F430568

General Info

Members Datasets Scaffolds Average Seq Length
386 244 772 117

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0379109|Ga0373947_0379109_444_803
Length 119
Sequence MRDGMASYTVNRRAVAHARKLIEAKQYVLNSVWGDAQPSAADETAFLKEHSWPEYASWFLGLTEGDDETKARYAFVCGDFRRIHRSGLIACVYRAAEWRHKAVERAAYRLLQELDAATS

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 6.74
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 12.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0379109 3300035725 Bacteria 952
2 JGI24033J26618_1002914 3300002155 Bacteria 1780
3 JGI24751J29686_10000668 3300002459 Bacteria 8576
4 Ga0070683_100010878 3300005329 Bacteria 7834
5 Ga0070683_100322243 3300005329 Bacteria 1471
6 Ga0070690_100179039 3300005330 Bacteria 1464
7 Ga0070670_100037726 3300005331 Bacteria 4156
8 Ga0070670_100165789 3300005331 Unclassified 1915
9 Ga0068869_100417917 3300005334 Bacteria 1106
10 Ga0070680_100608018 3300005336 Bacteria 938
11 Ga0070682_101387887 3300005337 Bacteria 600
12 Ga0068868_100095874 3300005338 Bacteria 2395
13 Ga0070689_100395001 3300005340 Unclassified 1168
14 Ga0070689_101243815 3300005340 Bacteria 669
15 Ga0070692_10048044 3300005345 Bacteria 2210
16 Ga0070692_10444994 3300005345 Bacteria 828
17 Ga0070668_100388399 3300005347 Bacteria 1189
18 Ga0070668_100635561 3300005347 Bacteria 937
19 Ga0070668_100672441 3300005347 Bacteria 911
20 Ga0070669_100630953 3300005353 Unclassified 900
21 Ga0070675_100116671 3300005354 Bacteria 2265
22 Ga0070675_100557945 3300005354 Bacteria 1036
23 Ga0070675_101113859 3300005354 Unclassified 726
24 Ga0070688_100719090 3300005365 Bacteria 775
25 Ga0070659_100624459 3300005366 Bacteria 928
26 Ga0070703_10008399 3300005406 Bacteria 2903
27 Ga0070709_10954825 3300005434 Bacteria 680
28 Ga0070714_100888263 3300005435 Bacteria 865
29 Ga0070710_11242361 3300005437 Unclassified 552
30 Ga0070711_100005731 3300005439 Bacteria 7451
31 Ga0070711_100287987 3300005439 Unclassified 1302
32 Ga0070700_100001636 3300005441 Bacteria 11199
33 Ga0070700_100324411 3300005441 Bacteria 1132
34 Ga0070700_100810718 3300005441 Bacteria 755
35 Ga0070694_100003757 3300005444 Bacteria 9054
36 Ga0070694_100628773 3300005444 Bacteria 867
37 Ga0070708_100004606 3300005445 Bacteria 10858
38 Ga0070708_100454656 3300005445 Archaea 1208
39 Ga0070663_100250696 3300005455 Bacteria 1401
40 Ga0070663_101279007 3300005455 Bacteria 647
41 Ga0070678_100586226 3300005456 Bacteria 994
42 Ga0070681_10208378 3300005458 Bacteria 1871
43 Ga0070706_100123215 3300005467 Bacteria 2417
44 Ga0070698_100701924 3300005471 Bacteria 954
45 Ga0070684_100002820 3300005535 Bacteria 12900
46 Ga0070684_100035452 3300005535 Bacteria 4269
47 Ga0070684_100532797 3300005535 Bacteria 1089
48 Ga0070684_101853139 3300005535 Bacteria 569
49 Ga0070697_100870276 3300005536 Bacteria 799
50 Ga0070672_100469134 3300005543 Bacteria 1086
51 Ga0070672_100550538 3300005543 Bacteria 1002
52 Ga0070686_100020292 3300005544 Bacteria 3929
53 Ga0070695_100814042 3300005545 Unclassified 749
54 Ga0070693_100848695 3300005547 Bacteria 681
55 Ga0070693_101301892 3300005547 Unclassified 562
56 Ga0070665_101731069 3300005548 Bacteria 632
57 Ga0070704_100018873 3300005549 Bacteria 4420
58 Ga0070664_100012265 3300005564 Bacteria 6965
59 Ga0070664_100059837 3300005564 Bacteria 3242
60 Ga0070664_100417293 3300005564 Bacteria 1229
61 Ga0070664_101562008 3300005564 Bacteria 625
62 Ga0068857_100058134 3300005577 Bacteria 3433
63 Ga0068857_100263712 3300005577 Bacteria 1582
64 Ga0070702_100662748 3300005615 Unclassified 791
65 Ga0068859_100552637 3300005617 Bacteria 1246
66 Ga0068864_100066444 3300005618 Bacteria 3130
67 Ga0068864_100158381 3300005618 Bacteria 2057
68 Ga0068866_10408263 3300005718 Bacteria 878
69 Ga0068861_100085067 3300005719 Bacteria 2484
70 Ga0068870_10000415 3300005840 Bacteria 16039
71 Ga0068870_11198130 3300005840 Bacteria 550
72 Ga0068863_100088237 3300005841 Bacteria 2939
73 Ga0068858_100215742 3300005842 Bacteria 1817
74 Ga0068858_101658992 3300005842 Bacteria 631
75 Ga0068860_100520439 3300005843 Bacteria 1189
76 Ga0068860_100958827 3300005843 Bacteria 873
77 Ga0068862_101279175 3300005844 Unclassified 734
78 Ga0081455_10005189 3300005937 Bacteria 14333
79 Ga0081455_10009674 3300005937 Bacteria 9886
80 Ga0081455_10012415 3300005937 Bacteria 8499
81 Ga0081455_10021684 3300005937 Bacteria 6019
82 Ga0081455_10105272 3300005937 Bacteria 2255
83 Ga0081455_10607591 3300005937 Unclassified 712
84 Ga0075365_10483673 3300006038 Bacteria 875
85 Ga0075364_10256369 3300006051 Bacteria 1189
86 Ga0075432_10167243 3300006058 Unclassified 853
87 Ga0070715_10013629 3300006163 Bacteria 2991
88 Ga0070715_10402330 3300006163 Unclassified 761
89 Ga0070716_100079099 3300006173 Bacteria 1957
90 Ga0070712_100589999 3300006175 Bacteria 939
91 Ga0075367_10605666 3300006178 Bacteria 696
92 Ga0075369_10136936 3300006186 Bacteria 1115
93 Ga0075427_10043611 3300006194 Bacteria 761
94 Ga0075428_100015072 3300006844 Bacteria 8587
95 Ga0075428_100107764 3300006844 Bacteria 3036
96 Ga0075428_100591428 3300006844 Bacteria 1185
97 Ga0075428_100896746 3300006844 Bacteria 940
98 Ga0075430_100000240 3300006846 Bacteria 38034
99 Ga0075430_100031470 3300006846 Bacteria 4503
100 Ga0075430_100116643 3300006846 Bacteria 2225
101 Ga0075430_100399711 3300006846 Bacteria 1134
102 Ga0075431_100003025 3300006847 Bacteria 16273
103 Ga0075431_100675175 3300006847 Bacteria 1012
104 Ga0075431_101049415 3300006847 Unclassified 781
105 Ga0075433_10016043 3300006852 Bacteria 6162
106 Ga0075433_10253104 3300006852 Bacteria 1562
107 Ga0075434_100098227 3300006871 Bacteria 2933
108 Ga0075429_100004273 3300006880 Bacteria 12253
109 Ga0075429_100023884 3300006880 Bacteria 5305
110 Ga0075429_101262104 3300006880 Bacteria 644
111 Ga0068865_100219460 3300006881 Bacteria 1486
112 Ga0068865_100601872 3300006881 Bacteria 929
113 Ga0075436_100341477 3300006914 Bacteria 1078
114 Ga0097620_100552622 3300006931 Bacteria 1246
115 Ga0075435_100005585 3300007076 Bacteria 8803
116 Ga0105251_10097741 3300009011 Bacteria 1344
117 Ga0111539_10403291 3300009094 Bacteria 1592
118 Ga0111539_11471203 3300009094 Bacteria 790
119 Ga0111539_11768194 3300009094 Bacteria 717
120 Ga0111539_12318176 3300009094 Bacteria 623
121 Ga0105245_10082634 3300009098 Bacteria 2939
122 Ga0105245_10084543 3300009098 Bacteria 2908
123 Ga0105245_10359029 3300009098 Bacteria 1446
124 Ga0105245_10938357 3300009098 Bacteria 908
125 Ga0105245_12538111 3300009098 Unclassified 566
126 Ga0114129_10002460 3300009147 Bacteria 25716
127 Ga0114129_10040227 3300009147 Bacteria 6590
128 Ga0114129_10065780 3300009147 Bacteria 5059
129 Ga0114129_10830930 3300009147 Unclassified 1176
130 Ga0114129_11103267 3300009147 Bacteria 993
131 Ga0114129_12146591 3300009147 Bacteria 673
132 Ga0114129_12697755 3300009147 Bacteria 592
133 Ga0105243_10062613 3300009148 Bacteria 2979
134 Ga0105243_10115081 3300009148 Bacteria 2258
135 Ga0105241_11235250 3300009174 Unclassified 709
136 Ga0105242_10010710 3300009176 Bacteria 7041
137 Ga0105238_10553077 3300009551 Bacteria 1155
138 Ga0105249_10021276 3300009553 Bacteria 5807
139 Ga0105249_10035107 3300009553 Bacteria 4545
140 Ga0105249_10678863 3300009553 Unclassified 1089
141 Ga0105249_11225097 3300009553 Bacteria 822
142 Ga0105239_10351333 3300010375 Bacteria 1665
143 Ga0105239_10452636 3300010375 Unclassified 1456
144 Ga0105239_11682366 3300010375 Bacteria 734
145 Ga0105246_10146336 3300011119 Bacteria 1783
146 Ga0157374_10211277 3300013296 Bacteria 1903
147 Ga0157374_11105452 3300013296 Unclassified 813
148 Ga0157374_11322660 3300013296 Unclassified 743
149 Ga0157378_10289979 3300013297 Bacteria 1580
150 Ga0157378_11003446 3300013297 Bacteria 869
151 Ga0163162_10746909 3300013306 Bacteria 1098
152 Ga0157375_10343757 3300013308 Bacteria 1657
153 Ga0157375_10379159 3300013308 Bacteria 1581
154 Ga0157375_12566806 3300013308 Bacteria 609
155 Ga0163163_10287995 3300014325 Bacteria 1694
156 Ga0157380_10039061 3300014326 Bacteria 3689
157 Ga0157380_10321744 3300014326 Bacteria 1434
158 Ga0157380_10685247 3300014326 Unclassified 1028
159 Ga0157380_11790697 3300014326 Bacteria 673
160 Ga0157377_10039209 3300014745 Bacteria 2619
161 Ga0157377_10206339 3300014745 Bacteria 1251
162 Ga0157377_10352902 3300014745 Bacteria 987
163 Ga0157377_10552026 3300014745 Bacteria 814
164 Ga0157377_10657628 3300014745 Bacteria 755
165 Ga0157376_10042446 3300014969 Bacteria 3727
166 Ga0157376_13042592 3300014969 Bacteria 508
167 Ga0163161_10397998 3300017792 Unclassified 1104
168 Ga0207713_1126371 3300025735 Bacteria 851
169 Ga0207688_10025779 3300025901 Bacteria 3231
170 Ga0207688_10776982 3300025901 Unclassified 607
171 Ga0207647_10019491 3300025904 Bacteria 4562
172 Ga0207685_10000364 3300025905 Bacteria 7410
173 Ga0207645_10027021 3300025907 Bacteria 3708
174 Ga0207643_10000520 3300025908 Bacteria 24662
175 Ga0207684_10097511 3300025910 Bacteria 2510
176 Ga0207707_10883902 3300025912 Bacteria 740
177 Ga0207693_10531804 3300025915 Bacteria 917
178 Ga0207660_11420308 3300025917 Bacteria 562
179 Ga0207649_10240387 3300025920 Bacteria 1299
180 Ga0207694_10161783 3300025924 Bacteria 1808
181 Ga0207650_10004722 3300025925 Bacteria 9309
182 Ga0207659_10875608 3300025926 Unclassified 772
183 Ga0207687_10009348 3300025927 Bacteria 6409
184 Ga0207687_10264865 3300025927 Bacteria 1372
185 Ga0207687_10291413 3300025927 Unclassified 1312
186 Ga0207687_10864106 3300025927 Bacteria 773
187 Ga0207690_10251848 3300025932 Bacteria 1364
188 Ga0207690_10335573 3300025932 Bacteria 1192
189 Ga0207706_10678208 3300025933 Bacteria 881
190 Ga0207686_10378235 3300025934 Bacteria 1073
191 Ga0207709_10067210 3300025935 Bacteria 2261
192 Ga0207669_10612887 3300025937 Bacteria 886
193 Ga0207704_10218246 3300025938 Bacteria 1409
194 Ga0207704_10449994 3300025938 Bacteria 1028
195 Ga0207665_10034954 3300025939 Bacteria 3335
196 Ga0207691_10950116 3300025940 Bacteria 718
197 Ga0207711_10134422 3300025941 Bacteria 2220
198 Ga0207689_10013252 3300025942 Bacteria 7034
199 Ga0207661_10003437 3300025944 Bacteria 10990
200 Ga0207661_10324910 3300025944 Bacteria 1384
201 Ga0207679_10126290 3300025945 Bacteria 2044
202 Ga0207679_10547492 3300025945 Bacteria 1038
203 Ga0207651_10171260 3300025960 Bacteria 1713
204 Ga0207712_10031833 3300025961 Bacteria 3556
205 Ga0207712_10409657 3300025961 Bacteria 1141
206 Ga0207712_10691314 3300025961 Bacteria 890
207 Ga0207640_11533280 3300025981 Unclassified 599
208 Ga0207677_10262991 3300026023 Bacteria 1407
209 Ga0207703_10659002 3300026035 Bacteria 993
210 Ga0207639_11218891 3300026041 Bacteria 706
211 Ga0207678_10169563 3300026067 Bacteria 1863
212 Ga0207678_10216243 3300026067 Bacteria 1640
213 Ga0207708_10040378 3300026075 Bacteria 3558
214 Ga0207708_10054084 3300026075 Bacteria 3060
215 Ga0207708_10803214 3300026075 Bacteria 810
216 Ga0207641_10024280 3300026088 Bacteria 4996
217 Ga0207648_10082847 3300026089 Bacteria 2797
218 Ga0207676_10003088 3300026095 Bacteria 11882
219 Ga0207674_10006056 3300026116 Bacteria 14306
220 Ga0207674_10100899 3300026116 Bacteria 2867
221 Ga0207675_100010769 3300026118 Bacteria 8570
222 Ga0209974_10197996 3300027876 Unclassified 741
223 Ga0207428_10031848 3300027907 Bacteria 4344
224 Ga0268264_10239582 3300028381 Bacteria 1679
225 Ga0265760_10229521 3300031090 Bacteria 636
226 Ga0307416_102744887 3300032002 Bacteria 589
227 Ga0373958_0017179 3300034819 Unclassified 1297
228 Ga0373959_0075844 3300034820 Unclassified 767
229 Ga0373926_0000911 3300035083 Bacteria 8514
230 Ga0373944_0000825 3300035089 Bacteria 7609
231 Ga0373949_0081306 3300035090 Unclassified 864
232 Ga0373952_0056236 3300035092 Bacteria 951
233 Ga0373923_0001925 3300035111 Bacteria 6213
234 Ga0373936_0003393 3300035113 Bacteria 5971
235 Ga0373939_0018488 3300035114 Unclassified 1868
236 Ga0373941_0292958 3300035115 Bacteria 647
237 Ga0373954_0056924 3300035118 Bacteria 1841
238 Ga0373960_0064606 3300035121 Bacteria 1118
239 Ga0373946_0006663 3300035171 Bacteria 4195
240 Ga0373942_0078476 3300035207 Bacteria 976
241 Ga0373931_0044060 3300035691 Unclassified 2352
242 Ga0373931_0179361 3300035691 Bacteria 1253
243 Ga0373935_0009333 3300035692 Bacteria 5875
244 Ga0373935_0773648 3300035692 Unclassified 708
245 Ga0373927_0006026 3300035695 Bacteria 8305
246 Ga0373937_0170080 3300036401 Bacteria 2045
247 Ga0373925_0025812 3300037068 Bacteria 4295
248 Ga0395899_0006474 3300037312 Bacteria 9074
249 Ga0395899_0302749 3300037312 Unclassified 1081
250 Ga0395900_0011005 3300037418 Bacteria 9248
251 Ga0395900_0020995 3300037418 Bacteria 6675
252 Ga0395900_0321937 3300037418 Bacteria 1526
253 Ga0395898_0049033 3300037466 Bacteria 4139
254 Ga0395898_0107743 3300037466 Bacteria 2672
255 Ga0395898_0140588 3300037466 Bacteria 2311
256 Ga0395905_0026752 3300037471 Bacteria 5440
257 Ga0395905_0145600 3300037471 Bacteria 2229
258 Ga0395905_0499847 3300037471 Bacteria 1116
259 Ga0395901_0002212 3300038443 Bacteria 19834
260 Ga0395901_0012927 3300038443 Bacteria 8469
261 Ga0395901_0074378 3300038443 Bacteria 3544
262 Ga0395901_0101583 3300038443 Bacteria 3017
263 Ga0451845_0695049 3300041501 Bacteria 585
264 Ga0439448_0229874 3300042005 Bacteria 653
265 Ga0450907_037907 3300042146 Bacteria 824
266 Ga0439464_0055870 3300042439 Bacteria 1149
267 Ga0439440_0098738 3300042993 Unclassified 792
268 Ga0451576_1622008 3300045051 Bacteria 671
269 Ga0495603_0302797 3300046455 Bacteria 918
270 Ga0495590_0386257 3300046457 Unclassified 536
271 Ga0495641_0054356 3300046461 Bacteria 1819
272 Ga0495582_0122324 3300046473 Bacteria 1467
273 Ga0495605_0385139 3300046474 Bacteria 585
274 Ga0495639_0003761 3300046475 Bacteria 6528
275 Ga0495662_0001801 3300046476 Bacteria 10728
276 Ga0495584_0091501 3300046491 Unclassified 1534
277 Ga0495584_0496466 3300046491 Unclassified 622
278 Ga0495584_0599217 3300046491 Bacteria 562
279 Ga0495607_0062185 3300046501 Bacteria 2118
280 Ga0495618_0911326 3300046514 Bacteria 507
281 Ga0495630_0015105 3300046517 Bacteria 5634
282 Ga0495637_0143465 3300046520 Bacteria 905
283 Ga0495666_0002078 3300046526 Bacteria 9920
284 Ga0495665_0002519 3300046531 Bacteria 9896
285 Ga0495640_0009394 3300046533 Bacteria 7616
286 Ga0495586_0010623 3300046535 Bacteria 4898
287 Ga0495609_0187514 3300046538 Unclassified 869
288 Ga0495621_0079111 3300046539 Unclassified 1223
289 Ga0495667_0125505 3300046559 Bacteria 1656
290 Ga0495656_0073027 3300046615 Bacteria 1529
291 Ga0495656_0479052 3300046615 Unclassified 658
292 Ga0495634_0009039 3300046642 Bacteria 7369
293 Ga0495611_0377821 3300046648 Archaea 649
294 Ga0495635_0002047 3300046663 Bacteria 13658
295 Ga0495659_0055421 3300046664 Unclassified 1453
296 Ga0495659_0062076 3300046664 Bacteria 1382
297 Ga0495588_0000766 3300046674 Bacteria 14586
298 Ga0495657_0112562 3300046675 Bacteria 1723
299 Ga0495647_0000825 3300046681 Bacteria 9267
300 Ga0495658_0007439 3300046683 Bacteria 5419
301 Ga0495669_0661909 3300046684 Bacteria 508
302 Ga0495624_0296335 3300046690 Bacteria 975
303 Ga0495670_0205325 3300046691 Bacteria 1044
304 Ga0495589_0106700 3300046794 Bacteria 1353
305 Ga0495589_0560024 3300046794 Unclassified 521
306 Ga0495581_0099127 3300047315 Bacteria 1692
307 Ga0495636_0390751 3300047318 Unclassified 661
308 Ga0495636_0546150 3300047318 Bacteria 563
309 Ga0495674_0003835 3300047319 Bacteria 14604
310 Ga0495676_0016414 3300047321 Bacteria 6573
311 Ga0495676_0312011 3300047321 Bacteria 1058
312 Ga0495680_0013976 3300047322 Bacteria 6979
313 Ga0495684_0092064 3300047471 Bacteria 2296
314 Ga0495593_0002954 3300047673 Bacteria 10229
315 Ga0495614_0019412 3300048089 Bacteria 2940
316 Ga0496100_0370817 3300048903 Bacteria 1085
317 Ga0496101_0277403 3300048904 Bacteria 1309
318 Ga0496102_0091732 3300048905 Bacteria 2812
319 Ga0496102_0398290 3300048905 Bacteria 1294
320 Ga0496105_0237422 3300048908 Bacteria 1480
321 Ga0496107_0035203 3300048910 Bacteria 3589
322 Ga0496108_0260386 3300048911 Bacteria 1509
323 Ga0496108_0261728 3300048911 Bacteria 1505
324 Ga0496108_0316954 3300048911 Bacteria 1359
325 Ga0496109_0011745 3300048912 Bacteria 7536
326 Ga0496109_0039844 3300048912 Bacteria 4254
327 Ga0496109_0143187 3300048912 Bacteria 2236
328 Ga0496109_0386889 3300048912 Bacteria 1321
329 Ga0496110_0075359 3300048913 Bacteria 2998
330 Ga0496110_0297040 3300048913 Bacteria 1471
331 Ga0496110_1151338 3300048913 Bacteria 684
332 Ga0496111_0280968 3300048914 Bacteria 1234
333 Ga0496111_0318674 3300048914 Bacteria 1152
334 Ga0496111_1038713 3300048914 Bacteria 586
335 Ga0496112_0096596 3300048915 Bacteria 2925
336 Ga0496113_0103276 3300048916 Bacteria 2211
337 Ga0496113_0170776 3300048916 Bacteria 1722
338 Ga0496113_0792174 3300048916 Unclassified 753
339 Ga0496114_0363991 3300048917 Bacteria 1279
340 Ga0496114_0543435 3300048917 Bacteria 1027
341 Ga0496115_0107311 3300048918 Bacteria 2293
342 Ga0501036_0327351 3300049572 Bacteria 1280
343 Ga0501040_0474011 3300049576 Bacteria 902
344 Ga0501040_1273717 3300049576 Bacteria 533
345 Ga0501041_0058345 3300049577 Bacteria 2361
346 Ga0501042_0448367 3300049578 Bacteria 936
347 Ga0501046_0112093 3300049580 Bacteria 2083
348 Ga0501069_0630752 3300049585 Bacteria 644
349 Ga0501071_0159964 3300049587 Unclassified 1683
350 Ga0501072_0379051 3300049588 Bacteria 1122
351 Ga0501075_0333782 3300049591 Bacteria 1155
352 Ga0501076_0100466 3300049592 Bacteria 2331
353 Ga0501083_0717791 3300049744 Bacteria 650
354 Ga0501045_0061452 3300049824 Bacteria 2756
355 nmdc:mga00v17_59838_c1 3300050491 Bacteria 2338
356 nmdc:mga0yw44_208278_c1 3300050492 Bacteria 1293
357 nmdc:mga05p37_2112575_c1 3300050507 Bacteria 527
358 nmdc:mga05p37_25542_c1 3300050507 Bacteria 7186
359 nmdc:mga05p37_44194_c1 3300050507 Bacteria 5481
360 nmdc:mga05p37_870794_c1 3300050507 Bacteria 975
361 nmdc:mga05p37_935868_c1 3300050507 Bacteria 929
362 nmdc:mga09592_296201_c1 3300050508 Bacteria 1403
363 nmdc:mga09592_5851_c1 3300050508 Bacteria 10030
364 nmdc:mga09592_719672_c1 3300050508 Bacteria 849
365 nmdc:mga09592_78665_c1 3300050508 Bacteria 2807
366 nmdc:mga09592_908415_c1 3300050508 Bacteria 740
367 nmdc:mga0qj67_1558314_c1 3300050509 Unclassified 507
368 nmdc:mga0qj67_178289_c1 3300050509 Bacteria 1726
369 nmdc:mga0qj67_194151_c1 3300050509 Bacteria 1650
370 nmdc:mga06r32_109181_c1 3300050510 Bacteria 2721
371 nmdc:mga06r32_1377552_c1 3300050510 Bacteria 648
372 nmdc:mga06r32_49374_c1 3300050510 Bacteria 4023
373 nmdc:mga06r32_511792_c1 3300050510 Bacteria 1177
374 nmdc:mga08y16_420788_c1 3300050511 Bacteria 1365
375 nmdc:mga0n895_158338_c1 3300050512 Bacteria 2296
376 nmdc:mga0n895_6442_c1 3300050512 Bacteria 9966
377 nmdc:mga0rr50_1073638_c1 3300050513 Bacteria 685
378 nmdc:mga0rr50_22975_c1 3300050513 Bacteria 4290
379 nmdc:mga08x19_169136_c1 3300050514 Bacteria 1488
380 nmdc:mga0a205_344020_c1 3300050515 Unclassified 1360
381 nmdc:mga0a205_4799_c1 3300050515 Bacteria 12156
382 Ga0495619_0003399 3300053085 Bacteria 10283
383 Ga0501084_0176098 3300054114 Unclassified 1806
384 Ga0501084_0874278 3300054114 Bacteria 756
385 Ga0501082_0205430 3300060353 Bacteria 1714
386 Ga0501082_1387568 3300060353 Bacteria 614
387 Ga0373947_0379109
388 JGI24033J26618_1002914
389 JGI24751J29686_10000668
390 Ga0070683_100010878
391 Ga0070683_100322243
392 Ga0070690_100179039
393 Ga0070670_100037726
394 Ga0070670_100165789
395 Ga0068869_100417917
396 Ga0070680_100608018
397 Ga0070682_101387887
398 Ga0068868_100095874
399 Ga0070689_100395001
400 Ga0070689_101243815
401 Ga0070692_10048044
402 Ga0070692_10444994
403 Ga0070668_100388399
404 Ga0070668_100635561
405 Ga0070668_100672441
406 Ga0070669_100630953
407 Ga0070675_100116671
408 Ga0070675_100557945
409 Ga0070675_101113859
410 Ga0070688_100719090
411 Ga0070659_100624459
412 Ga0070703_10008399
413 Ga0070709_10954825
414 Ga0070714_100888263
415 Ga0070710_11242361
416 Ga0070711_100005731
417 Ga0070711_100287987
418 Ga0070700_100001636
419 Ga0070700_100324411
420 Ga0070700_100810718
421 Ga0070694_100003757
422 Ga0070694_100628773
423 Ga0070708_100004606
424 Ga0070708_100454656
425 Ga0070663_100250696
426 Ga0070663_101279007
427 Ga0070678_100586226
428 Ga0070681_10208378
429 Ga0070706_100123215
430 Ga0070698_100701924
431 Ga0070684_100002820
432 Ga0070684_100035452
433 Ga0070684_100532797
434 Ga0070684_101853139
435 Ga0070697_100870276
436 Ga0070672_100469134
437 Ga0070672_100550538
438 Ga0070686_100020292
439 Ga0070695_100814042
440 Ga0070693_100848695
441 Ga0070693_101301892
442 Ga0070665_101731069
443 Ga0070704_100018873
444 Ga0070664_100012265
445 Ga0070664_100059837
446 Ga0070664_100417293
447 Ga0070664_101562008
448 Ga0068857_100058134
449 Ga0068857_100263712
450 Ga0070702_100662748
451 Ga0068859_100552637
452 Ga0068864_100066444
453 Ga0068864_100158381
454 Ga0068866_10408263
455 Ga0068861_100085067
456 Ga0068870_10000415
457 Ga0068870_11198130
458 Ga0068863_100088237
459 Ga0068858_100215742
460 Ga0068858_101658992
461 Ga0068860_100520439
462 Ga0068860_100958827
463 Ga0068862_101279175
464 Ga0081455_10005189
465 Ga0081455_10009674
466 Ga0081455_10012415
467 Ga0081455_10021684
468 Ga0081455_10105272
469 Ga0081455_10607591
470 Ga0075365_10483673
471 Ga0075364_10256369
472 Ga0075432_10167243
473 Ga0070715_10013629
474 Ga0070715_10402330
475 Ga0070716_100079099
476 Ga0070712_100589999
477 Ga0075367_10605666
478 Ga0075369_10136936
479 Ga0075427_10043611
480 Ga0075428_100015072
481 Ga0075428_100107764
482 Ga0075428_100591428
483 Ga0075428_100896746
484 Ga0075430_100000240
485 Ga0075430_100031470
486 Ga0075430_100116643
487 Ga0075430_100399711
488 Ga0075431_100003025
489 Ga0075431_100675175
490 Ga0075431_101049415
491 Ga0075433_10016043
492 Ga0075433_10253104
493 Ga0075434_100098227
494 Ga0075429_100004273
495 Ga0075429_100023884
496 Ga0075429_101262104
497 Ga0068865_100219460
498 Ga0068865_100601872
499 Ga0075436_100341477
500 Ga0097620_100552622
501 Ga0075435_100005585
502 Ga0105251_10097741
503 Ga0111539_10403291
504 Ga0111539_11471203
505 Ga0111539_11768194
506 Ga0111539_12318176
507 Ga0105245_10082634
508 Ga0105245_10084543
509 Ga0105245_10359029
510 Ga0105245_10938357
511 Ga0105245_12538111
512 Ga0114129_10002460
513 Ga0114129_10040227
514 Ga0114129_10065780
515 Ga0114129_10830930
516 Ga0114129_11103267
517 Ga0114129_12146591
518 Ga0114129_12697755
519 Ga0105243_10062613
520 Ga0105243_10115081
521 Ga0105241_11235250
522 Ga0105242_10010710
523 Ga0105238_10553077
524 Ga0105249_10021276
525 Ga0105249_10035107
526 Ga0105249_10678863
527 Ga0105249_11225097
528 Ga0105239_10351333
529 Ga0105239_10452636
530 Ga0105239_11682366
531 Ga0105246_10146336
532 Ga0157374_10211277
533 Ga0157374_11105452
534 Ga0157374_11322660
535 Ga0157378_10289979
536 Ga0157378_11003446
537 Ga0163162_10746909
538 Ga0157375_10343757
539 Ga0157375_10379159
540 Ga0157375_12566806
541 Ga0163163_10287995
542 Ga0157380_10039061
543 Ga0157380_10321744
544 Ga0157380_10685247
545 Ga0157380_11790697
546 Ga0157377_10039209
547 Ga0157377_10206339
548 Ga0157377_10352902
549 Ga0157377_10552026
550 Ga0157377_10657628
551 Ga0157376_10042446
552 Ga0157376_13042592
553 Ga0163161_10397998
554 Ga0207713_1126371
555 Ga0207688_10025779
556 Ga0207688_10776982
557 Ga0207647_10019491
558 Ga0207685_10000364
559 Ga0207645_10027021
560 Ga0207643_10000520
561 Ga0207684_10097511
562 Ga0207707_10883902
563 Ga0207693_10531804
564 Ga0207660_11420308
565 Ga0207649_10240387
566 Ga0207694_10161783
567 Ga0207650_10004722
568 Ga0207659_10875608
569 Ga0207687_10009348
570 Ga0207687_10264865
571 Ga0207687_10291413
572 Ga0207687_10864106
573 Ga0207690_10251848
574 Ga0207690_10335573
575 Ga0207706_10678208
576 Ga0207686_10378235
577 Ga0207709_10067210
578 Ga0207669_10612887
579 Ga0207704_10218246
580 Ga0207704_10449994
581 Ga0207665_10034954
582 Ga0207691_10950116
583 Ga0207711_10134422
584 Ga0207689_10013252
585 Ga0207661_10003437
586 Ga0207661_10324910
587 Ga0207679_10126290
588 Ga0207679_10547492
589 Ga0207651_10171260
590 Ga0207712_10031833
591 Ga0207712_10409657
592 Ga0207712_10691314
593 Ga0207640_11533280
594 Ga0207677_10262991
595 Ga0207703_10659002
596 Ga0207639_11218891
597 Ga0207678_10169563
598 Ga0207678_10216243
599 Ga0207708_10040378
600 Ga0207708_10054084
601 Ga0207708_10803214
602 Ga0207641_10024280
603 Ga0207648_10082847
604 Ga0207676_10003088
605 Ga0207674_10006056
606 Ga0207674_10100899
607 Ga0207675_100010769
608 Ga0209974_10197996
609 Ga0207428_10031848
610 Ga0268264_10239582
611 Ga0265760_10229521
612 Ga0307416_102744887
613 Ga0373958_0017179
614 Ga0373959_0075844
615 Ga0373926_0000911
616 Ga0373944_0000825
617 Ga0373949_0081306
618 Ga0373952_0056236
619 Ga0373923_0001925
620 Ga0373936_0003393
621 Ga0373939_0018488
622 Ga0373941_0292958
623 Ga0373954_0056924
624 Ga0373960_0064606
625 Ga0373946_0006663
626 Ga0373942_0078476
627 Ga0373931_0044060
628 Ga0373931_0179361
629 Ga0373935_0009333
630 Ga0373935_0773648
631 Ga0373927_0006026
632 Ga0373937_0170080
633 Ga0373925_0025812
634 Ga0395899_0006474
635 Ga0395899_0302749
636 Ga0395900_0011005
637 Ga0395900_0020995
638 Ga0395900_0321937
639 Ga0395898_0049033
640 Ga0395898_0107743
641 Ga0395898_0140588
642 Ga0395905_0026752
643 Ga0395905_0145600
644 Ga0395905_0499847
645 Ga0395901_0002212
646 Ga0395901_0012927
647 Ga0395901_0074378
648 Ga0395901_0101583
649 Ga0451845_0695049
650 Ga0439448_0229874
651 Ga0450907_037907
652 Ga0439464_0055870
653 Ga0439440_0098738
654 Ga0451576_1622008
655 Ga0495603_0302797
656 Ga0495590_0386257
657 Ga0495641_0054356
658 Ga0495582_0122324
659 Ga0495605_0385139
660 Ga0495639_0003761
661 Ga0495662_0001801
662 Ga0495584_0091501
663 Ga0495584_0496466
664 Ga0495584_0599217
665 Ga0495607_0062185
666 Ga0495618_0911326
667 Ga0495630_0015105
668 Ga0495637_0143465
669 Ga0495666_0002078
670 Ga0495665_0002519
671 Ga0495640_0009394
672 Ga0495586_0010623
673 Ga0495609_0187514
674 Ga0495621_0079111
675 Ga0495667_0125505
676 Ga0495656_0073027
677 Ga0495656_0479052
678 Ga0495634_0009039
679 Ga0495611_0377821
680 Ga0495635_0002047
681 Ga0495659_0055421
682 Ga0495659_0062076
683 Ga0495588_0000766
684 Ga0495657_0112562
685 Ga0495647_0000825
686 Ga0495658_0007439
687 Ga0495669_0661909
688 Ga0495624_0296335
689 Ga0495670_0205325
690 Ga0495589_0106700
691 Ga0495589_0560024
692 Ga0495581_0099127
693 Ga0495636_0390751
694 Ga0495636_0546150
695 Ga0495674_0003835
696 Ga0495676_0016414
697 Ga0495676_0312011
698 Ga0495680_0013976
699 Ga0495684_0092064
700 Ga0495593_0002954
701 Ga0495614_0019412
702 Ga0496100_0370817
703 Ga0496101_0277403
704 Ga0496102_0091732
705 Ga0496102_0398290
706 Ga0496105_0237422
707 Ga0496107_0035203
708 Ga0496108_0260386
709 Ga0496108_0261728
710 Ga0496108_0316954
711 Ga0496109_0011745
712 Ga0496109_0039844
713 Ga0496109_0143187
714 Ga0496109_0386889
715 Ga0496110_0075359
716 Ga0496110_0297040
717 Ga0496110_1151338
718 Ga0496111_0280968
719 Ga0496111_0318674
720 Ga0496111_1038713
721 Ga0496112_0096596
722 Ga0496113_0103276
723 Ga0496113_0170776
724 Ga0496113_0792174
725 Ga0496114_0363991
726 Ga0496114_0543435
727 Ga0496115_0107311
728 Ga0501036_0327351
729 Ga0501040_0474011
730 Ga0501040_1273717
731 Ga0501041_0058345
732 Ga0501042_0448367
733 Ga0501046_0112093
734 Ga0501069_0630752
735 Ga0501071_0159964
736 Ga0501072_0379051
737 Ga0501075_0333782
738 Ga0501076_0100466
739 Ga0501083_0717791
740 Ga0501045_0061452
741 nmdc:mga00v17_59838_c1
742 nmdc:mga0yw44_208278_c1
743 nmdc:mga05p37_2112575_c1
744 nmdc:mga05p37_25542_c1
745 nmdc:mga05p37_44194_c1
746 nmdc:mga05p37_870794_c1
747 nmdc:mga05p37_935868_c1
748 nmdc:mga09592_296201_c1
749 nmdc:mga09592_5851_c1
750 nmdc:mga09592_719672_c1
751 nmdc:mga09592_78665_c1
752 nmdc:mga09592_908415_c1
753 nmdc:mga0qj67_1558314_c1
754 nmdc:mga0qj67_178289_c1
755 nmdc:mga0qj67_194151_c1
756 nmdc:mga06r32_109181_c1
757 nmdc:mga06r32_1377552_c1
758 nmdc:mga06r32_49374_c1
759 nmdc:mga06r32_511792_c1
760 nmdc:mga08y16_420788_c1
761 nmdc:mga0n895_158338_c1
762 nmdc:mga0n895_6442_c1
763 nmdc:mga0rr50_1073638_c1
764 nmdc:mga0rr50_22975_c1
765 nmdc:mga08x19_169136_c1
766 nmdc:mga0a205_344020_c1
767 nmdc:mga0a205_4799_c1
768 Ga0495619_0003399
769 Ga0501084_0176098
770 Ga0501084_0874278
771 Ga0501082_0205430
772 Ga0501082_1387568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rdr-assembly1.cif.gz_A circular tandem repeat protein with novel repeat topology and enhanced subunit contact surfaces 0.9685 82 114
1f4n-assembly1.cif.gz_A c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9481 82 114
1f4m-assembly1.cif.gz_A p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.934 82 114
1f4m-assembly3.cif.gz_E p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9315 82 114
1f4m-assembly2.cif.gz_C p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9306 82 114
ID Description Score Start End Superfamily
af_E9QI21_1_864_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 1.009 82 115 1.25.40.10
2yxyA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Hypothetical protein YfhH domain 0.9888 82 114 1.10.287.880
af_O16709_5_105_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.9871 82 112 3.30.710.10
5jajA03 Mainly Alpha;Up-down Bundle;phosphoenolpyruvate carboxylase, domain 3; 0.9785 82 114 1.20.1320.30
af_Q5TAA0_61_144_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9695 82 114 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4Q7UT68-F1-model_v4 Uncharacterized protein 0.9709 1 113
AF-A0A370CQB0-F1-model_v4 deleted 0.97 1 115
AF-A0A6V8KPL8-F1-model_v4 Uncharacterized protein 0.969 1 116
AF-A0A3D9V2E1-F1-model_v4 Uncharacterized protein 0.9682 1 116
AF-M5RDR5-F1-model_v4 Uncharacterized protein 0.9654 2 115

Map