F430598

General Info

Members Datasets Scaffolds Average Seq Length
386 335 772 223

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0130094|Ga0495638_0130094_602_1372
Length 256
Sequence MPDPVDRAFRVSGLIFAGSRDQHRAQLIRNLRMIVKLLLQNTITTAAMGALLFACAGTLHWPSAWVFLGTCALLGPLCGWWLYRVDPALLAERLRPVLQKNQPAADKIFMTVFIAAMLAWLGAMGLDRRTLSSNMPVAFQLLGLVLYLASTLFTLWVFRENSFAAPVVKLQAERAQRVISTGPYAHVRHPMYSGMILFFAGVSLLLGSWWGLGMVPVILALFAIRIGIEERTLREGLPGYSDYATRVRYRLLPGVW

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
32 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
33 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
34 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
57 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
58 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
59 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
77 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
143 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
144 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
147 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
148 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
149 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
152 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
153 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
159 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
160 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
161 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
162 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
163 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
164 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
165 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
166 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
167 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
168 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
169 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
170 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
171 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
172 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
173 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
174 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
175 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
176 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
177 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
178 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
179 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
180 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
181 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
182 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
183 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
184 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
185 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
186 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
187 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
188 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
189 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
190 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
191 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
192 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
193 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
194 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
195 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
196 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
197 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
198 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
199 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
200 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
201 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
202 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
203 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
204 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
205 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
206 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
207 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
208 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
209 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
210 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
211 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
212 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
213 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
214 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
215 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
216 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
217 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
218 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
219 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
220 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
221 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
222 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
223 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
224 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
225 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
226 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
227 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
228 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
229 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
230 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
231 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
232 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
233 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
234 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
235 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
236 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
237 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
238 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
239 2922368715
240 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
241 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
242 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
243 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
244 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
245 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
246 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
247 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
248 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
249 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
250 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
251 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
252 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
253 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
254 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
255 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
256 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
257 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
258 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
259 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
260 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
261 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
262 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
263 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
264 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
265 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
266 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
267 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
268 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
269 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
270 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
271 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
272 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
273 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
274 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
275 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
276 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
277 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
278 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
279 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
280 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
281 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
282 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
283 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
284 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
285 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
286 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
287 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
288 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
289 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
290 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
291 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
292 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
293 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
294 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
295 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
296 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
297 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
298 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
299 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
300 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
301 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
302 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
303 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
304 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
305 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
306 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
307 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
308 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
309 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
310 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
311 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
312 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
313 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
314 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
315 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
316 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
317 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
318 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
319 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
320 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
321 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
322 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
323 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
324 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
325 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
326 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
327 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
328 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
329 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
330 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
331 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
332 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
333 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
334 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
335 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.1
Metatranscriptomes 0
Isolates 43.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.54
Nodule 36.01
Rhizoplane 4.4
Rhizosphere 28.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0130094 3300046460 Bacteria 1479
2 RicEn_C2329 2010549000 Bacteria 2221
3 JGI25153J46596_10003006 3300003215 Bacteria 9540
4 JGI25153J46596_10003584 3300003215 Bacteria 8625
5 rootH2_10139192 3300003320 Bacteria 1698
6 rootH1_10112554 3300003323 Bacteria 1251
7 Ga0055531_10004398 3300003794 Bacteria 8599
8 Ga0065165_1000626 3300005262 Bacteria 51320
9 Ga0065165_1004879 3300005262 Bacteria 7930
10 Ga0068868_100387693 3300005338 Bacteria 1203
11 Ga0070660_100203056 3300005339 Bacteria 1608
12 Ga0070660_100722098 3300005339 Bacteria 836
13 Ga0070659_100452152 3300005366 Bacteria 1090
14 Ga0070663_100502084 3300005455 Bacteria 1007
15 Ga0070678_100952209 3300005456 Bacteria 787
16 Ga0070665_100026614 3300005548 Bacteria 5823
17 Ga0068856_100478650 3300005614 Bacteria 1266
18 Ga0068852_100005675 3300005616 Bacteria 8949
19 Ga0068863_100302103 3300005841 Bacteria 1553
20 Ga0075363_100304251 3300006048 Bacteria 926
21 Ga0070712_100451844 3300006175 Bacteria 1070
22 Ga0075367_10242125 3300006178 Bacteria 1130
23 Ga0075369_10104338 3300006186 Bacteria 1274
24 Ga0075370_10042421 3300006353 Bacteria 2570
25 Ga0075370_10207664 3300006353 Bacteria 1156
26 Ga0075370_10287011 3300006353 Bacteria 978
27 Ga0099825_1025734 3300006941 Bacteria 3234
28 Ga0105245_10344722 3300009098 Bacteria 1474
29 Ga0105241_10017898 3300009174 Bacteria 5210
30 Ga0105241_10045478 3300009174 Bacteria 3331
31 Ga0105237_10026215 3300009545 Bacteria 5958
32 Ga0105237_10174632 3300009545 Bacteria 2149
33 Ga0105237_10230794 3300009545 Bacteria 1852
34 Ga0105237_10485380 3300009545 Bacteria 1242
35 Ga0105238_10324663 3300009551 Bacteria 1525
36 Ga0105239_10064506 3300010375 Bacteria 4021
37 Ga0105239_10086308 3300010375 Bacteria 3459
38 Ga0157370_10964759 3300013104 Bacteria 773
39 Ga0163162_10210713 3300013306 Bacteria 2073
40 Ga0163163_10135948 3300014325 Bacteria 2500
41 Ga0214544_1000020 3300021320 Bacteria 178560
42 Ga0214542_1000024 3300021321 Bacteria 191218
43 Ga0214545_1000011 3300021324 Bacteria 190550
44 Ga0214543_1000033 3300021327 Bacteria 190419
45 Ga0209148_1000382 3300025254 Bacteria 53278
46 Ga0209233_1012151 3300025261 Bacteria 2507
47 Ga0209233_1014766 3300025261 Bacteria 2191
48 Ga0209564_1005846 3300025295 Bacteria 6842
49 Ga0209758_1000484 3300025297 Bacteria 65301
50 Ga0209758_1006978 3300025297 Bacteria 7873
51 Ga0209758_1010161 3300025297 Bacteria 5689
52 Ga0209758_1013343 3300025297 Bacteria 4489
53 Ga0209256_1005941 3300025299 Bacteria 6723
54 Ga0207426_1000597 3300025302 Bacteria 47604
55 Ga0207426_1005646 3300025302 Bacteria 5658
56 Ga0207426_1072982 3300025302 Bacteria 951
57 Ga0209257_1000708 3300025304 Bacteria 51573
58 Ga0207710_10072862 3300025900 Bacteria 1578
59 Ga0207654_10008221 3300025911 Bacteria 5266
60 Ga0207695_10000029 3300025913 Bacteria 548364
61 Ga0207671_10007694 3300025914 Bacteria 9303
62 Ga0207671_10534599 3300025914 Bacteria 934
63 Ga0207693_10481297 3300025915 Bacteria 969
64 Ga0207649_10251249 3300025920 Bacteria 1274
65 Ga0207687_10119165 3300025927 Bacteria 1971
66 Ga0207690_10537340 3300025932 Bacteria 949
67 Ga0207668_10086094 3300025972 Bacteria 2295
68 Ga0207640_10110010 3300025981 Bacteria 1951
69 Ga0207678_10067457 3300026067 Bacteria 3071
70 Ga0207678_10147305 3300026067 Bacteria 2009
71 Ga0207678_10399774 3300026067 Bacteria 1189
72 Ga0207702_10432485 3300026078 Bacteria 1274
73 Ga0207683_10518308 3300026121 Bacteria 1102
74 Ga0207698_10070283 3300026142 Bacteria 2773
75 Ga0209389_1000011 3300027296 Bacteria 223265
76 Ga0209389_1000127 3300027296 Bacteria 67209
77 Ga0209589_1000243 3300027357 Bacteria 67209
78 Ga0209489_100017 3300027361 Bacteria 223265
79 Ga0209489_102084 3300027361 Bacteria 41097
80 Ga0209700_100027 3300027363 Bacteria 223462
81 Ga0268266_10068943 3300028379 Bacteria 3063
82 Ga0268266_10384510 3300028379 Bacteria 1324
83 Ga0268265_10733888 3300028380 Bacteria 957
84 Ga0307510_10023389 3300033180 Bacteria 7163
85 Ga0307510_10051661 3300033180 Bacteria 4345
86 Ga0395900_0292029 3300037418 Bacteria 1619
87 Ga0395898_0155992 3300037466 Bacteria 2184
88 Ga0395905_0034831 3300037471 Bacteria 4727
89 Ga0395901_0583584 3300038443 Bacteria 1129
90 Ga0451841_1027585 3300041498 Bacteria 1024
91 Ga0466972_0110665 3300044658 Bacteria 1298
92 Ga0466963_0059209 3300044694 Bacteria 2556
93 Ga0466960_0090160 3300044901 Bacteria 1561
94 Ga0466959_0106215 3300045049 Bacteria 2008
95 Ga0466967_0203959 3300045976 Bacteria 1873
96 Ga0495629_0014536 3300046459 Bacteria 5664
97 Ga0495651_0009313 3300046462 Bacteria 7537
98 Ga0495651_0045430 3300046462 Bacteria 3403
99 Ga0495653_0077350 3300046463 Bacteria 2471
100 Ga0495650_0076569 3300046471 Bacteria 1300
101 Ga0495605_0091504 3300046474 Bacteria 1409
102 Ga0495664_0009743 3300046477 Bacteria 5384
103 Ga0495606_0021391 3300046507 Bacteria 4739
104 Ga0495608_0017945 3300046511 Bacteria 4891
105 Ga0495610_0122962 3300046512 Bacteria 1135
106 Ga0495618_0308958 3300046514 Bacteria 981
107 Ga0495628_0020939 3300046516 Bacteria 5386
108 Ga0495648_0022243 3300046524 Bacteria 4369
109 Ga0495648_0134229 3300046524 Bacteria 1311
110 Ga0495652_0068605 3300046529 Bacteria 2970
111 Ga0495652_0273467 3300046529 Bacteria 1240
112 Ga0495640_0024209 3300046533 Bacteria 4418
113 Ga0495609_0161083 3300046538 Bacteria 951
114 Ga0495645_0209801 3300046543 Bacteria 1316
115 Ga0495622_0103474 3300046557 Bacteria 1304
116 Ga0495667_0018183 3300046559 Bacteria 4748
117 Ga0495668_0136295 3300046616 Bacteria 1344
118 Ga0495668_0372340 3300046616 Bacteria 784
119 Ga0495611_0116140 3300046648 Bacteria 1247
120 Ga0495625_0280216 3300046660 Bacteria 1073
121 Ga0495635_0006670 3300046663 Bacteria 8063
122 Ga0495588_0188631 3300046674 Bacteria 1089
123 Ga0495657_0007006 3300046675 Bacteria 8744
124 Ga0495657_0040115 3300046675 Bacteria 3213
125 Ga0495599_0097381 3300046678 Bacteria 1834
126 Ga0495623_0023083 3300046679 Bacteria 4016
127 Ga0495646_0084312 3300046680 Bacteria 1845
128 Ga0495613_0058131 3300046689 Bacteria 2839
129 Ga0495613_0147678 3300046689 Bacteria 1678
130 Ga0495671_0354124 3300046692 Bacteria 704
131 Ga0495649_0109092 3300046694 Bacteria 1468
132 Ga0495649_0136421 3300046694 Bacteria 1293
133 Ga0495600_0007679 3300046809 Bacteria 6609
134 Ga0495600_0035884 3300046809 Bacteria 3222
135 Ga0495604_0001798 3300047317 Bacteria 17470
136 Ga0495604_0020022 3300047317 Bacteria 5347
137 Ga0495604_0097780 3300047317 Bacteria 2164
138 Ga0495676_0076165 3300047321 Bacteria 2563
139 Ga0495680_0003498 3300047322 Bacteria 15418
140 Ga0495675_0103788 3300047444 Bacteria 1777
141 Ga0495673_0056445 3300047469 Bacteria 1699
142 Ga0495673_0101811 3300047469 Bacteria 1160
143 Ga0495684_0306477 3300047471 Bacteria 1139
144 Ga0495686_0114815 3300047472 Bacteria 1611
145 Ga0495602_0001750 3300048088 Bacteria 21663
146 Ga0495602_0020853 3300048088 Bacteria 6467
147 Ga0495602_0528162 3300048088 Bacteria 821
148 Ga0496100_0116552 3300048903 Bacteria 1864
149 Ga0496101_0167913 3300048904 Bacteria 1685
150 Ga0496102_0333777 3300048905 Bacteria 1428
151 Ga0496104_0008403 3300048907 Bacteria 9176
152 Ga0496104_0108849 3300048907 Bacteria 2656
153 Ga0496105_0009755 3300048908 Bacteria 7519
154 Ga0496105_0088903 3300048908 Bacteria 2552
155 Ga0496107_0393198 3300048910 Bacteria 1031
156 Ga0496108_0269909 3300048911 Bacteria 1481
157 Ga0496109_0823459 3300048912 Bacteria 866
158 Ga0496110_0622034 3300048913 Bacteria 979
159 Ga0496112_0272714 3300048915 Bacteria 1640
160 Ga0496112_0529070 3300048915 Bacteria 1113
161 Ga0496113_0300291 3300048916 Bacteria 1286
162 Ga0496113_0366686 3300048916 Bacteria 1156
163 Ga0496114_0037749 3300048917 Bacteria 3996
164 Ga0496115_0783589 3300048918 Bacteria 743
165 Ga0496116_0137133 3300048919 Bacteria 1383
166 Ga0496117_0221695 3300048920 Bacteria 1052
167 Ga0496117_0309968 3300048920 Bacteria 832
168 Ga0496117_0336070 3300048920 Bacteria 785
169 Ga0496118_0088999 3300048921 Bacteria 2133
170 Ga0496119_0006368 3300048922 Bacteria 10974
171 Ga0496120_0005109 3300048923 Bacteria 10609
172 Ga0496121_0051454 3300048924 Bacteria 3468
173 Ga0496122_0299041 3300048925 Bacteria 869
174 Ga0496124_0525625 3300048927 Bacteria 787
175 Ga0496125_0046917 3300048928 Bacteria 3619
176 Ga0496126_0019682 3300048929 Bacteria 6642
177 Ga0496126_0098398 3300048929 Bacteria 2563
178 Ga0496126_0472229 3300048929 Bacteria 1006
179 Ga0501071_0262683 3300049587 Bacteria 1304
180 Ga0501076_0083122 3300049592 Bacteria 2571
181 nmdc:mga0yw44_351056_c1 3300050492 Bacteria 993
182 nmdc:mga0yw44_55729_c1 3300050492 Bacteria 2406
183 nmdc:mga0yw44_99501_c1 3300050492 Bacteria 1850
184 nmdc:mga0k408_522713_c1 3300050493 Bacteria 702
185 nmdc:mga06z11_242402_c1 3300050494 Bacteria 1059
186 nmdc:mga06z11_270090_c1 3300050494 Bacteria 1005
187 nmdc:mga07m45_148024_c1 3300050496 Bacteria 1361
188 nmdc:mga0sz30_122722_c1 3300050516 Bacteria 1142
189 Ga0495655_0005455 3300053083 Bacteria 2247
190 Ga0500578_0110068 3300053086 Bacteria 1737
191 Ga0500578_0133151 3300053086 Bacteria 1558
192 Ga0500578_0251353 3300053086 Bacteria 1065
193 Ga0500578_0337641 3300053086 Bacteria 884
194 Ga0500643_000019 3300053087 Bacteria 294301
195 Ga0500644_0075976 3300053088 Bacteria 1223
196 Ga0500583_0019069 3300053092 Bacteria 2804
197 Ga0500583_0092169 3300053092 Bacteria 1476
198 Ga0500566_0005936 3300053094 Bacteria 7259
199 Ga0500640_157621 3300053095 Bacteria 857
200 Ga0500555_001069 3300053103 Bacteria 9208
201 Ga0500562_002165 3300053108 Bacteria 4908
202 Ga0500595_048225 3300053119 Bacteria 1331
203 Ga0500608_043152 3300053122 Bacteria 2165
204 Ga0500655_004890 3300053133 Bacteria 2407
205 Ga0500658_0048700 3300053134 Bacteria 1724
206 Ga0500559_0026135 3300053136 Bacteria 2485
207 Ga0500568_0033495 3300053139 Bacteria 2107
208 Ga0500616_0108560 3300053153 Bacteria 1344
209 Ga0500622_0050243 3300053156 Bacteria 2148
210 Ga0500627_0098236 3300053158 Bacteria 1313
211 Ga0500633_0036693 3300053160 Bacteria 1622
212 Ga0500636_0000353 3300053177 Bacteria 25304
213 Ga0500645_050591 3300053730 Bacteria 1212
214 Ga0500609_008051 3300053731 Bacteria 1422
215 Ga0500599_000102 3300053736 Bacteria 7853
216 Ga0500601_003798 3300053737 Bacteria 1638
217 2507510161 2507262055 Bacteria 8048963
218 2508697897 2508501042 Bacteria 8719808
219 2513627551 2513237092 Bacteria 8341956
220 2513643875 2513237094 Bacteria 8789602
221 2513648860 2513237095 Bacteria 8976980
222 2513721812 2513237104 Bacteria 10034502
223 2513877977 2513237139 Bacteria 8737671
224 2514017165 2513237161 Bacteria 8871253
225 2515629946 2515154112 Bacteria 8294334
226 2524439183 2524023205 Bacteria 8918781
227 2528854222 2528768022 Bacteria 10457665
228 2617352504 2617270735 Bacteria 9163226
229 2617379086 2617270741 Bacteria 8201522
230 2745078336 2744054633 Bacteria 8678936
231 2793059850 2791355196 Bacteria 7323613
232 2805919937 2802429603 Bacteria 8777136
233 2818241735 2816332527 Bacteria 8933356
234 2824606734 2824600985 Bacteria 8488197
235 2824616377 2824609381 Bacteria 8672835
236 2824624581 2824617872 Bacteria 8814715
237 2824633567 2824626560 Bacteria 8813858
238 2824640469 2824635225 Bacteria 8785348
239 2824651412 2824644064 Bacteria 8743947
240 2824659248 2824653114 Bacteria 8493680
241 2824664902 2824661429 Bacteria 9877870
242 2824674495 2824671348 Bacteria 8369588
243 2824683378 2824679649 Bacteria 8248951
244 2824694326 2824687955 Bacteria 8360029
245 2824699551 2824696289 Bacteria 8335049
246 2824712107 2824704595 Bacteria 9667483
247 2824721467 2824714736 Bacteria 8717648
248 2824727685 2824723954 Bacteria 8758240
249 2824739590 2824732956 Bacteria 7810675
250 2824752499 2824746037 Bacteria 7911610
251 2824761330 2824753945 Bacteria 9787441
252 2824771589 2824763712 Bacteria 9792355
253 2824778135 2824773399 Bacteria 8360218
254 2838125677 2838122688 Bacteria 8803140
255 2841941662 2841941048 Bacteria 8688029
256 2841951091 2841949485 Bacteria 8680857
257 2841959336 2841957949 Bacteria 8652217
258 2841974218 2841966195 Bacteria 8673214
259 2841975886 2841974524 Bacteria 8931498
260 2841989257 2841983080 Bacteria 8395090
261 2842038095 2842038055 Bacteria 8002051
262 2842048959 2842045827 Bacteria 8006841
263 2847934388 2847930680 Bacteria 9342022
264 2847944980 2847939898 Bacteria 8606328
265 2857509815 2857509624 Bacteria 7472071
266 2874593360 2874590934 Bacteria 8299676
267 2874618082 2874612657 Bacteria 8252029
268 2874623057 2874620515 Bacteria 8290088
269 2874636185 2874628541 Bacteria 8630250
270 2874652864 2874645413 Bacteria 8214782
271 2876762774 2876761206 Bacteria 10111113
272 2876773400 2876771140 Bacteria 8287509
273 2876821353 2876818435 Bacteria 8274608
274 2879077316 2879074833 Bacteria 8279565
275 2879089580 2879083081 Bacteria 8587928
276 2879107560 2879099564 Bacteria 10442239
277 2879130126 2879127579 Bacteria 8294491
278 2879146641 2879142872 Bacteria 8267021
279 2881367615 2881364244 Bacteria 7710352
280 2881670746 2881665667 Bacteria 8175609
281 2885368780 2885366525 Bacteria 8326213
282 2885417487 2885409591 Bacteria 9235467
283 2888382309 2888378607 Bacteria 9652610
284 2888422893 2888419890 Bacteria 7857137
285 2904669876 2904666416 Bacteria 8226587
286 2904718617 2904711408 Bacteria 9771557
287 2906634652 2906626472 Bacteria 8826946
288 2906652356 2906643746 Bacteria 8722424
289 2908778575 2908775508 Bacteria 8092255
290 2922375690
291 2922394841 2922393267 Bacteria 8285685
292 2929616411 2929615660 Bacteria 9193770
293 2929625155 2929624759 Bacteria 9339455
294 2932786919 2932784394 Bacteria 9704911
295 2932797200 2932794094 Bacteria 7915132
296 2932804915 2932801729 Bacteria 7987968
297 2932811120 2932809354 Bacteria 9135765
298 2932825888 2932818245 Bacteria 9955613
299 2932832490 2932828146 Bacteria 9745859
300 2933578306 2933577622 Bacteria 9116884
301 2935610936 2935608549 Bacteria 8203142
302 2935619195 2935616580 Bacteria 9032984
303 2935645420 2935638405 Bacteria 10015038
304 2935648363 2935648319 Bacteria 8801166
305 2935657649 2935656913 Bacteria 8965014
306 2935671518 2935665750 Bacteria 9571747
307 2935677245 2935675223 Bacteria 9928132
308 2935691818 2935684952 Bacteria 9590419
309 2935695228 2935694250 Bacteria 9291695
310 2935709669 2935703347 Bacteria 10242284
311 2935719886 2935713505 Bacteria 9608509
312 2935729347 2935722832 Bacteria 9608746
313 2935738793 2935732158 Bacteria 9706831
314 2935748022 2935741537 Bacteria 9707219
315 2935756606 2935750917 Bacteria 9590372
316 2935761416 2935760218 Bacteria 9817913
317 2935771357 2935769743 Bacteria 7878163
318 2935779043 2935777560 Bacteria 8077691
319 2935788251 2935785616 Bacteria 7962367
320 2935796984 2935793552 Bacteria 8012592
321 2935805198 2935801545 Bacteria 9301974
322 2935812267 2935810662 Bacteria 9401221
323 2935820421 2935819856 Bacteria 8261050
324 2935834737 2935827899 Bacteria 10038562
325 2935839050 2935837841 Bacteria 9454360
326 2935849570 2935847175 Bacteria 8228321
327 2935857560 2935855204 Bacteria 9035059
328 2935865094 2935864058 Bacteria 9784707
329 2935881670 2935873716 Bacteria 9632195
330 2935884847 2935883170 Bacteria 7964738
331 2935911657 2935908558 Bacteria 8568796
332 2935919311 2935916978 Bacteria 9113783
333 2935928686 2935926038 Bacteria 8601059
334 2935938331 2935934488 Bacteria 8602579
335 2935945777 2935942939 Bacteria 8599779
336 2935954616 2935951376 Bacteria 8602333
337 2935963213 2935959822 Bacteria 7869783
338 2935970503 2935967501 Bacteria 8603075
339 2935987724 2935984226 Bacteria 8302647
340 2935997324 2935992306 Bacteria 9802711
341 2936005106 2936002035 Bacteria 9362176
342 2936011273 2936011229 Bacteria 8801034
343 2936019868 2936019824 Bacteria 8804134
344 2936028464 2936028420 Bacteria 8965941
345 2936038861 2936037263 Bacteria 9446081
346 2936046591 2936046547 Bacteria 8903709
347 2936062286 2936055302 Bacteria 8785755
348 2940562520 2940556831 Bacteria 9590747
349 2941536254 2941531003 Bacteria 7653939
350 2941539740 2941538514 Bacteria 9402094
351 3005487802 3005483717 Bacteria 7877331
352 3005589305 3005587118 Bacteria 7794411
353 3005597334 3005594810 Bacteria 8716512
354 3005713362 3005710791 Bacteria 7622528
355 3005720711 3005718088 Bacteria 8283608
356 8016515300 8016511872 Bacteria 9921665
357 8016523034 8016522445 Bacteria 8156687
358 8016536497 8016530956 Bacteria 8155261
359 8016540777 8016539877 Bacteria 8155419
360 8016552466 8016548790 Bacteria 8155074
361 8016560848 8016557553 Bacteria 8154380
362 8016574857 8016566248 Bacteria 8158151
363 8016578930 8016575299 Bacteria 8154085
364 8016590698 8016583857 Bacteria 10421953
365 8016598720 8016595262 Bacteria 8149947
366 8016612367 8016603502 Bacteria 8731218
367 8016621440 8016613128 Bacteria 8794220
368 8016628514 8016622563 Bacteria 7999408
369 8016632722 8016630954 Bacteria 9217207
370 8017061163 8017057580 Bacteria 10023680
371 8019536213 8019530166 Bacteria 8155624
372 8019543249 8019538911 Bacteria 7872763
373 8019555597 8019547302 Bacteria 7996444
374 8019580638 8019576017 Bacteria 10049540
375 8019602975 8019597564 Bacteria 10041141
376 8019615573 8019608314 Bacteria 10042931
377 8019626375 8019619141 Bacteria 9218857
378 8019636118 8019629233 Bacteria 8687553
379 8019643545 8019638758 Bacteria 9062356
380 8019656347 8019648815 Bacteria 10014479
381 8019663887 8019659431 Bacteria 8577854
382 8019673515 8019668869 Bacteria 8791617
383 8019682615 8019678201 Bacteria 8863603
384 8019688299 8019687851 Bacteria 8712826
385 8055748057 8055742211 Bacteria 9226248
386 8056969403 8056967851 Bacteria 9038162
387 Ga0495638_0130094
388 RicEn_C2329
389 JGI25153J46596_10003006
390 JGI25153J46596_10003584
391 rootH2_10139192
392 rootH1_10112554
393 Ga0055531_10004398
394 Ga0065165_1000626
395 Ga0065165_1004879
396 Ga0068868_100387693
397 Ga0070660_100203056
398 Ga0070660_100722098
399 Ga0070659_100452152
400 Ga0070663_100502084
401 Ga0070678_100952209
402 Ga0070665_100026614
403 Ga0068856_100478650
404 Ga0068852_100005675
405 Ga0068863_100302103
406 Ga0075363_100304251
407 Ga0070712_100451844
408 Ga0075367_10242125
409 Ga0075369_10104338
410 Ga0075370_10042421
411 Ga0075370_10207664
412 Ga0075370_10287011
413 Ga0099825_1025734
414 Ga0105245_10344722
415 Ga0105241_10017898
416 Ga0105241_10045478
417 Ga0105237_10026215
418 Ga0105237_10174632
419 Ga0105237_10230794
420 Ga0105237_10485380
421 Ga0105238_10324663
422 Ga0105239_10064506
423 Ga0105239_10086308
424 Ga0157370_10964759
425 Ga0163162_10210713
426 Ga0163163_10135948
427 Ga0214544_1000020
428 Ga0214542_1000024
429 Ga0214545_1000011
430 Ga0214543_1000033
431 Ga0209148_1000382
432 Ga0209233_1012151
433 Ga0209233_1014766
434 Ga0209564_1005846
435 Ga0209758_1000484
436 Ga0209758_1006978
437 Ga0209758_1010161
438 Ga0209758_1013343
439 Ga0209256_1005941
440 Ga0207426_1000597
441 Ga0207426_1005646
442 Ga0207426_1072982
443 Ga0209257_1000708
444 Ga0207710_10072862
445 Ga0207654_10008221
446 Ga0207695_10000029
447 Ga0207671_10007694
448 Ga0207671_10534599
449 Ga0207693_10481297
450 Ga0207649_10251249
451 Ga0207687_10119165
452 Ga0207690_10537340
453 Ga0207668_10086094
454 Ga0207640_10110010
455 Ga0207678_10067457
456 Ga0207678_10147305
457 Ga0207678_10399774
458 Ga0207702_10432485
459 Ga0207683_10518308
460 Ga0207698_10070283
461 Ga0209389_1000011
462 Ga0209389_1000127
463 Ga0209589_1000243
464 Ga0209489_100017
465 Ga0209489_102084
466 Ga0209700_100027
467 Ga0268266_10068943
468 Ga0268266_10384510
469 Ga0268265_10733888
470 Ga0307510_10023389
471 Ga0307510_10051661
472 Ga0395900_0292029
473 Ga0395898_0155992
474 Ga0395905_0034831
475 Ga0395901_0583584
476 Ga0451841_1027585
477 Ga0466972_0110665
478 Ga0466963_0059209
479 Ga0466960_0090160
480 Ga0466959_0106215
481 Ga0466967_0203959
482 Ga0495629_0014536
483 Ga0495651_0009313
484 Ga0495651_0045430
485 Ga0495653_0077350
486 Ga0495650_0076569
487 Ga0495605_0091504
488 Ga0495664_0009743
489 Ga0495606_0021391
490 Ga0495608_0017945
491 Ga0495610_0122962
492 Ga0495618_0308958
493 Ga0495628_0020939
494 Ga0495648_0022243
495 Ga0495648_0134229
496 Ga0495652_0068605
497 Ga0495652_0273467
498 Ga0495640_0024209
499 Ga0495609_0161083
500 Ga0495645_0209801
501 Ga0495622_0103474
502 Ga0495667_0018183
503 Ga0495668_0136295
504 Ga0495668_0372340
505 Ga0495611_0116140
506 Ga0495625_0280216
507 Ga0495635_0006670
508 Ga0495588_0188631
509 Ga0495657_0007006
510 Ga0495657_0040115
511 Ga0495599_0097381
512 Ga0495623_0023083
513 Ga0495646_0084312
514 Ga0495613_0058131
515 Ga0495613_0147678
516 Ga0495671_0354124
517 Ga0495649_0109092
518 Ga0495649_0136421
519 Ga0495600_0007679
520 Ga0495600_0035884
521 Ga0495604_0001798
522 Ga0495604_0020022
523 Ga0495604_0097780
524 Ga0495676_0076165
525 Ga0495680_0003498
526 Ga0495675_0103788
527 Ga0495673_0056445
528 Ga0495673_0101811
529 Ga0495684_0306477
530 Ga0495686_0114815
531 Ga0495602_0001750
532 Ga0495602_0020853
533 Ga0495602_0528162
534 Ga0496100_0116552
535 Ga0496101_0167913
536 Ga0496102_0333777
537 Ga0496104_0008403
538 Ga0496104_0108849
539 Ga0496105_0009755
540 Ga0496105_0088903
541 Ga0496107_0393198
542 Ga0496108_0269909
543 Ga0496109_0823459
544 Ga0496110_0622034
545 Ga0496112_0272714
546 Ga0496112_0529070
547 Ga0496113_0300291
548 Ga0496113_0366686
549 Ga0496114_0037749
550 Ga0496115_0783589
551 Ga0496116_0137133
552 Ga0496117_0221695
553 Ga0496117_0309968
554 Ga0496117_0336070
555 Ga0496118_0088999
556 Ga0496119_0006368
557 Ga0496120_0005109
558 Ga0496121_0051454
559 Ga0496122_0299041
560 Ga0496124_0525625
561 Ga0496125_0046917
562 Ga0496126_0019682
563 Ga0496126_0098398
564 Ga0496126_0472229
565 Ga0501071_0262683
566 Ga0501076_0083122
567 nmdc:mga0yw44_351056_c1
568 nmdc:mga0yw44_55729_c1
569 nmdc:mga0yw44_99501_c1
570 nmdc:mga0k408_522713_c1
571 nmdc:mga06z11_242402_c1
572 nmdc:mga06z11_270090_c1
573 nmdc:mga07m45_148024_c1
574 nmdc:mga0sz30_122722_c1
575 Ga0495655_0005455
576 Ga0500578_0110068
577 Ga0500578_0133151
578 Ga0500578_0251353
579 Ga0500578_0337641
580 Ga0500643_000019
581 Ga0500644_0075976
582 Ga0500583_0019069
583 Ga0500583_0092169
584 Ga0500566_0005936
585 Ga0500640_157621
586 Ga0500555_001069
587 Ga0500562_002165
588 Ga0500595_048225
589 Ga0500608_043152
590 Ga0500655_004890
591 Ga0500658_0048700
592 Ga0500559_0026135
593 Ga0500568_0033495
594 Ga0500616_0108560
595 Ga0500622_0050243
596 Ga0500627_0098236
597 Ga0500633_0036693
598 Ga0500636_0000353
599 Ga0500645_050591
600 Ga0500609_008051
601 Ga0500599_000102
602 Ga0500601_003798
603 2507510161
604 2508697897
605 2513627551
606 2513643875
607 2513648860
608 2513721812
609 2513877977
610 2514017165
611 2515629946
612 2524439183
613 2528854222
614 2617352504
615 2617379086
616 2745078336
617 2793059850
618 2805919937
619 2818241735
620 2824606734
621 2824616377
622 2824624581
623 2824633567
624 2824640469
625 2824651412
626 2824659248
627 2824664902
628 2824674495
629 2824683378
630 2824694326
631 2824699551
632 2824712107
633 2824721467
634 2824727685
635 2824739590
636 2824752499
637 2824761330
638 2824771589
639 2824778135
640 2838125677
641 2841941662
642 2841951091
643 2841959336
644 2841974218
645 2841975886
646 2841989257
647 2842038095
648 2842048959
649 2847934388
650 2847944980
651 2857509815
652 2874593360
653 2874618082
654 2874623057
655 2874636185
656 2874652864
657 2876762774
658 2876773400
659 2876821353
660 2879077316
661 2879089580
662 2879107560
663 2879130126
664 2879146641
665 2881367615
666 2881670746
667 2885368780
668 2885417487
669 2888382309
670 2888422893
671 2904669876
672 2904718617
673 2906634652
674 2906652356
675 2908778575
676 2922375690
677 2922394841
678 2929616411
679 2929625155
680 2932786919
681 2932797200
682 2932804915
683 2932811120
684 2932825888
685 2932832490
686 2933578306
687 2935610936
688 2935619195
689 2935645420
690 2935648363
691 2935657649
692 2935671518
693 2935677245
694 2935691818
695 2935695228
696 2935709669
697 2935719886
698 2935729347
699 2935738793
700 2935748022
701 2935756606
702 2935761416
703 2935771357
704 2935779043
705 2935788251
706 2935796984
707 2935805198
708 2935812267
709 2935820421
710 2935834737
711 2935839050
712 2935849570
713 2935857560
714 2935865094
715 2935881670
716 2935884847
717 2935911657
718 2935919311
719 2935928686
720 2935938331
721 2935945777
722 2935954616
723 2935963213
724 2935970503
725 2935987724
726 2935997324
727 2936005106
728 2936011273
729 2936019868
730 2936028464
731 2936038861
732 2936046591
733 2936062286
734 2940562520
735 2941536254
736 2941539740
737 3005487802
738 3005589305
739 3005597334
740 3005713362
741 3005720711
742 8016515300
743 8016523034
744 8016536497
745 8016540777
746 8016552466
747 8016560848
748 8016574857
749 8016578930
750 8016590698
751 8016598720
752 8016612367
753 8016621440
754 8016628514
755 8016632722
756 8017061163
757 8019536213
758 8019543249
759 8019555597
760 8019580638
761 8019602975
762 8019615573
763 8019626375
764 8019636118
765 8019643545
766 8019656347
767 8019663887
768 8019673515
769 8019682615
770 8019688299
771 8055748057
772 8056969403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04191

PEMT

Phospholipid methyltransferase

138

238

0.9

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

141

235

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.4677 7 211
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.4547 7 211
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.4336 7 211
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.4209 7 211
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.3658 14 208
ID Description Score Start End Superfamily
af_O05317_28_223_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8193 31 223 1.20.120.1630
af_O05317_28_223_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7968 31 223 1.20.120.1630
af_A0A1D8PPI7_47_265_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6885 81 211 1.20.120.1630
af_Q8I555_347_506_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.68 107 223 1.20.120.1630
af_Q558K8_55_236_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6468 54 215 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A531M5F0-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.8857 1 129 GO:0008168
GO:0016020
GO:0032259
AF-A0A524PAH0-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.873 1 219 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A3NFA2-F1-model_v4 deleted 0.8707 2 129
AF-A0A5E4P3N6-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase 0.8683 8 224 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A560DXJ0-F1-model_v4 Protein-S-isoprenylcysteine O-methyltransferase Ste14 0.8661 1 224 GO:0008168
GO:0012505
GO:0016020
GO:0032259

Map