204
332 3300035121 Ga0373960_0094221 Ga0373960_0094221_43_657 204
333 3300035241 Ga0373961_0060936 Ga0373961_0060936_255_872 204
334 3300035691 Ga0373931_0002890 Ga0373931_0002890_1099_1728 204
335 3300035691 Ga0373931_0024136 Ga0373931_0024136_716_1330 204
336 3300042876 Ga0451577_0335379 Ga0451577_0335379_145_774 204
337 3300044712 Ga0453684_0243468 Ga0453684_0243468_516_1145 204
338 3300044712 Ga0453684_0385610 Ga0453684_0385610_329_958 204
339 3300047318 Ga0495636_0033960 Ga0495636_0033960_966_1580 204
340 3300048913 Ga0496110_0184756 Ga0496110_0184756_937_1566 204
341 3300048915 Ga0496112_0038882 Ga0496112_0038882_3156_3785 204
342 3300048916 Ga0496113_0231026 Ga0496113_0231026_804_1433 204
343 3300049568 Ga0501031_0686554 Ga0501031_0686554_17_643 204
344 3300049573 Ga0501037_0030779 Ga0501037_0030779_2085_2711 204
345 3300049574 Ga0501038_0009480 Ga0501038_0009480_8220_8846 204
346 3300049575 Ga0501039_0016291 Ga0501039_0016291_2449_3075 204
347 3300049576 Ga0501040_0020272 Ga0501040_0020272_3627_4253 204
348 3300049577 Ga0501041_0005809 Ga0501041_0005809_4484_5110 204
349 3300049586 Ga0501070_0425599 Ga0501070_0425599_411_1037 204
350 3300049587 Ga0501071_0003510 Ga0501071_0003510_4132_4758 204
351 3300049588 Ga0501072_0016790 Ga0501072_0016790_2892_3518 204
352 3300049590 Ga0501074_0108732 Ga0501074_0108732_1024_1650 204
353 3300049591 Ga0501075_0002762 Ga0501075_0002762_7072_7698 204
354 3300049592 Ga0501076_0004360 Ga0501076_0004360_2495_3121 204
355 3300049593 Ga0501077_0011950 Ga0501077_0011950_2208_2834 204
356 3300049593 Ga0501077_0012826 Ga0501077_0012826_1988_2614 204
357 3300049741 Ga0501079_0008055 Ga0501079_0008055_260_886 204
358 3300049742 Ga0501080_0003078 Ga0501080_0003078_303_929 204
359 3300049743 Ga0501081_0007823 Ga0501081_0007823_3636_4262 204
360 3300049824 Ga0501045_0013848 Ga0501045_0013848_2348_2974 204
361 3300049824 Ga0501045_0382946 Ga0501045_0382946_322_942 204
362 3300050507 nmdc:mga05p37_1125_c1 nmdc:mga05p37_1125_c1_2261_2878 204
363 3300050507 nmdc:mga05p37_1506102_c1 nmdc:mga05p37_1506102_c1_12_641 204
364 3300050507 nmdc:mga05p37_33117_c1 nmdc:mga05p37_33117_c1_4039_4665 204
365 3300050508 nmdc:mga09592_233822_c1 nmdc:mga09592_233822_c1_702_1331 204
366 3300050508 nmdc:mga09592_54266_c1 nmdc:mga09592_54266_c1_192_818 204
367 3300050508 nmdc:mga09592_617_c1 nmdc:mga09592_617_c1_1479_2096 204
368 3300050509 nmdc:mga0qj67_162365_c1 nmdc:mga0qj67_162365_c1_1050_1679 204
369 3300050509 nmdc:mga0qj67_267715_c1 nmdc:mga0qj67_267715_c1_193_822 204
370 3300050510 nmdc:mga06r32_103587_c1 nmdc:mga06r32_103587_c1_1207_1836 204
371 3300050510 nmdc:mga06r32_315141_c1 nmdc:mga06r32_315141_c1_587_1213 204
372 3300050510 nmdc:mga06r32_759613_c1 nmdc:mga06r32_759613_c1_264_911 204
373 3300050511 nmdc:mga08y16_158274_c1 nmdc:mga08y16_158274_c1_131_748 204
374 3300050512 nmdc:mga0n895_10200_c1 nmdc:mga0n895_10200_c1_1516_2142 204
375 3300050512 nmdc:mga0n895_757654_c1 nmdc:mga0n895_757654_c1_238_864 204
376 3300050512 nmdc:mga0n895_94671_c1 nmdc:mga0n895_94671_c1_1921_2622 204
377 3300050513 nmdc:mga0rr50_15345_c1 nmdc:mga0rr50_15345_c1_2782_3408 204
378 3300050513 nmdc:mga0rr50_167039_c1 nmdc:mga0rr50_167039_c1_10_639 204
379 3300050514 nmdc:mga08x19_179826_c1 nmdc:mga08x19_179826_c1_679_1293 204
380 3300050514 nmdc:mga08x19_294157_c1 nmdc:mga08x19_294157_c1_419_1048 204
381 3300050515 nmdc:mga0a205_19504_c1 nmdc:mga0a205_19504_c1_4530_5156 204
382 3300050515 nmdc:mga0a205_207035_c2 nmdc:mga0a205_207035_c2_708_1334 204
383 3300050515 nmdc:mga0a205_26199_c1 nmdc:mga0a205_26199_c1_3260_3886 204
384 3300050515 nmdc:mga0a205_49573_c1 nmdc:mga0a205_49573_c1_3009_3710 204
385 3300054114 Ga0501084_0003766 Ga0501084_0003766_7283_7909 204
386 3300060353 Ga0501082_0003627 Ga0501082_0003627_4703_5329 204
387 3300061734 Ga0530510_0086519 Ga0530510_0086519_1216_1842 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

57

231

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u1x-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bdi_1869) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8193 30 204
3u1x-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bdi_1869) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8182 30 204
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.8025 31 202
3osd-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bt2157) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution 0.7902 30 204
3hbk-assembly1.cif.gz_A crystal structure of putative glycosyl hydrolase, was domain of unknown function (duf1080) (yp_001302580.1) from parabacteroides distasonis atcc 8503 at 2.36 a resolution 0.7897 30 204
ID Description Score Start End Superfamily
3hw2A01 Alpha Beta;2-Layer Sandwich;Secreted effector protein SifA fold;Secreted effector protein SifA 0.8715 147 170 3.30.2440.10
3u1xA00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8209 30 204 2.60.120.560
af_Q9TZF7_1_189_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.8138 145 170 3.80.10.10
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7899 31 202 2.60.120.560
af_P77567_199_281_3.30.1120.150 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.7633 147 171 3.30.1120.150
ID Description Score Start End GO Terms
AF-A0A2V8MA35-F1-model_v4 DUF1080 domain-containing protein 0.9723 69 204 GO:0016787
AF-A0A2V8HYN9-F1-model_v4 DUF1080 domain-containing protein 0.9666 95 174 GO:0016787
AF-A0A7X4EZA9-F1-model_v4 DUF1080 domain-containing protein 0.9665 30 204 GO:0016787
AF-A0A2V8MA35-F1-model_v4 DUF1080 domain-containing protein 0.9649 69 204 GO:0016787
AF-A0A4Q5WU28-F1-model_v4 deleted 0.9527 30 204

Feature Viewer

pLDDT pTM Quality
88.6 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map