F430738

General Info

Members Datasets Scaffolds Average Seq Length
387 241 382 217

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100203721|Ga0070671_1002037212
Length 234
Sequence LTSWLGALRRAWLMYHLADTRLSYMFDPPPVDEWVALDCETTGLDVRRDDIVSIGAVRIVGNRLLTSQRLELLVHPERAPLKAESVRVHRLRERDVAAGLGADEAVHRLLEFIGSRPLVGYYLEFDVAMLNRVIWPMLGMGMPQQKIEVSAMYYDFKNRQLPAHERGGTIDLRFATMMGDLDLPLREAHDAVSDAVMAGLAFLKLRRLLNGRRGVASVGRSKHDAPPTLSLGKV

Samples

Sample ID Description Type Environment
1 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
2 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
3 2885266251 Ralstonia sp. SET104 Isolate Nodule
4 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
5 2928058823 Ralstonia sp. 1138 Isolate Unclassified
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0.26
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.44
Nodule 0.26
Rhizoplane 6.2
Rhizosphere 74.94
Stem 0
Stem Tuber 0
Unclassified 5.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000631 3300001915 Bacteria 10643
2 JGI24740J21852_10001035 3300001979 Bacteria 12466
3 JGI24740J21852_10004810 3300001979 Bacteria 5758
4 JGI25154J39366_1000383 3300002738 Bacteria 24253
5 Ga0055539_1000207 3300003752 Bacteria 45730
6 Ga0055533_1006220 3300003756 Bacteria 1792
7 Ga0055532_1000006 3300003758 Bacteria 451244
8 Ga0055525_1000649 3300003759 Bacteria 13622
9 Ga0055527_1000629 3300003760 Bacteria 11057
10 Ga0055535_1000004 3300003761 Bacteria 451244
11 Ga0055542_1001713 3300003762 Bacteria 9497
12 Ga0055529_1000022 3300003763 Bacteria 320108
13 Ga0055541_1000423 3300003841 Bacteria 12446
14 Ga0070676_10032824 3300005328 Bacteria 2976
15 Ga0070683_100525933 3300005329 Bacteria 1130
16 Ga0070690_100201615 3300005330 Unclassified 1385
17 Ga0070670_100018862 3300005331 Bacteria 5916
18 Ga0070670_100660876 3300005331 Bacteria 938
19 Ga0068869_100013729 3300005334 Bacteria 5396
20 Ga0070666_10038137 3300005335 Bacteria 3196
21 Ga0070666_10041727 3300005335 Bacteria 3067
22 Ga0068868_100006149 3300005338 Bacteria 8486
23 Ga0068868_100107861 3300005338 Bacteria 2260
24 Ga0070689_100041065 3300005340 Bacteria 3549
25 Ga0070687_100151311 3300005343 Bacteria 1362
26 Ga0070661_100000209 3300005344 Bacteria 48575
27 Ga0070661_100137217 3300005344 Bacteria 1841
28 Ga0070668_100395530 3300005347 Bacteria 1179
29 Ga0070675_100004134 3300005354 Bacteria 11026
30 Ga0070675_100019873 3300005354 Bacteria 5358
31 Ga0070675_101116491 3300005354 Bacteria 725
32 Ga0070671_100003152 3300005355 Bacteria 12854
33 Ga0070671_100019944 3300005355 Bacteria 5461
34 Ga0070671_100132850 3300005355 Bacteria 2097
35 Ga0070671_100203721 3300005355 Bacteria 1678
36 Ga0070671_100467466 3300005355 Bacteria 1083
37 Ga0070673_100002048 3300005364 Bacteria 12160
38 Ga0070673_100158146 3300005364 Bacteria 1925
39 Ga0070673_100500806 3300005364 Bacteria 1099
40 Ga0070673_100964135 3300005364 Bacteria 793
41 Ga0070667_100012959 3300005367 Bacteria 6894
42 Ga0070667_100037874 3300005367 Bacteria 4043
43 Ga0070667_100191014 3300005367 Bacteria 1814
44 Ga0070667_100668704 3300005367 Unclassified 960
45 Ga0070709_10355284 3300005434 Bacteria 1084
46 Ga0070714_100202166 3300005435 Unclassified 1818
47 Ga0070713_100094425 3300005436 Unclassified 2578
48 Ga0070663_100000020 3300005455 Bacteria 112469
49 Ga0070678_100001592 3300005456 Bacteria 12150
50 Ga0070678_100347324 3300005456 Bacteria 1274
51 Ga0070662_100018931 3300005457 Bacteria 4665
52 Ga0068867_100013680 3300005459 Bacteria 5747
53 Ga0070685_10006160 3300005466 Bacteria 6106
54 Ga0070672_100002330 3300005543 Bacteria 12009
55 Ga0070672_100010691 3300005543 Bacteria 6376
56 Ga0070672_100023441 3300005543 Bacteria 4550
57 Ga0070672_100049323 3300005543 Bacteria 3275
58 Ga0070672_100630606 3300005543 Bacteria 935
59 Ga0070686_100074636 3300005544 Bacteria 2229
60 Ga0070665_100005162 3300005548 Bacteria 13513
61 Ga0070665_100032110 3300005548 Bacteria 5285
62 Ga0070665_100085705 3300005548 Bacteria 3156
63 Ga0070665_100671258 3300005548 Bacteria 1049
64 Ga0070664_100000003 3300005564 Bacteria 325604
65 Ga0068857_100083972 3300005577 Bacteria 2845
66 Ga0068854_100000100 3300005578 Bacteria 60250
67 Ga0068856_100000011 3300005614 Bacteria 170419
68 Ga0068856_100296636 3300005614 Bacteria 1634
69 Ga0070702_100348298 3300005615 Bacteria 1042
70 Ga0068852_100023472 3300005616 Bacteria 4965
71 Ga0068859_100036646 3300005617 Bacteria 4924
72 Ga0068859_100049918 3300005617 Bacteria 4203
73 Ga0068859_100233202 3300005617 Bacteria 1929
74 Ga0068859_100505233 3300005617 Bacteria 1304
75 Ga0068864_100000330 3300005618 Bacteria 41727
76 Ga0068864_100010163 3300005618 Bacteria 7769
77 Ga0068864_100011754 3300005618 Bacteria 7230
78 Ga0068864_100215660 3300005618 Bacteria 1769
79 Ga0068861_100054391 3300005719 Bacteria 3049
80 Ga0068863_100000715 3300005841 Bacteria 33387
81 Ga0068863_100015691 3300005841 Bacteria 7272
82 Ga0068863_100096712 3300005841 Unclassified 2804
83 Ga0068863_100111166 3300005841 Bacteria 2610
84 Ga0068863_100145557 3300005841 Bacteria 2266
85 Ga0068858_100000900 3300005842 Bacteria 30822
86 Ga0068858_100279750 3300005842 Bacteria 1589
87 Ga0068860_100192293 3300005843 Bacteria 1975
88 Ga0068860_100349241 3300005843 Bacteria 1455
89 Ga0068860_100572353 3300005843 Bacteria 1133
90 Ga0068862_100177501 3300005844 Bacteria 1910
91 Ga0075368_10097881 3300006042 Bacteria 1203
92 Ga0070716_100080738 3300006173 Unclassified 1940
93 Ga0070712_100190520 3300006175 Unclassified 1605
94 Ga0070712_100195109 3300006175 Bacteria 1587
95 Ga0075366_10004405 3300006195 Bacteria 7558
96 Ga0075366_10008312 3300006195 Bacteria 5765
97 Ga0075366_10020159 3300006195 Bacteria 3865
98 Ga0075366_10038164 3300006195 Bacteria 2837
99 Ga0075366_10098201 3300006195 Bacteria 1757
100 Ga0097621_100002284 3300006237 Bacteria 13135
101 Ga0097621_100033077 3300006237 Bacteria 4115
102 Ga0097621_100055097 3300006237 Bacteria 3246
103 Ga0097621_100089964 3300006237 Bacteria 2568
104 Ga0075370_10000129 3300006353 Bacteria 25189
105 Ga0075370_10001593 3300006353 Bacteria 9993
106 Ga0075370_10107650 3300006353 Bacteria 1617
107 Ga0068871_100018973 3300006358 Bacteria 5242
108 Ga0068871_100041642 3300006358 Bacteria 3684
109 Ga0068871_100267118 3300006358 Bacteria 1494
110 Ga0075430_100037816 3300006846 Bacteria 4091
111 Ga0075429_100000492 3300006880 Bacteria 29664
112 Ga0068865_100267380 3300006881 Bacteria 1356
113 Ga0097620_100036646 3300006931 Bacteria 4924
114 Ga0097620_100049919 3300006931 Bacteria 4203
115 Ga0097620_100233195 3300006931 Bacteria 1929
116 Ga0097620_100505288 3300006931 Bacteria 1304
117 Ga0105240_10079935 3300009093 Bacteria 4022
118 Ga0105240_10579539 3300009093 Bacteria 1238
119 Ga0105247_10112558 3300009101 Bacteria 1754
120 Ga0105247_10397178 3300009101 Bacteria 981
121 Ga0105243_10038511 3300009148 Bacteria 3723
122 Ga0105242_10269762 3300009176 Bacteria 1541
123 Ga0105248_10007165 3300009177 Bacteria 12233
124 Ga0105248_10020100 3300009177 Bacteria 7397
125 Ga0105248_10204258 3300009177 Bacteria 2226
126 Ga0105249_10227901 3300009553 Unclassified 1837
127 Ga0105239_10754270 3300010375 Bacteria 1114
128 Ga0105246_10027612 3300011119 Bacteria 3722
129 Ga0157373_10037688 3300013100 Bacteria 3465
130 Ga0157371_10000083 3300013102 Bacteria 149633
131 Ga0157370_10000141 3300013104 Bacteria 87406
132 Ga0157369_10008027 3300013105 Bacteria 12112
133 Ga0157374_10057214 3300013296 Bacteria 3642
134 Ga0157374_10059151 3300013296 Bacteria 3582
135 Ga0157374_10319123 3300013296 Unclassified 1539
136 Ga0157378_10392838 3300013297 Bacteria 1365
137 Ga0163162_10012080 3300013306 Bacteria 8425
138 Ga0163162_10198305 3300013306 Bacteria 2136
139 Ga0163162_10595967 3300013306 Bacteria 1232
140 Ga0157372_10000577 3300013307 Bacteria 40077
141 Ga0157375_10005147 3300013308 Bacteria 11351
142 Ga0157375_10007271 3300013308 Bacteria 9688
143 Ga0157375_10025037 3300013308 Bacteria 5535
144 Ga0157375_10053755 3300013308 Bacteria 3964
145 Ga0157375_10200305 3300013308 Bacteria 2152
146 Ga0157375_10250650 3300013308 Bacteria 1931
147 Ga0163163_10000980 3300014325 Bacteria 24230
148 Ga0182008_10007239 3300014497 Bacteria 6136
149 Ga0182008_10081647 3300014497 Bacteria 1591
150 Ga0157379_10356265 3300014968 Bacteria 1340
151 Ga0157376_10040936 3300014969 Bacteria 3790
152 Ga0157376_10354302 3300014969 Unclassified 1405
153 Ga0182006_1017888 3300015261 Bacteria 3004
154 Ga0182007_10005180 3300015262 Bacteria 5764
155 Ga0182005_1031777 3300015265 Bacteria 1438
156 Ga0183362_10002 3300015683 Bacteria 1432711
157 Ga0163161_10037507 3300017792 Bacteria 3475
158 Ga0163161_10136140 3300017792 Bacteria 1857
159 Ga0154015_1166000 3300020610 Bacteria 28143
160 Ga0209784_100195 3300025224 Bacteria 46751
161 Ga0209784_100589 3300025224 Bacteria 12159
162 Ga0209566_100002 3300025225 Bacteria 2614868
163 Ga0209566_101009 3300025225 Bacteria 11980
164 Ga0209566_101017 3300025225 Bacteria 11821
165 Ga0209674_100010 3300025226 Bacteria 1038638
166 Ga0209674_100050 3300025226 Bacteria 341738
167 Ga0209674_100205 3300025226 Bacteria 59434
168 Ga0209674_102593 3300025226 Bacteria 3777
169 Ga0209672_100123 3300025228 Bacteria 81654
170 Ga0209147_100015 3300025229 Bacteria 565073
171 Ga0209563_100004 3300025230 Bacteria 1814108
172 Ga0209563_100026 3300025230 Bacteria 559453
173 Ga0209563_104545 3300025230 Bacteria 2637
174 Ga0209563_110419 3300025230 Bacteria 1355
175 Ga0209258_100021 3300025242 Bacteria 565073
176 Ga0209646_1000075 3300025246 Bacteria 221755
177 Ga0209026_1008067 3300025250 Bacteria 2256
178 Ga0209677_100013 3300025253 Bacteria 548200
179 Ga0209677_102193 3300025253 Bacteria 7593
180 Ga0209148_1000043 3300025254 Bacteria 461531
181 Ga0209759_1014823 3300025256 Bacteria 2039
182 Ga0209759_1034546 3300025256 Bacteria 943
183 Ga0209455_1000028 3300025272 Bacteria 565073
184 Ga0209050_1003089 3300025298 Bacteria 12797
185 Ga0209051_1001799 3300025303 Bacteria 17001
186 Ga0209257_1000053 3300025304 Bacteria 425160
187 Ga0207688_10367861 3300025901 Unclassified 888
188 Ga0207680_10034426 3300025903 Bacteria 2898
189 Ga0207680_10038072 3300025903 Bacteria 2782
190 Ga0207699_10126528 3300025906 Unclassified 1660
191 Ga0207645_10052547 3300025907 Bacteria 2604
192 Ga0207645_10096217 3300025907 Bacteria 1907
193 Ga0207645_10293433 3300025907 Bacteria 1082
194 Ga0207695_10003242 3300025913 Bacteria 23161
195 Ga0207695_10008393 3300025913 Bacteria 12941
196 Ga0207693_10297112 3300025915 Unclassified 1265
197 Ga0207663_10119436 3300025916 Unclassified 1802
198 Ga0207662_10276116 3300025918 Bacteria 1110
199 Ga0207649_10000209 3300025920 Bacteria 48620
200 Ga0207649_10109075 3300025920 Bacteria 1846
201 Ga0207659_10001225 3300025926 Bacteria 15353
202 Ga0207659_10123529 3300025926 Bacteria 1987
203 Ga0207687_10072828 3300025927 Bacteria 2459
204 Ga0207700_10187727 3300025928 Unclassified 1735
205 Ga0207664_10598244 3300025929 Unclassified 990
206 Ga0207644_10008015 3300025931 Bacteria 6908
207 Ga0207644_10024808 3300025931 Bacteria 4119
208 Ga0207706_10039037 3300025933 Bacteria 4211
209 Ga0207709_10030138 3300025935 Bacteria 3153
210 Ga0207670_10046429 3300025936 Bacteria 2886
211 Ga0207704_10172158 3300025938 Bacteria 1554
212 Ga0207665_10081677 3300025939 Unclassified 2226
213 Ga0207691_10009318 3300025940 Bacteria 9423
214 Ga0207691_10019803 3300025940 Bacteria 6365
215 Ga0207691_10035590 3300025940 Bacteria 4620
216 Ga0207691_10082150 3300025940 Bacteria 2895
217 Ga0207711_10007733 3300025941 Bacteria 8980
218 Ga0207711_10049161 3300025941 Bacteria 3610
219 Ga0207711_10287042 3300025941 Bacteria 1516
220 Ga0207689_10038322 3300025942 Bacteria 3971
221 Ga0207679_10000083 3300025945 Bacteria 83025
222 Ga0207679_10433811 3300025945 Bacteria 1162
223 Ga0207651_10017289 3300025960 Bacteria 4256
224 Ga0207651_10078913 3300025960 Bacteria 2363
225 Ga0207651_10624476 3300025960 Bacteria 944
226 Ga0207668_10202190 3300025972 Bacteria 1583
227 Ga0207640_10000111 3300025981 Bacteria 61830
228 Ga0207658_10027419 3300025986 Bacteria 4002
229 Ga0207658_10159614 3300025986 Bacteria 1847
230 Ga0207677_10010720 3300026023 Bacteria 5195
231 Ga0207677_10057208 3300026023 Bacteria 2676
232 Ga0207677_10133521 3300026023 Bacteria 1889
233 Ga0207703_10033884 3300026035 Bacteria 4050
234 Ga0207639_10150065 3300026041 Bacteria 1951
235 Ga0207678_10000030 3300026067 Bacteria 112455
236 Ga0207702_10000054 3300026078 Bacteria 137192
237 Ga0207641_10003696 3300026088 Bacteria 13475
238 Ga0207641_10027161 3300026088 Bacteria 4726
239 Ga0207641_10124067 3300026088 Bacteria 2309
240 Ga0207641_10160292 3300026088 Bacteria 2045
241 Ga0207641_10239897 3300026088 Bacteria 1689
242 Ga0207648_10058659 3300026089 Bacteria 3357
243 Ga0207648_10153750 3300026089 Bacteria 2030
244 Ga0207676_10002137 3300026095 Bacteria 14293
245 Ga0207676_10024453 3300026095 Bacteria 4468
246 Ga0207676_10031729 3300026095 Bacteria 3975
247 Ga0207676_10077315 3300026095 Bacteria 2692
248 Ga0207674_10467698 3300026116 Bacteria 1219
249 Ga0207675_100076520 3300026118 Bacteria 3134
250 Ga0207683_10006668 3300026121 Bacteria 9878
251 Ga0207683_10040845 3300026121 Bacteria 4050
252 Ga0207683_10103061 3300026121 Bacteria 2548
253 Ga0207698_10030722 3300026142 Bacteria 3868
254 Ga0207698_10031175 3300026142 Bacteria 3845
255 Ga0268266_10159604 3300028379 Bacteria 2039
256 Ga0268266_10438173 3300028379 Bacteria 1241
257 Ga0268265_10085383 3300028380 Bacteria 2505
258 Ga0268264_10063294 3300028381 Bacteria 3109
259 Ga0268264_10160777 3300028381 Bacteria 2023
260 Ga0265334_10110036 3300028573 Bacteria 991
261 Ga0265336_10000048 3300028666 Bacteria 121572
262 Ga0307515_10448891 3300028794 Bacteria 905
263 Ga0265338_10075883 3300028800 Bacteria 2850
264 Ga0307512_10054455 3300030522 Bacteria 3168
265 Ga0265332_10000005 3300031238 Bacteria 377525
266 Ga0265327_10009929 3300031251 Bacteria 6785
267 Ga0307513_10154391 3300031456 Bacteria 2198
268 Ga0307513_10226666 3300031456 Bacteria 1685
269 Ga0307509_10000168 3300031507 Bacteria 103047
270 Ga0307509_10002617 3300031507 Bacteria 28807
271 Ga0307514_10150193 3300031649 Bacteria 1565
272 Ga0307516_10030247 3300031730 Bacteria 5467
273 Ga0307507_10166002 3300033179 Bacteria 1618
274 Ga0307510_10007792 3300033180 Bacteria 12772
275 Ga0373936_0046219 3300035113 Unclassified 1755
276 Ga0373946_0063514 3300035171 Bacteria 1577
277 Ga0373927_0057469 3300035695 Bacteria 2516
278 Ga0373927_0478923 3300035695 Bacteria 822
279 Ga0373933_0138836 3300035724 Unclassified 1533
280 Ga0373937_0032556 3300036401 Unclassified 4729
281 Ga0373925_0012886 3300037068 Bacteria 6057
282 Ga0373925_0097289 3300037068 Unclassified 2257
283 Ga0373925_0258631 3300037068 Bacteria 1398
284 Ga0395900_0002596 3300037418 Bacteria 19749
285 Ga0395900_0014306 3300037418 Bacteria 8099
286 Ga0395905_0016077 3300037471 Bacteria 7114
287 Ga0395905_0053333 3300037471 Bacteria 3784
288 Ga0395905_0205819 3300037471 Bacteria 1844
289 Ga0395905_0243146 3300037471 Bacteria 1681
290 Ga0395905_0313351 3300037471 Bacteria 1458
291 Ga0451853_3618205 3300041512 Bacteria 1086
292 Ga0439457_047613 3300042014 Bacteria 960
293 Ga0451577_0000058 3300042876 Bacteria 272673
294 Ga0451577_0031552 3300042876 Bacteria 4780
295 Ga0466986_0014777 3300044650 Bacteria 4973
296 Ga0453684_0000279 3300044712 Bacteria 220016
297 Ga0453684_0387775 3300044712 Bacteria 1567
298 Ga0451576_0018881 3300045051 Bacteria 7537
299 Ga0451576_0020874 3300045051 Bacteria 7128
300 Ga0495592_0000159 3300046454 Bacteria 59481
301 Ga0495590_0001557 3300046457 Bacteria 9835
302 Ga0495590_0026207 3300046457 Bacteria 2047
303 Ga0495629_0120236 3300046459 Bacteria 1830
304 Ga0495582_0360155 3300046473 Bacteria 838
305 Ga0495639_0007432 3300046475 Bacteria 4702
306 Ga0495664_0321618 3300046477 Unclassified 933
307 Ga0495594_0189767 3300046499 Unclassified 1171
308 Ga0495608_0052963 3300046511 Unclassified 2685
309 Ga0495608_0156092 3300046511 Unclassified 1453
310 Ga0495608_0241780 3300046511 Bacteria 1128
311 Ga0495610_0082158 3300046512 Bacteria 1477
312 Ga0495620_0013742 3300046515 Bacteria 4138
313 Ga0495628_0167916 3300046516 Bacteria 1665
314 Ga0495632_0015958 3300046519 Bacteria 4192
315 Ga0495648_0157747 3300046524 Bacteria 1176
316 Ga0495642_0147424 3300046528 Bacteria 1017
317 Ga0495640_0143495 3300046533 Bacteria 1538
318 Ga0495587_0089749 3300046536 Unclassified 1776
319 Ga0495598_0045313 3300046537 Bacteria 1303
320 Ga0495621_0014553 3300046539 Bacteria 2492
321 Ga0495597_0114056 3300046542 Bacteria 1131
322 Ga0495645_0159944 3300046543 Bacteria 1558
323 Ga0495667_0016009 3300046559 Bacteria 5068
324 Ga0495668_0030431 3300046616 Bacteria 3048
325 Ga0495625_0011791 3300046660 Bacteria 7101
326 Ga0495588_0013226 3300046674 Bacteria 3927
327 Ga0495647_0070563 3300046681 Bacteria 1398
328 Ga0495647_0181305 3300046681 Bacteria 916
329 Ga0495624_0007958 3300046690 Bacteria 7433
330 Ga0495649_0005711 3300046694 Bacteria 7849
331 Ga0495660_0061263 3300046810 Bacteria 2019
332 Ga0495581_0129008 3300047315 Bacteria 1473
333 Ga0495676_0001948 3300047321 Bacteria 18124
334 Ga0495680_0104058 3300047322 Bacteria 2112
335 Ga0495687_012002 3300047443 Bacteria 4611
336 Ga0495687_025557 3300047443 Bacteria 2788
337 Ga0495675_0201435 3300047444 Unclassified 1211
338 Ga0495681_0090197 3300047470 Bacteria 1355
339 Ga0495684_0186247 3300047471 Unclassified 1537
340 Ga0495593_0014751 3300047673 Bacteria 4441
341 Ga0495593_0133343 3300047673 Bacteria 1260
342 Ga0495602_0100385 3300048088 Bacteria 2377
343 Ga0495626_0053517 3300048091 Bacteria 1857
344 Ga0496100_0165366 3300048903 Bacteria 1589
345 Ga0496101_0005783 3300048904 Bacteria 7905
346 Ga0496101_0357093 3300048904 Bacteria 1149
347 Ga0496102_0006336 3300048905 Bacteria 10089
348 Ga0496104_0064920 3300048907 Bacteria 3463
349 Ga0496104_0572820 3300048907 Bacteria 1039
350 Ga0496105_0009639 3300048908 Bacteria 7560
351 Ga0496105_0058965 3300048908 Bacteria 3167
352 Ga0496106_0164031 3300048909 Bacteria 1758
353 Ga0496107_0220185 3300048910 Bacteria 1412
354 Ga0496108_0065564 3300048911 Bacteria 3061
355 Ga0496108_0344918 3300048911 Bacteria 1299
356 Ga0496108_0509938 3300048911 Bacteria 1050
357 Ga0496109_0078734 3300048912 Bacteria 3035
358 Ga0496109_0767502 3300048912 Unclassified 902
359 Ga0496110_0022736 3300048913 Bacteria 5327
360 Ga0496110_0506489 3300048913 Bacteria 1099
361 Ga0496111_0056554 3300048914 Bacteria 2838
362 Ga0496111_0524030 3300048914 Unclassified 871
363 Ga0496112_0027480 3300048915 Bacteria 5485
364 Ga0496113_0264316 3300048916 Bacteria 1375
365 Ga0496114_0346183 3300048917 Bacteria 1314
366 Ga0496114_0546442 3300048917 Bacteria 1024
367 Ga0496125_0018984 3300048928 Bacteria 6506
368 Ga0501076_0185711 3300049592 Bacteria 1696
369 nmdc:mga0k408_132176_c1 3300050493 Bacteria 1482
370 nmdc:mga0k408_158180_c1 3300050493 Bacteria 1350
371 nmdc:mga0k408_17363_c1 3300050493 Bacteria 4009
372 nmdc:mga0k408_37865_c1 3300050493 Bacteria 2769
373 nmdc:mga0k408_86693_c1 3300050493 Bacteria 1838
374 nmdc:mga07m45_2046_c1 3300050496 Bacteria 9366
375 nmdc:mga07m45_329_c1 3300050496 Bacteria 19212
376 nmdc:mga07m45_78609_c1 3300050496 Bacteria 1882
377 nmdc:mga09592_7548_c1 3300050508 Bacteria 8849
378 Ga0495595_0023766 3300053084 Unclassified 2702
379 Ga0495619_0017056 3300053085 Unclassified 4604
380 Ga0500651_0083649 3300053093 Bacteria 1974
381 Ga0500658_0003812 3300053134 Bacteria 5673
382 Ga0500568_0027563 3300053139 Bacteria 2374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0321618 Ga0495664_0321618_11_541 176
2 3300009093 Ga0105240_10079935 Ga0105240_100799353 182
3 3300046473 Ga0495582_0360155 Ga0495582_0360155_21_590 185
4 iso_pu_bacteria 2596583598 2597030710 195
5 3300031456 Ga0307513_10226666 Ga0307513_102266663 197
6 3300014497 Ga0182008_10007239 Ga0182008_100072393 199
7 3300015262 Ga0182007_10005180 Ga0182007_100051804 199
8 3300015265 Ga0182005_1031777 Ga0182005_10317771 199
9 3300042876 Ga0451577_0000058 Ga0451577_0000058_9651_10280 203
10 3300044712 Ga0453684_0000279 Ga0453684_0000279_106308_106937 203
11 3300045051 Ga0451576_0020874 Ga0451576_0020874_1917_2546 203
12 3300048911 Ga0496108_0509938 Ga0496108_0509938_375_1001 203
13 3300031251 Ga0265327_10009929 Ga0265327_100099292 205
14 3300005355 Ga0070671_100467466 Ga0070671_1004674661 208
15 3300005364 Ga0070673_100964135 Ga0070673_1009641351 208
16 3300005367 Ga0070667_100037874 Ga0070667_1000378742 208
17 3300005456 Ga0070678_100347324 Ga0070678_1003473242 208
18 3300005617 Ga0068859_100505233 Ga0068859_1005052332 208
19 3300005842 Ga0068858_100279750 Ga0068858_1002797502 208
20 3300006195 Ga0075366_10008312 Ga0075366_100083122 208
21 3300006931 Ga0097620_100505288 Ga0097620_1005052882 208
22 3300009101 Ga0105247_10397178 Ga0105247_103971782 208
23 3300009177 Ga0105248_10020100 Ga0105248_1002010014 208
24 3300013306 Ga0163162_10198305 Ga0163162_101983052 208
25 3300014968 Ga0157379_10356265 Ga0157379_103562652 208
26 3300017792 Ga0163161_10136140 Ga0163161_101361402 208
27 3300025903 Ga0207680_10038072 Ga0207680_100380722 208
28 3300025941 Ga0207711_10287042 Ga0207711_102870422 208
29 3300025960 Ga0207651_10624476 Ga0207651_106244761 208
30 3300025972 Ga0207668_10202190 Ga0207668_102021902 208
31 3300026088 Ga0207641_10160292 Ga0207641_101602922 208
32 3300026121 Ga0207683_10040845 Ga0207683_100408452 208
33 3300028379 Ga0268266_10438173 Ga0268266_104381732 208
34 3300045051 Ga0451576_0018881 Ga0451576_0018881_4098_4739 208
35 3300046459 Ga0495629_0120236 Ga0495629_0120236_471_1100 208
36 3300046475 Ga0495639_0007432 Ga0495639_0007432_1188_1817 208
37 3300046511 Ga0495608_0241780 Ga0495608_0241780_388_1017 208
38 3300046528 Ga0495642_0147424 Ga0495642_0147424_247_876 208
39 3300046537 Ga0495598_0045313 Ga0495598_0045313_324_953 208
40 3300046543 Ga0495645_0159944 Ga0495645_0159944_688_1317 208
41 3300046674 Ga0495588_0013226 Ga0495588_0013226_2832_3461 208
42 3300047315 Ga0495581_0129008 Ga0495581_0129008_436_1065 208
43 3300047470 Ga0495681_0090197 Ga0495681_0090197_715_1344 208
44 3300047673 Ga0495593_0133343 Ga0495593_0133343_331_960 208
45 3300048903 Ga0496100_0165366 Ga0496100_0165366_800_1432 208
46 3300048904 Ga0496101_0005783 Ga0496101_0005783_76_705 208
47 3300048904 Ga0496101_0357093 Ga0496101_0357093_349_981 208
48 3300048905 Ga0496102_0006336 Ga0496102_0006336_6387_7016 208
49 3300048907 Ga0496104_0572820 Ga0496104_0572820_76_705 208
50 3300048908 Ga0496105_0058965 Ga0496105_0058965_1854_2483 208
51 3300048909 Ga0496106_0164031 Ga0496106_0164031_970_1599 208
52 3300048910 Ga0496107_0220185 Ga0496107_0220185_376_1005 208
53 3300048911 Ga0496108_0344918 Ga0496108_0344918_387_1019 208
54 3300048913 Ga0496110_0022736 Ga0496110_0022736_570_1199 208
55 3300048914 Ga0496111_0056554 Ga0496111_0056554_155_784 208
56 3300048915 Ga0496112_0027480 Ga0496112_0027480_384_1016 208
57 3300050493 nmdc:mga0k408_17363_c1 nmdc:mga0k408_17363_c1_2856_3488 208
58 3300005328 Ga0070676_10032824 Ga0070676_100328242 209
59 3300005331 Ga0070670_100660876 Ga0070670_1006608761 209
60 3300005334 Ga0068869_100013729 Ga0068869_1000137292 209
61 3300005335 Ga0070666_10038137 Ga0070666_100381372 209
62 3300005338 Ga0068868_100006149 Ga0068868_1000061493 209
63 3300005340 Ga0070689_100041065 Ga0070689_1000410652 209
64 3300005343 Ga0070687_100151311 Ga0070687_1001513112 209
65 3300005344 Ga0070661_100137217 Ga0070661_1001372171 209
66 3300005354 Ga0070675_100004134 Ga0070675_1000041347 209
67 3300005355 Ga0070671_100003152 Ga0070671_1000031523 209
68 3300005355 Ga0070671_100203721 Ga0070671_1002037212 209
69 3300005364 Ga0070673_100002048 Ga0070673_1000020483 209
70 3300005364 Ga0070673_100158146 Ga0070673_1001581462 209
71 3300005367 Ga0070667_100012959 Ga0070667_1000129593 209
72 3300005456 Ga0070678_100001592 Ga0070678_1000015923 209
73 3300005457 Ga0070662_100018931 Ga0070662_1000189313 209
74 3300005459 Ga0068867_100013680 Ga0068867_1000136803 209
75 3300005466 Ga0070685_10006160 Ga0070685_100061603 209
76 3300005543 Ga0070672_100010691 Ga0070672_1000106912 209
77 3300005544 Ga0070686_100074636 Ga0070686_1000746362 209
78 3300005615 Ga0070702_100348298 Ga0070702_1003482982 209
79 3300005617 Ga0068859_100049918 Ga0068859_1000499183 209
80 3300005618 Ga0068864_100000330 Ga0068864_1000003303 209
81 3300005719 Ga0068861_100054391 Ga0068861_1000543912 209
82 3300005841 Ga0068863_100000715 Ga0068863_1000007152 209
83 3300005842 Ga0068858_100000900 Ga0068858_10000090028 209
84 3300005843 Ga0068860_100192293 Ga0068860_1001922932 209
85 3300005844 Ga0068862_100177501 Ga0068862_1001775012 209
86 3300006195 Ga0075366_10098201 Ga0075366_100982012 209
87 3300006237 Ga0097621_100002284 Ga0097621_10000228410 209
88 3300006237 Ga0097621_100055097 Ga0097621_1000550973 209
89 3300006358 Ga0068871_100018973 Ga0068871_1000189733 209
90 3300006931 Ga0097620_100049919 Ga0097620_1000499193 209
91 3300009177 Ga0105248_10007165 Ga0105248_100071653 209
92 3300013296 Ga0157374_10059151 Ga0157374_100591512 209
93 3300013297 Ga0157378_10392838 Ga0157378_103928382 209
94 3300013306 Ga0163162_10012080 Ga0163162_100120803 209
95 3300013308 Ga0157375_10007271 Ga0157375_100072716 209
96 3300013308 Ga0157375_10200305 Ga0157375_102003052 209
97 3300014325 Ga0163163_10000980 Ga0163163_1000098022 209
98 3300014969 Ga0157376_10040936 Ga0157376_100409363 209
99 3300015683 Ga0183362_10002 Ga0183362_10002146 209
100 3300017792 Ga0163161_10037507 Ga0163161_100375073 209
101 3300025903 Ga0207680_10034426 Ga0207680_100344262 209
102 3300025907 Ga0207645_10052547 Ga0207645_100525472 209
103 3300025918 Ga0207662_10276116 Ga0207662_102761162 209
104 3300025920 Ga0207649_10109075 Ga0207649_101090752 209
105 3300025926 Ga0207659_10001225 Ga0207659_100012253 209
106 3300025931 Ga0207644_10008015 Ga0207644_100080152 209
107 3300025933 Ga0207706_10039037 Ga0207706_100390373 209
108 3300025935 Ga0207709_10030138 Ga0207709_100301384 209
109 3300025936 Ga0207670_10046429 Ga0207670_100464292 209
110 3300025940 Ga0207691_10035590 Ga0207691_100355902 209
111 3300025941 Ga0207711_10007733 Ga0207711_100077333 209
112 3300025941 Ga0207711_10049161 Ga0207711_100491612 209
113 3300025942 Ga0207689_10038322 Ga0207689_100383222 209
114 3300025960 Ga0207651_10017289 Ga0207651_100172893 209
115 3300025986 Ga0207658_10027419 Ga0207658_100274193 209
116 3300026023 Ga0207677_10010720 Ga0207677_100107203 209
117 3300026035 Ga0207703_10033884 Ga0207703_100338842 209
118 3300026041 Ga0207639_10150065 Ga0207639_101500652 209
119 3300026088 Ga0207641_10003696 Ga0207641_100036962 209
120 3300026089 Ga0207648_10058659 Ga0207648_100586593 209
121 3300026089 Ga0207648_10153750 Ga0207648_101537503 209
122 3300026095 Ga0207676_10024453 Ga0207676_100244533 209
123 3300026118 Ga0207675_100076520 Ga0207675_1000765202 209
124 3300028380 Ga0268265_10085383 Ga0268265_100853832 209
125 3300028381 Ga0268264_10063294 Ga0268264_100632942 209
126 3300028573 Ga0265334_10110036 Ga0265334_101100362 209
127 3300028666 Ga0265336_10000048 Ga0265336_1000004819 209
128 3300028800 Ga0265338_10075883 Ga0265338_100758831 209
129 3300035171 Ga0373946_0063514 Ga0373946_0063514_185_889 209
130 3300035695 Ga0373927_0478923 Ga0373927_0478923_82_786 209
131 3300037068 Ga0373925_0258631 Ga0373925_0258631_395_1099 209
132 3300042014 Ga0439457_047613 Ga0439457_047613_225_857 209
133 3300046454 Ga0495592_0000159 Ga0495592_0000159_53576_54250 209
134 3300046524 Ga0495648_0157747 Ga0495648_0157747_480_1154 209
135 3300046681 Ga0495647_0070563 Ga0495647_0070563_203_907 209
136 3300046681 Ga0495647_0181305 Ga0495647_0181305_27_731 209
137 3300048907 Ga0496104_0064920 Ga0496104_0064920_1457_2161 209
138 3300048908 Ga0496105_0009639 Ga0496105_0009639_1147_1851 209
139 3300048911 Ga0496108_0065564 Ga0496108_0065564_205_855 209
140 3300048912 Ga0496109_0767502 Ga0496109_0767502_130_759 209
141 3300048913 Ga0496110_0506489 Ga0496110_0506489_320_970 209
142 3300048914 Ga0496111_0524030 Ga0496111_0524030_196_825 209
143 3300048917 Ga0496114_0346183 Ga0496114_0346183_294_998 209
144 3300048917 Ga0496114_0546442 Ga0496114_0546442_75_704 209
145 3300005354 Ga0070675_101116491 Ga0070675_1011164911 210
146 3300005364 Ga0070673_100500806 Ga0070673_1005008062 210
147 3300005548 Ga0070665_100671258 Ga0070665_1006712582 210
148 3300006195 Ga0075366_10038164 Ga0075366_100381642 210
149 3300006353 Ga0075370_10001593 Ga0075370_100015935 210
150 3300035695 Ga0373927_0057469 Ga0373927_0057469_81_719 210
151 3300037068 Ga0373925_0012886 Ga0373925_0012886_48_686 210
152 3300037471 Ga0395905_0016077 Ga0395905_0016077_4702_5343 210
153 3300050496 nmdc:mga07m45_2046_c1 nmdc:mga07m45_2046_c1_4204_4863 210
154 3300005330 Ga0070690_100201615 Ga0070690_1002016152 211
155 3300005338 Ga0068868_100107861 Ga0068868_1001078612 211
156 3300005347 Ga0070668_100395530 Ga0070668_1003955301 211
157 3300005367 Ga0070667_100191014 Ga0070667_1001910142 211
158 3300005434 Ga0070709_10355284 Ga0070709_103552842 211
159 3300005435 Ga0070714_100202166 Ga0070714_1002021662 211
160 3300005436 Ga0070713_100094425 Ga0070713_1000944252 211
161 3300005543 Ga0070672_100002330 Ga0070672_1000023302 211
162 3300005543 Ga0070672_100049323 Ga0070672_1000493234 211
163 3300005543 Ga0070672_100630606 Ga0070672_1006306062 211
164 3300005548 Ga0070665_100005162 Ga0070665_1000051623 211
165 3300005548 Ga0070665_100085705 Ga0070665_1000857052 211
166 3300005614 Ga0068856_100296636 Ga0068856_1002966361 211
167 3300005617 Ga0068859_100233202 Ga0068859_1002332022 211
168 3300005618 Ga0068864_100215660 Ga0068864_1002156601 211
169 3300005841 Ga0068863_100015691 Ga0068863_1000156914 211
170 3300005843 Ga0068860_100572353 Ga0068860_1005723532 211
171 3300006042 Ga0075368_10097881 Ga0075368_100978811 211
172 3300006173 Ga0070716_100080738 Ga0070716_1000807382 211
173 3300006175 Ga0070712_100190520 Ga0070712_1001905202 211
174 3300006175 Ga0070712_100195109 Ga0070712_1001951092 211
175 3300006195 Ga0075366_10020159 Ga0075366_100201592 211
176 3300006846 Ga0075430_100037816 Ga0075430_1000378161 211
177 3300006880 Ga0075429_100000492 Ga0075429_10000049221 211
178 3300006881 Ga0068865_100267380 Ga0068865_1002673802 211
179 3300006931 Ga0097620_100233195 Ga0097620_1002331952 211
180 3300009176 Ga0105242_10269762 Ga0105242_102697622 211
181 3300009177 Ga0105248_10204258 Ga0105248_102042582 211
182 3300009553 Ga0105249_10227901 Ga0105249_102279012 211
183 3300010375 Ga0105239_10754270 Ga0105239_107542701 211
184 3300013296 Ga0157374_10057214 Ga0157374_100572142 211
185 3300013296 Ga0157374_10319123 Ga0157374_103191232 211
186 3300013306 Ga0163162_10595967 Ga0163162_105959671 211
187 3300013308 Ga0157375_10005147 Ga0157375_100051473 211
188 3300013308 Ga0157375_10053755 Ga0157375_100537554 211
189 3300014497 Ga0182008_10081647 Ga0182008_100816472 211
190 3300025901 Ga0207688_10367861 Ga0207688_103678612 211
191 3300025906 Ga0207699_10126528 Ga0207699_101265282 211
192 3300025907 Ga0207645_10293433 Ga0207645_102934331 211
193 3300025915 Ga0207693_10297112 Ga0207693_102971122 211
194 3300025916 Ga0207663_10119436 Ga0207663_101194362 211
195 3300025926 Ga0207659_10123529 Ga0207659_101235292 211
196 3300025928 Ga0207700_10187727 Ga0207700_101877272 211
197 3300025929 Ga0207664_10598244 Ga0207664_105982441 211
198 3300025938 Ga0207704_10172158 Ga0207704_101721582 211
199 3300025939 Ga0207665_10081677 Ga0207665_100816771 211
200 3300025940 Ga0207691_10019803 Ga0207691_100198032 211
201 3300025940 Ga0207691_10082150 Ga0207691_100821502 211
202 3300025986 Ga0207658_10159614 Ga0207658_101596142 211
203 3300026023 Ga0207677_10133521 Ga0207677_101335212 211
204 3300026088 Ga0207641_10027161 Ga0207641_100271613 211
205 3300026095 Ga0207676_10031729 Ga0207676_100317292 211
206 3300026121 Ga0207683_10006668 Ga0207683_100066683 211
207 3300028379 Ga0268266_10159604 Ga0268266_101596042 211
208 3300028381 Ga0268264_10160777 Ga0268264_101607772 211
209 3300035113 Ga0373936_0046219 Ga0373936_0046219_759_1400 211
210 3300035724 Ga0373933_0138836 Ga0373933_0138836_284_925 211
211 3300036401 Ga0373937_0032556 Ga0373937_0032556_3203_3844 211
212 3300037068 Ga0373925_0097289 Ga0373925_0097289_890_1531 211
213 3300037418 Ga0395900_0014306 Ga0395900_0014306_3086_3739 211
214 3300037471 Ga0395905_0053333 Ga0395905_0053333_1976_2620 211
215 3300037471 Ga0395905_0205819 Ga0395905_0205819_490_1143 211
216 3300037471 Ga0395905_0243146 Ga0395905_0243146_746_1399 211
217 3300042876 Ga0451577_0031552 Ga0451577_0031552_2747_3406 211
218 3300044712 Ga0453684_0387775 Ga0453684_0387775_429_1088 211
219 3300046499 Ga0495594_0189767 Ga0495594_0189767_308_949 211
220 3300046511 Ga0495608_0052963 Ga0495608_0052963_186_827 211
221 3300046533 Ga0495640_0143495 Ga0495640_0143495_650_1288 211
222 3300046536 Ga0495587_0089749 Ga0495587_0089749_440_1081 211
223 3300046539 Ga0495621_0014553 Ga0495621_0014553_1698_2348 211
224 3300046559 Ga0495667_0016009 Ga0495667_0016009_3356_3997 211
225 3300047322 Ga0495680_0104058 Ga0495680_0104058_924_1565 211
226 3300047444 Ga0495675_0201435 Ga0495675_0201435_506_1147 211
227 3300047471 Ga0495684_0186247 Ga0495684_0186247_858_1499 211
228 3300048916 Ga0496113_0264316 Ga0496113_0264316_672_1316 211
229 3300049592 Ga0501076_0185711 Ga0501076_0185711_606_1247 211
230 3300050493 nmdc:mga0k408_132176_c1 nmdc:mga0k408_132176_c1_685_1335 211
231 3300050493 nmdc:mga0k408_37865_c1 nmdc:mga0k408_37865_c1_687_1343 211
232 3300050496 nmdc:mga07m45_78609_c1 nmdc:mga07m45_78609_c1_513_1160 211
233 3300050508 nmdc:mga09592_7548_c1 nmdc:mga09592_7548_c1_4684_5331 211
234 3300053084 Ga0495595_0023766 Ga0495595_0023766_1243_1884 211
235 3300053085 Ga0495619_0017056 Ga0495619_0017056_3798_4439 211
236 3300009148 Ga0105243_10038511 Ga0105243_100385112 212
237 iso_pu_bacteria 2599185178 2599446959 212
238 iso_pu_bacteria 2885266251 2885267862 212
239 iso_pu_bacteria 2928058823 2928061342 212
240 3300005331 Ga0070670_100018862 Ga0070670_1000188625 213
241 3300005335 Ga0070666_10041727 Ga0070666_100417272 213
242 3300005354 Ga0070675_100019873 Ga0070675_1000198735 213
243 3300005355 Ga0070671_100019944 Ga0070671_1000199445 213
244 3300005355 Ga0070671_100132850 Ga0070671_1001328501 213
245 3300005367 Ga0070667_100668704 Ga0070667_1006687041 213
246 3300005543 Ga0070672_100023441 Ga0070672_1000234414 213
247 3300005548 Ga0070665_100032110 Ga0070665_1000321103 213
248 3300005617 Ga0068859_100036646 Ga0068859_1000366463 213
249 3300005618 Ga0068864_100010163 Ga0068864_10001016311 213
250 3300005618 Ga0068864_100011754 Ga0068864_1000117548 213
251 3300005841 Ga0068863_100096712 Ga0068863_1000967123 213
252 3300005841 Ga0068863_100111166 Ga0068863_1001111663 213
253 3300005841 Ga0068863_100145557 Ga0068863_1001455571 213
254 3300005843 Ga0068860_100349241 Ga0068860_1003492412 213
255 3300006195 Ga0075366_10004405 Ga0075366_100044053 213
256 3300006237 Ga0097621_100033077 Ga0097621_1000330773 213
257 3300006237 Ga0097621_100089964 Ga0097621_1000899642 213
258 3300006353 Ga0075370_10000129 Ga0075370_100001292 213
259 3300006353 Ga0075370_10107650 Ga0075370_101076502 213
260 3300006358 Ga0068871_100041642 Ga0068871_1000416423 213
261 3300006931 Ga0097620_100036646 Ga0097620_1000366463 213
262 3300009101 Ga0105247_10112558 Ga0105247_101125583 213
263 3300011119 Ga0105246_10027612 Ga0105246_100276122 213
264 3300013308 Ga0157375_10025037 Ga0157375_1002503711 213
265 3300013308 Ga0157375_10250650 Ga0157375_102506502 213
266 3300014969 Ga0157376_10354302 Ga0157376_103543022 213
267 3300025298 Ga0209050_1003089 Ga0209050_100308913 213
268 3300025303 Ga0209051_1001799 Ga0209051_10017994 213
269 3300025304 Ga0209257_1000053 Ga0209257_1000053272 213
270 3300025927 Ga0207687_10072828 Ga0207687_100728282 213
271 3300025931 Ga0207644_10024808 Ga0207644_100248085 213
272 3300025940 Ga0207691_10009318 Ga0207691_100093183 213
273 3300025945 Ga0207679_10433811 Ga0207679_104338112 213
274 3300025960 Ga0207651_10078913 Ga0207651_100789132 213
275 3300026023 Ga0207677_10057208 Ga0207677_100572082 213
276 3300026088 Ga0207641_10124067 Ga0207641_101240673 213
277 3300026088 Ga0207641_10239897 Ga0207641_102398972 213
278 3300026095 Ga0207676_10002137 Ga0207676_100021373 213
279 3300026095 Ga0207676_10077315 Ga0207676_100773152 213
280 3300026121 Ga0207683_10103061 Ga0207683_101030612 213
281 3300026142 Ga0207698_10030722 Ga0207698_100307224 213
282 3300028794 Ga0307515_10448891 Ga0307515_104488912 213
283 3300030522 Ga0307512_10054455 Ga0307512_100544551 213
284 3300031238 Ga0265332_10000005 Ga0265332_1000000555 213
285 3300031456 Ga0307513_10154391 Ga0307513_101543912 213
286 3300031507 Ga0307509_10000168 Ga0307509_1000016890 213
287 3300031507 Ga0307509_10002617 Ga0307509_100026172 213
288 3300031649 Ga0307514_10150193 Ga0307514_101501932 213
289 3300031730 Ga0307516_10030247 Ga0307516_100302471 213
290 3300033179 Ga0307507_10166002 Ga0307507_101660022 213
291 3300033180 Ga0307510_10007792 Ga0307510_100077928 213
292 3300041512 Ga0451853_3618205 Ga0451853_3618205_121_792 213
293 3300046457 Ga0495590_0026207 Ga0495590_0026207_522_1199 213
294 3300046511 Ga0495608_0156092 Ga0495608_0156092_43_732 213
295 3300046512 Ga0495610_0082158 Ga0495610_0082158_147_824 213
296 3300046515 Ga0495620_0013742 Ga0495620_0013742_786_1463 213
297 3300046516 Ga0495628_0167916 Ga0495628_0167916_504_1160 213
298 3300046519 Ga0495632_0015958 Ga0495632_0015958_699_1376 213
299 3300046542 Ga0495597_0114056 Ga0495597_0114056_319_996 213
300 3300046616 Ga0495668_0030431 Ga0495668_0030431_742_1398 213
301 3300046660 Ga0495625_0011791 Ga0495625_0011791_1417_2103 213
302 3300046690 Ga0495624_0007958 Ga0495624_0007958_5122_5778 213
303 3300046694 Ga0495649_0005711 Ga0495649_0005711_4703_5380 213
304 3300046810 Ga0495660_0061263 Ga0495660_0061263_846_1523 213
305 3300047321 Ga0495676_0001948 Ga0495676_0001948_12924_13580 213
306 3300047443 Ga0495687_012002 Ga0495687_012002_886_1563 213
307 3300047443 Ga0495687_025557 Ga0495687_025557_844_1521 213
308 3300047673 Ga0495593_0014751 Ga0495593_0014751_963_1619 213
309 3300048091 Ga0495626_0053517 Ga0495626_0053517_979_1656 213
310 3300048912 Ga0496109_0078734 Ga0496109_0078734_1350_2021 213
311 3300050493 nmdc:mga0k408_158180_c1 nmdc:mga0k408_158180_c1_379_1071 213
312 3300050493 nmdc:mga0k408_86693_c1 nmdc:mga0k408_86693_c1_1000_1650 213
313 3300050496 nmdc:mga07m45_329_c1 nmdc:mga07m45_329_c1_17492_18184 213
314 3300053093 Ga0500651_0083649 Ga0500651_0083649_694_1401 213
315 3300053134 Ga0500658_0003812 Ga0500658_0003812_2180_2857 213
316 3300053139 Ga0500568_0027563 Ga0500568_0027563_1496_2173 213
317 3300006358 Ga0068871_100267118 Ga0068871_1002671182 214
318 3300025907 Ga0207645_10096217 Ga0207645_100962171 214
319 3300046457 Ga0495590_0001557 Ga0495590_0001557_1382_2053 214
320 3300048088 Ga0495602_0100385 Ga0495602_0100385_404_1087 214
321 iso_pu_bacteria 2900577576 2900579213 214
322 3300001915 JGI24741J21665_1000631 JGI24741J21665_10006315 216
323 3300001979 JGI24740J21852_10001035 JGI24740J21852_100010357 216
324 3300001979 JGI24740J21852_10004810 JGI24740J21852_100048102 216
325 3300002738 JGI25154J39366_1000383 JGI25154J39366_10003837 216
326 3300003752 Ga0055539_1000207 Ga0055539_10002077 216
327 3300003756 Ga0055533_1006220 Ga0055533_10062201 216
328 3300003758 Ga0055532_1000006 Ga0055532_100000669 216
329 3300003759 Ga0055525_1000649 Ga0055525_10006497 216
330 3300003760 Ga0055527_1000629 Ga0055527_10006299 216
331 3300003761 Ga0055535_1000004 Ga0055535_100000469 216
332 3300003762 Ga0055542_1001713 Ga0055542_10017133 216
333 3300003763 Ga0055529_1000022 Ga0055529_1000022252 216
334 3300003841 Ga0055541_1000423 Ga0055541_10004237 216
335 3300005329 Ga0070683_100525933 Ga0070683_1005259332 216
336 3300005344 Ga0070661_100000209 Ga0070661_10000020937 216
337 3300005455 Ga0070663_100000020 Ga0070663_10000002058 216
338 3300005564 Ga0070664_100000003 Ga0070664_100000003255 216
339 3300005577 Ga0068857_100083972 Ga0068857_1000839723 216
340 3300005578 Ga0068854_100000100 Ga0068854_10000010014 216
341 3300005614 Ga0068856_100000011 Ga0068856_10000001171 216
342 3300005616 Ga0068852_100023472 Ga0068852_1000234722 216
343 3300009093 Ga0105240_10579539 Ga0105240_105795392 216
344 3300013100 Ga0157373_10037688 Ga0157373_100376884 216
345 3300013102 Ga0157371_10000083 Ga0157371_1000008370 216
346 3300013104 Ga0157370_10000141 Ga0157370_100001419 216
347 3300013105 Ga0157369_10008027 Ga0157369_100080274 216
348 3300013307 Ga0157372_10000577 Ga0157372_100005778 216
349 3300015261 Ga0182006_1017888 Ga0182006_10178882 216
350 3300020610 Ga0154015_1166000 Ga0154015_116600020 216
351 3300025224 Ga0209784_100195 Ga0209784_1001953 216
352 3300025224 Ga0209784_100589 Ga0209784_1005896 216
353 3300025225 Ga0209566_100002 Ga0209566_1000021002 216
354 3300025225 Ga0209566_101009 Ga0209566_1010098 216
355 3300025225 Ga0209566_101017 Ga0209566_1010176 216
356 3300025226 Ga0209674_100010 Ga0209674_100010136 216
357 3300025226 Ga0209674_100050 Ga0209674_10005071 216
358 3300025226 Ga0209674_100205 Ga0209674_10020529 216
359 3300025226 Ga0209674_102593 Ga0209674_1025933 216
360 3300025228 Ga0209672_100123 Ga0209672_10012311 216
361 3300025229 Ga0209147_100015 Ga0209147_100015474 216
362 3300025230 Ga0209563_100004 Ga0209563_100004413 216
363 3300025230 Ga0209563_100026 Ga0209563_100026336 216
364 3300025230 Ga0209563_104545 Ga0209563_1045452 216
365 3300025230 Ga0209563_110419 Ga0209563_1104192 216
366 3300025242 Ga0209258_100021 Ga0209258_100021474 216
367 3300025246 Ga0209646_1000075 Ga0209646_1000075190 216
368 3300025250 Ga0209026_1008067 Ga0209026_10080671 216
369 3300025253 Ga0209677_100013 Ga0209677_10001336 216
370 3300025253 Ga0209677_102193 Ga0209677_1021932 216
371 3300025254 Ga0209148_1000043 Ga0209148_10000436 216
372 3300025256 Ga0209759_1014823 Ga0209759_10148233 216
373 3300025256 Ga0209759_1034546 Ga0209759_10345461 216
374 3300025272 Ga0209455_1000028 Ga0209455_1000028474 216
375 3300025913 Ga0207695_10003242 Ga0207695_1000324226 216
376 3300025913 Ga0207695_10008393 Ga0207695_100083932 216
377 3300025920 Ga0207649_10000209 Ga0207649_1000020937 216
378 3300025945 Ga0207679_10000083 Ga0207679_1000008343 216
379 3300025981 Ga0207640_10000111 Ga0207640_1000011152 216
380 3300026067 Ga0207678_10000030 Ga0207678_1000003058 216
381 3300026078 Ga0207702_10000054 Ga0207702_1000005492 216
382 3300026116 Ga0207674_10467698 Ga0207674_104676982 216
383 3300026142 Ga0207698_10031175 Ga0207698_100311753 216
384 3300037418 Ga0395900_0002596 Ga0395900_0002596_3489_4139 216
385 3300037471 Ga0395905_0313351 Ga0395905_0313351_135_785 216
386 3300044650 Ga0466986_0014777 Ga0466986_0014777_2190_2852 216
387 3300048928 Ga0496125_0018984 Ga0496125_0018984_3613_4263 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

35

202

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h2f-assembly1.cif.gz_A crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710 0.8888 35 212
8h2f-assembly1.cif.gz_A crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710 0.8498 35 212
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.8473 37 211
4fzz-assembly1.cif.gz_B exonuclease x in complex with 5' overhanging duplex dna 0.8422 38 213
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.8368 38 211
ID Description Score Start End Superfamily
2p1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8954 38 188 3.30.420.10
2p1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8834 38 188 3.30.420.10
af_Q2FWZ6_2_173_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8827 36 213 3.30.420.10
af_Q2G1Z8_409_554_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8825 31 162 3.30.420.10
af_O69678_9_183_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8609 36 212 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1V6F1S3-F1-model_v4 DNA polymerase III PolC-type (EC 2.7.7.7) 0.9938 40 214 GO:0003676
GO:0003887
GO:0005829
GO:0008408
AF-A0A0D7KAC5-F1-model_v4 DNA polymerase III subunit epsilon 0.9911 9 214 GO:0003676
GO:0005829
GO:0006259
GO:0008408
AF-A0A5C7SZ95-F1-model_v4 3'-5' exonuclease 0.9854 18 216 GO:0003676
GO:0005829
GO:0006259
GO:0008408
AF-A0A257LJ92-F1-model_v4 DNA polymerase III subunit epsilon 0.9851 11 213 GO:0003676
GO:0005829
GO:0006259
GO:0008408
AF-A0A2N2G386-F1-model_v4 DNA polymerase III subunit epsilon 0.9844 9 152 GO:0003676
GO:0005829
GO:0006259
GO:0008408

Feature Viewer

pLDDT pTM Quality
91.45 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map