F430558

General Info

Members Datasets Scaffolds Average Seq Length
386 220 772 83

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101068053|Ga0307416_1010680532
Length 84
Sequence MARFMDVHSGFVGVTEEQLLEAHRRDQEIEGEEGVHFDTAWLDPESGGKVFCLSTGPSKESVLRIHERAGHPTSEVYEVPIEVR

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
146 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
151 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
152 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
153 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 4.15
Rhizosphere 93.78
Stem 0
Stem Tuber 0
Unclassified 19.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_101068053 3300032002 Bacteria 911
2 JGI26145J50221_1030165 3300003371 Unclassified 552
3 JGI25407J50210_10040346 3300003373 Bacteria 1197
4 Ga0070690_100546353 3300005330 Unclassified 873
5 Ga0070670_101679925 3300005331 Bacteria 584
6 Ga0068869_101162527 3300005334 Bacteria 677
7 Ga0070666_11322052 3300005335 Bacteria 538
8 Ga0068868_100532387 3300005338 Bacteria 1033
9 Ga0070660_100112656 3300005339 Bacteria 2166
10 Ga0070689_100220612 3300005340 Bacteria 1555
11 Ga0070687_100169475 3300005343 Bacteria 1298
12 Ga0070692_10517960 3300005345 Bacteria 776
13 Ga0070692_10639306 3300005345 Bacteria 709
14 Ga0070668_100055756 3300005347 Bacteria 3051
15 Ga0070668_100995252 3300005347 Bacteria 753
16 Ga0070669_101258398 3300005353 Bacteria 640
17 Ga0070675_100328079 3300005354 Unclassified 1353
18 Ga0070674_102153531 3300005356 Bacteria 509
19 Ga0070688_100140648 3300005365 Bacteria 1639
20 Ga0070659_100648899 3300005366 Bacteria 910
21 Ga0070703_10109539 3300005406 Bacteria 986
22 Ga0070703_10292220 3300005406 Unclassified 676
23 Ga0070701_10283308 3300005438 Unclassified 1013
24 Ga0070701_10551243 3300005438 Unclassified 756
25 Ga0070701_10664534 3300005438 Bacteria 697
26 Ga0070705_100017515 3300005440 Bacteria 3740
27 Ga0070705_100429381 3300005440 Bacteria 986
28 Ga0070705_101956788 3300005440 Bacteria 500
29 Ga0070700_100175579 3300005441 Unclassified 1487
30 Ga0070700_101586864 3300005441 Unclassified 559
31 Ga0070694_100639932 3300005444 Bacteria 860
32 Ga0070708_100520877 3300005445 Archaea 1121
33 Ga0070708_101340551 3300005445 Unclassified 668
34 Ga0070663_100775874 3300005455 Unclassified 820
35 Ga0070678_101373219 3300005456 Bacteria 659
36 Ga0070678_102330556 3300005456 Unclassified 508
37 Ga0070662_100112485 3300005457 Bacteria 2076
38 Ga0070662_100132225 3300005457 Bacteria 1925
39 Ga0068867_100892121 3300005459 Bacteria 799
40 Ga0068867_101048206 3300005459 Bacteria 742
41 Ga0070706_100001304 3300005467 Bacteria 26604
42 Ga0070706_100079525 3300005467 Unclassified 3034
43 Ga0070706_100444094 3300005467 Bacteria 1207
44 Ga0070706_101258895 3300005467 Bacteria 679
45 Ga0070706_101366212 3300005467 Bacteria 649
46 Ga0070707_100003275 3300005468 Bacteria 15334
47 Ga0070707_100509922 3300005468 Archaea 1165
48 Ga0070698_100154038 3300005471 Bacteria 2244
49 Ga0070698_100276872 3300005471 Archaea 1610
50 Ga0070698_100802481 3300005471 Bacteria 885
51 Ga0070698_100952632 3300005471 Bacteria 805
52 Ga0070698_100976376 3300005471 Bacteria 794
53 Ga0070698_101247754 3300005471 Unclassified 693
54 Ga0070699_100080563 3300005518 Bacteria 2838
55 Ga0070699_100447610 3300005518 Archaea 1171
56 Ga0070699_101135591 3300005518 Unclassified 717
57 Ga0070684_101807303 3300005535 Bacteria 577
58 Ga0070697_100471938 3300005536 Unclassified 1095
59 Ga0070697_100968483 3300005536 Archaea 756
60 Ga0070672_100573934 3300005543 Bacteria 981
61 Ga0070696_100041167 3300005546 Bacteria 3191
62 Ga0070693_100398664 3300005547 Bacteria 953
63 Ga0070704_100072231 3300005549 Bacteria 2510
64 Ga0068855_100016813 3300005563 Bacteria 8796
65 Ga0068855_101590420 3300005563 Bacteria 669
66 Ga0070664_100444869 3300005564 Bacteria 1189
67 Ga0068856_102233518 3300005614 Bacteria 556
68 Ga0070702_100209414 3300005615 Bacteria 1296
69 Ga0070702_101157703 3300005615 Bacteria 621
70 Ga0068852_100260484 3300005616 Bacteria 1665
71 Ga0068852_101627190 3300005616 Bacteria 668
72 Ga0068859_100527254 3300005617 Bacteria 1276
73 Ga0068859_101778725 3300005617 Bacteria 681
74 Ga0068864_100105838 3300005618 Bacteria 2501
75 Ga0068864_101811202 3300005618 Bacteria 616
76 Ga0068861_100059963 3300005719 Bacteria 2915
77 Ga0068861_101331934 3300005719 Bacteria 699
78 Ga0068863_100302751 3300005841 Bacteria 1551
79 Ga0068858_100312431 3300005842 Bacteria 1501
80 Ga0068858_101661518 3300005842 Unclassified 631
81 Ga0068862_100541337 3300005844 Unclassified 1111
82 Ga0068862_101815342 3300005844 Bacteria 619
83 Ga0081455_10055079 3300005937 Bacteria 3385
84 Ga0081538_10010976 3300005981 Bacteria 7376
85 Ga0081540_1191286 3300005983 Bacteria 754
86 Ga0075432_10214050 3300006058 Bacteria 768
87 Ga0075367_10407452 3300006178 Unclassified 860
88 Ga0097621_101697033 3300006237 Bacteria 601
89 Ga0068871_101980516 3300006358 Bacteria 554
90 Ga0075428_100786337 3300006844 Bacteria 1012
91 Ga0075428_102417177 3300006844 Bacteria 539
92 Ga0075430_100666376 3300006846 Bacteria 858
93 Ga0075433_10511879 3300006852 Bacteria 1056
94 Ga0075434_100043290 3300006871 Bacteria 4465
95 Ga0075429_100981378 3300006880 Unclassified 739
96 Ga0075429_101966837 3300006880 Bacteria 506
97 Ga0068865_100830343 3300006881 Bacteria 799
98 Ga0068865_101184479 3300006881 Unclassified 676
99 Ga0097620_100527287 3300006931 Bacteria 1276
100 Ga0097620_101778909 3300006931 Bacteria 681
101 Ga0105251_10382129 3300009011 Unclassified 645
102 Ga0105240_10411771 3300009093 Bacteria 1520
103 Ga0111539_10342296 3300009094 Unclassified 1741
104 Ga0111539_10376822 3300009094 Bacteria 1652
105 Ga0111539_10762878 3300009094 Unclassified 1126
106 Ga0111539_10992517 3300009094 Bacteria 976
107 Ga0111539_12109106 3300009094 Unclassified 654
108 Ga0105245_10573417 3300009098 Bacteria 1152
109 Ga0105245_10577666 3300009098 Bacteria 1148
110 Ga0105245_11618226 3300009098 Unclassified 699
111 Ga0114129_10954439 3300009147 Bacteria 1083
112 Ga0114129_11065039 3300009147 Unclassified 1014
113 Ga0105242_10777363 3300009176 Bacteria 945
114 Ga0105248_11453270 3300009177 Bacteria 776
115 Ga0105249_10256660 3300009553 Bacteria 1735
116 Ga0105249_10313862 3300009553 Bacteria 1577
117 Ga0105239_10228523 3300010375 Bacteria 2087
118 Ga0105239_11104036 3300010375 Bacteria 913
119 Ga0157370_10130689 3300013104 Bacteria 2342
120 Ga0157374_10828491 3300013296 Bacteria 942
121 Ga0157378_10428382 3300013297 Bacteria 1309
122 Ga0157378_11299888 3300013297 Bacteria 768
123 Ga0157378_11933514 3300013297 Unclassified 639
124 Ga0157372_12577304 3300013307 Bacteria 584
125 Ga0157375_10369470 3300013308 Bacteria 1601
126 Ga0157380_10226862 3300014326 Bacteria 1675
127 Ga0157380_10532411 3300014326 Unclassified 1148
128 Ga0157380_10623161 3300014326 Unclassified 1071
129 Ga0157380_11712121 3300014326 Bacteria 686
130 Ga0157380_11766179 3300014326 Bacteria 677
131 Ga0157377_10222055 3300014745 Unclassified 1210
132 Ga0157377_10381337 3300014745 Bacteria 955
133 Ga0157377_10463441 3300014745 Unclassified 878
134 Ga0157376_10492426 3300014969 Bacteria 1203
135 Ga0163161_10193644 3300017792 Bacteria 1564
136 Ga0207653_10207594 3300025885 Bacteria 740
137 Ga0207688_10645779 3300025901 Bacteria 668
138 Ga0207645_10536670 3300025907 Bacteria 793
139 Ga0207705_10229269 3300025909 Bacteria 1412
140 Ga0207684_10001366 3300025910 Bacteria 26652
141 Ga0207684_10584378 3300025910 Bacteria 954
142 Ga0207695_11255385 3300025913 Unclassified 621
143 Ga0207662_10140301 3300025918 Bacteria 1530
144 Ga0207657_10134387 3300025919 Bacteria 2025
145 Ga0207646_10029748 3300025922 Bacteria 4959
146 Ga0207646_10043678 3300025922 Bacteria 4024
147 Ga0207646_11350151 3300025922 Bacteria 621
148 Ga0207650_11915493 3300025925 Bacteria 501
149 Ga0207659_11831486 3300025926 Bacteria 515
150 Ga0207687_10698592 3300025927 Bacteria 861
151 Ga0207644_11496349 3300025931 Bacteria 567
152 Ga0207690_10874041 3300025932 Bacteria 745
153 Ga0207706_10181593 3300025933 Bacteria 1848
154 Ga0207706_10241185 3300025933 Bacteria 1580
155 Ga0207686_11010957 3300025934 Bacteria 675
156 Ga0207709_11121945 3300025935 Bacteria 646
157 Ga0207670_10504126 3300025936 Unclassified 983
158 Ga0207704_11054432 3300025938 Bacteria 689
159 Ga0207691_10547898 3300025940 Bacteria 981
160 Ga0207689_10322702 3300025942 Bacteria 1282
161 Ga0207667_10027174 3300025949 Bacteria 6236
162 Ga0207667_10799785 3300025949 Unclassified 940
163 Ga0207651_11643679 3300025960 Unclassified 579
164 Ga0207668_10042252 3300025972 Bacteria 3087
165 Ga0207677_11075210 3300026023 Bacteria 732
166 Ga0207703_10359580 3300026035 Bacteria 1342
167 Ga0207703_11312659 3300026035 Unclassified 696
168 Ga0207708_10184432 3300026075 Bacteria 1658
169 Ga0207708_10317701 3300026075 Unclassified 1270
170 Ga0207702_10955030 3300026078 Bacteria 850
171 Ga0207641_11464580 3300026088 Bacteria 684
172 Ga0207676_10351891 3300026095 Unclassified 1362
173 Ga0207676_11824949 3300026095 Bacteria 607
174 Ga0207675_100054854 3300026118 Bacteria 3718
175 Ga0207675_100156789 3300026118 Bacteria 2170
176 Ga0207675_102266041 3300026118 Unclassified 557
177 Ga0207428_10081471 3300027907 Bacteria 2527
178 Ga0207428_10861612 3300027907 Bacteria 641
179 Ga0268265_10641339 3300028380 Unclassified 1020
180 Ga0265326_10019138 3300028558 Unclassified 1969
181 Ga0265326_10128046 3300028558 Bacteria 723
182 Ga0265334_10036755 3300028573 Unclassified 1933
183 Ga0265334_10069547 3300028573 Bacteria 1314
184 Ga0265323_10034113 3300028653 Unclassified 1881
185 Ga0265322_10004991 3300028654 Bacteria 3936
186 Ga0265324_10072416 3300029957 Bacteria 1174
187 Ga0265324_10077937 3300029957 Bacteria 1128
188 Ga0307512_10237566 3300030522 Bacteria 927
189 Ga0265325_10065890 3300031241 Unclassified 1828
190 Ga0265331_10458334 3300031250 Bacteria 573
191 Ga0265331_10470341 3300031250 Bacteria 565
192 Ga0265316_10043527 3300031344 Bacteria 3577
193 Ga0265316_10670332 3300031344 Bacteria 732
194 Ga0265316_11260569 3300031344 Unclassified 511
195 Ga0307513_10009943 3300031456 Bacteria 11996
196 Ga0265314_10201822 3300031711 Unclassified 1175
197 Ga0326468_10000770 3300031889 Bacteria 3222
198 Ga0307407_10094258 3300031903 Bacteria 1843
199 Ga0307412_11817334 3300031911 Bacteria 561
200 Ga0307409_100302869 3300031995 Unclassified 1488
201 Ga0307409_100418087 3300031995 Bacteria 1285
202 Ga0307416_100289836 3300032002 Bacteria 1620
203 Ga0307416_103524322 3300032002 Bacteria 524
204 Ga0307411_10370878 3300032005 Bacteria 1174
205 Ga0307411_10710036 3300032005 Bacteria 877
206 Ga0307415_100414103 3300032126 Bacteria 1154
207 Ga0373948_0040091 3300034817 Bacteria 977
208 Ga0373932_0062729 3300035112 Bacteria 1134
209 Ga0373939_0298215 3300035114 Bacteria 642
210 Ga0373939_0363875 3300035114 Bacteria 591
211 Ga0373953_0102459 3300035117 Bacteria 1206
212 Ga0373961_0021182 3300035241 Bacteria 1727
213 Ga0316574_0484885 3300035398 Bacteria 772
214 Ga0373931_0501363 3300035691 Bacteria 783
215 Ga0373937_0207601 3300036401 Bacteria 1842
216 Ga0373937_0422994 3300036401 Bacteria 1264
217 Ga0373925_0000374 3300037068 Bacteria 46408
218 Ga0436364_0701866 3300037853 Bacteria 507
219 Ga0436365_1545819 3300039437 Bacteria 1849
220 Ga0439466_0163742 3300041411 Bacteria 680
221 Ga0439465_0065283 3300041413 Bacteria 1212
222 Ga0451787_134758 3300041441 Bacteria 788
223 Ga0451835_0797677 3300041492 Bacteria 513
224 Ga0451841_0043413 3300041498 Bacteria 592
225 Ga0439448_0217212 3300042005 Bacteria 672
226 Ga0439450_032924 3300042008 Bacteria 1173
227 Ga0439463_014771 3300042016 Bacteria 1927
228 Ga0439463_085151 3300042016 Bacteria 813
229 Ga0439463_132790 3300042016 Bacteria 644
230 Ga0450917_003330 3300042120 Bacteria 1162
231 Ga0450902_050308 3300042137 Bacteria 715
232 Ga0450905_047685 3300042142 Bacteria 693
233 Ga0439464_0058933 3300042439 Bacteria 1121
234 Ga0439460_0148941 3300042461 Bacteria 780
235 Ga0439440_0075389 3300042993 Bacteria 884
236 Ga0439440_0115890 3300042993 Bacteria 741
237 Ga0439440_0246072 3300042993 Bacteria 543
238 Ga0453683_0639250 3300044673 Bacteria 695
239 Ga0451576_1299983 3300045051 Unclassified 758
240 Ga0495629_0042907 3300046459 Bacteria 3177
241 Ga0495641_0224044 3300046461 Bacteria 844
242 Ga0495651_0600994 3300046462 Bacteria 694
243 Ga0495651_0917433 3300046462 Bacteria 535
244 Ga0495608_0375065 3300046511 Bacteria 873
245 Ga0495625_0624348 3300046660 Bacteria 644
246 Ga0495647_0397155 3300046681 Bacteria 633
247 Ga0495675_0793007 3300047444 Bacteria 525
248 Ga0495593_0059292 3300047673 Bacteria 2006
249 Ga0495602_0392224 3300048088 Unclassified 992
250 Ga0496101_0350614 3300048904 Bacteria 1160
251 Ga0496102_0080413 3300048905 Bacteria 3003
252 Ga0496102_1676567 3300048905 Unclassified 554
253 Ga0496103_0012571 3300048906 Bacteria 5020
254 Ga0496104_0824250 3300048907 Bacteria 834
255 Ga0496105_1412850 3300048908 Bacteria 504
256 Ga0496106_0014548 3300048909 Bacteria 5814
257 Ga0496107_0392691 3300048910 Bacteria 1032
258 Ga0496108_1411580 3300048911 Bacteria 582
259 Ga0496109_0231093 3300048912 Bacteria 1740
260 Ga0496109_0511313 3300048912 Bacteria 1134
261 Ga0496109_1596715 3300048912 Unclassified 587
262 Ga0496110_1327571 3300048913 Bacteria 629
263 Ga0496112_0101013 3300048915 Bacteria 2854
264 Ga0496113_0028951 3300048916 Bacteria 3992
265 Ga0501031_0007534 3300049568 Bacteria 7090
266 Ga0501031_0125564 3300049568 Bacteria 1676
267 Ga0501031_0176606 3300049568 Unclassified 1395
268 Ga0501031_0244796 3300049568 Bacteria 1165
269 Ga0501031_0591975 3300049568 Bacteria 714
270 Ga0501032_0992427 3300049569 Bacteria 528
271 Ga0501033_0371179 3300049570 Bacteria 1000
272 Ga0501033_0905746 3300049570 Bacteria 593
273 Ga0501034_0493976 3300049571 Bacteria 1138
274 Ga0501036_0006480 3300049572 Bacteria 9511
275 Ga0501036_0209127 3300049572 Bacteria 1640
276 Ga0501036_0659456 3300049572 Bacteria 866
277 Ga0501037_0262516 3300049573 Unclassified 1206
278 Ga0501037_0679064 3300049573 Bacteria 687
279 Ga0501037_1071196 3300049573 Bacteria 523
280 Ga0501038_0242703 3300049574 Bacteria 1430
281 Ga0501038_0262130 3300049574 Unclassified 1365
282 Ga0501038_0685984 3300049574 Unclassified 769
283 Ga0501038_0752372 3300049574 Bacteria 727
284 Ga0501039_0001029 3300049575 Bacteria 20376
285 Ga0501039_0042950 3300049575 Unclassified 3492
286 Ga0501039_0216419 3300049575 Unclassified 1506
287 Ga0501040_0003992 3300049576 Bacteria 9586
288 Ga0501040_0108996 3300049576 Bacteria 1936
289 Ga0501040_0890264 3300049576 Bacteria 645
290 Ga0501041_0015454 3300049577 Unclassified 4532
291 Ga0501041_0218331 3300049577 Unclassified 1196
292 Ga0501041_0809472 3300049577 Bacteria 601
293 Ga0501042_0011654 3300049578 Bacteria 5941
294 Ga0501042_0156529 3300049578 Bacteria 1644
295 Ga0501042_0446066 3300049578 Bacteria 938
296 Ga0501043_0392459 3300049579 Bacteria 1049
297 Ga0501046_0080433 3300049580 Bacteria 2518
298 Ga0501046_0830649 3300049580 Unclassified 646
299 Ga0501048_0010446 3300049582 Bacteria 6932
300 Ga0501048_0237725 3300049582 Unclassified 1292
301 Ga0501048_0491193 3300049582 Bacteria 880
302 Ga0501067_0073382 3300049583 Bacteria 1896
303 Ga0501067_0221041 3300049583 Bacteria 1055
304 Ga0501068_0002749 3300049584 Bacteria 9343
305 Ga0501068_0180680 3300049584 Bacteria 1334
306 Ga0501068_0239835 3300049584 Bacteria 1154
307 Ga0501069_0007289 3300049585 Bacteria 5801
308 Ga0501069_0084069 3300049585 Bacteria 1795
309 Ga0501069_0223822 3300049585 Bacteria 1094
310 Ga0501069_0627513 3300049585 Bacteria 646
311 Ga0501069_0696508 3300049585 Bacteria 613
312 Ga0501070_0036623 3300049586 Bacteria 4097
313 Ga0501070_0265055 3300049586 Bacteria 1404
314 Ga0501070_0278149 3300049586 Unclassified 1366
315 Ga0501070_1112466 3300049586 Bacteria 609
316 Ga0501071_0000445 3300049587 Bacteria 20780
317 Ga0501071_0002994 3300049587 Bacteria 10456
318 Ga0501071_0489861 3300049587 Bacteria 943
319 Ga0501071_0830622 3300049587 Unclassified 712
320 Ga0501072_0017293 3300049588 Bacteria 5542
321 Ga0501072_0018043 3300049588 Bacteria 5426
322 Ga0501072_0058015 3300049588 Unclassified 3051
323 Ga0501073_0045000 3300049589 Bacteria 3110
324 Ga0501073_0145910 3300049589 Unclassified 1640
325 Ga0501074_0013342 3300049590 Bacteria 5975
326 Ga0501074_0053052 3300049590 Bacteria 2926
327 Ga0501074_0109999 3300049590 Unclassified 1971
328 Ga0501074_0175952 3300049590 Bacteria 1527
329 Ga0501075_0001623 3300049591 Bacteria 14756
330 Ga0501075_0035363 3300049591 Bacteria 3725
331 Ga0501075_0095145 3300049591 Unclassified 2260
332 Ga0501075_0267044 3300049591 Bacteria 1304
333 Ga0501076_0099261 3300049592 Bacteria 2345
334 Ga0501076_0177208 3300049592 Unclassified 1737
335 Ga0501076_0232134 3300049592 Bacteria 1508
336 Ga0501076_0311896 3300049592 Bacteria 1290
337 Ga0501076_0600135 3300049592 Bacteria 908
338 Ga0501077_0000441 3300049593 Bacteria 25114
339 Ga0501077_0017697 3300049593 Bacteria 4501
340 Ga0501077_0028509 3300049593 Bacteria 3548
341 Ga0501077_0036866 3300049593 Bacteria 3115
342 Ga0501079_0001392 3300049741 Bacteria 17043
343 Ga0501079_0021844 3300049741 Bacteria 4899
344 Ga0501079_0031717 3300049741 Bacteria 4061
345 Ga0501079_0049298 3300049741 Bacteria 3250
346 Ga0501079_0117675 3300049741 Bacteria 2066
347 Ga0501079_1005228 3300049741 Unclassified 657
348 Ga0501080_0002533 3300049742 Bacteria 15990
349 Ga0501080_0029468 3300049742 Bacteria 5110
350 Ga0501080_0042741 3300049742 Bacteria 4219
351 Ga0501080_0418024 3300049742 Bacteria 1205
352 Ga0501080_0511515 3300049742 Bacteria 1072
353 Ga0501081_0001005 3300049743 Bacteria 16818
354 Ga0501081_0287178 3300049743 Bacteria 1205
355 Ga0501081_0791434 3300049743 Bacteria 713
356 Ga0501083_0016540 3300049744 Bacteria 5159
357 Ga0501083_0037547 3300049744 Bacteria 3299
358 Ga0501083_0479805 3300049744 Unclassified 809
359 Ga0501035_0070794 3300049822 Bacteria 3089
360 Ga0501035_0713842 3300049822 Bacteria 808
361 Ga0501045_0001458 3300049824 Bacteria 15722
362 Ga0501045_0008897 3300049824 Bacteria 7010
363 Ga0501045_0100749 3300049824 Bacteria 2138
364 nmdc:mga06z11_388164_c1 3300050494 Unclassified 839
365 nmdc:mga05p37_1096429_c1 3300050507 Bacteria 834
366 nmdc:mga05p37_550388_c1 3300050507 Unclassified 1313
367 nmdc:mga09592_1506572_c1 3300050508 Bacteria 547
368 nmdc:mga08y16_1018466_c1 3300050511 Archaea 807
369 nmdc:mga08y16_1267303_c1 3300050511 Unclassified 705
370 nmdc:mga08y16_769800_c1 3300050511 Bacteria 957
371 nmdc:mga08y16_91792_c1 3300050511 Bacteria 3165
372 nmdc:mga0a205_896960_c1 3300050515 Bacteria 733
373 Ga0495601_0212800 3300053077 Bacteria 1263
374 Ga0495601_0376245 3300053077 Bacteria 922
375 Ga0495619_0064696 3300053085 Bacteria 2439
376 Ga0495619_0161912 3300053085 Bacteria 1546
377 Ga0501084_0001756 3300054114 Bacteria 17232
378 Ga0501084_0059792 3300054114 Bacteria 3190
379 Ga0501084_0073943 3300054114 Bacteria 2853
380 Ga0501084_0444912 3300054114 Unclassified 1095
381 Ga0501082_0034233 3300060353 Bacteria 4381
382 Ga0501082_0143481 3300060353 Unclassified 2072
383 Ga0501082_0554859 3300060353 Bacteria 1005
384 Ga0530510_0001711 3300061734 Bacteria 14901
385 Ga0530510_0302642 3300061734 Unclassified 1196
386 Ga0530510_1021188 3300061734 Bacteria 633
387 Ga0307416_101068053
388 JGI26145J50221_1030165
389 JGI25407J50210_10040346
390 Ga0070690_100546353
391 Ga0070670_101679925
392 Ga0068869_101162527
393 Ga0070666_11322052
394 Ga0068868_100532387
395 Ga0070660_100112656
396 Ga0070689_100220612
397 Ga0070687_100169475
398 Ga0070692_10517960
399 Ga0070692_10639306
400 Ga0070668_100055756
401 Ga0070668_100995252
402 Ga0070669_101258398
403 Ga0070675_100328079
404 Ga0070674_102153531
405 Ga0070688_100140648
406 Ga0070659_100648899
407 Ga0070703_10109539
408 Ga0070703_10292220
409 Ga0070701_10283308
410 Ga0070701_10551243
411 Ga0070701_10664534
412 Ga0070705_100017515
413 Ga0070705_100429381
414 Ga0070705_101956788
415 Ga0070700_100175579
416 Ga0070700_101586864
417 Ga0070694_100639932
418 Ga0070708_100520877
419 Ga0070708_101340551
420 Ga0070663_100775874
421 Ga0070678_101373219
422 Ga0070678_102330556
423 Ga0070662_100112485
424 Ga0070662_100132225
425 Ga0068867_100892121
426 Ga0068867_101048206
427 Ga0070706_100001304
428 Ga0070706_100079525
429 Ga0070706_100444094
430 Ga0070706_101258895
431 Ga0070706_101366212
432 Ga0070707_100003275
433 Ga0070707_100509922
434 Ga0070698_100154038
435 Ga0070698_100276872
436 Ga0070698_100802481
437 Ga0070698_100952632
438 Ga0070698_100976376
439 Ga0070698_101247754
440 Ga0070699_100080563
441 Ga0070699_100447610
442 Ga0070699_101135591
443 Ga0070684_101807303
444 Ga0070697_100471938
445 Ga0070697_100968483
446 Ga0070672_100573934
447 Ga0070696_100041167
448 Ga0070693_100398664
449 Ga0070704_100072231
450 Ga0068855_100016813
451 Ga0068855_101590420
452 Ga0070664_100444869
453 Ga0068856_102233518
454 Ga0070702_100209414
455 Ga0070702_101157703
456 Ga0068852_100260484
457 Ga0068852_101627190
458 Ga0068859_100527254
459 Ga0068859_101778725
460 Ga0068864_100105838
461 Ga0068864_101811202
462 Ga0068861_100059963
463 Ga0068861_101331934
464 Ga0068863_100302751
465 Ga0068858_100312431
466 Ga0068858_101661518
467 Ga0068862_100541337
468 Ga0068862_101815342
469 Ga0081455_10055079
470 Ga0081538_10010976
471 Ga0081540_1191286
472 Ga0075432_10214050
473 Ga0075367_10407452
474 Ga0097621_101697033
475 Ga0068871_101980516
476 Ga0075428_100786337
477 Ga0075428_102417177
478 Ga0075430_100666376
479 Ga0075433_10511879
480 Ga0075434_100043290
481 Ga0075429_100981378
482 Ga0075429_101966837
483 Ga0068865_100830343
484 Ga0068865_101184479
485 Ga0097620_100527287
486 Ga0097620_101778909
487 Ga0105251_10382129
488 Ga0105240_10411771
489 Ga0111539_10342296
490 Ga0111539_10376822
491 Ga0111539_10762878
492 Ga0111539_10992517
493 Ga0111539_12109106
494 Ga0105245_10573417
495 Ga0105245_10577666
496 Ga0105245_11618226
497 Ga0114129_10954439
498 Ga0114129_11065039
499 Ga0105242_10777363
500 Ga0105248_11453270
501 Ga0105249_10256660
502 Ga0105249_10313862
503 Ga0105239_10228523
504 Ga0105239_11104036
505 Ga0157370_10130689
506 Ga0157374_10828491
507 Ga0157378_10428382
508 Ga0157378_11299888
509 Ga0157378_11933514
510 Ga0157372_12577304
511 Ga0157375_10369470
512 Ga0157380_10226862
513 Ga0157380_10532411
514 Ga0157380_10623161
515 Ga0157380_11712121
516 Ga0157380_11766179
517 Ga0157377_10222055
518 Ga0157377_10381337
519 Ga0157377_10463441
520 Ga0157376_10492426
521 Ga0163161_10193644
522 Ga0207653_10207594
523 Ga0207688_10645779
524 Ga0207645_10536670
525 Ga0207705_10229269
526 Ga0207684_10001366
527 Ga0207684_10584378
528 Ga0207695_11255385
529 Ga0207662_10140301
530 Ga0207657_10134387
531 Ga0207646_10029748
532 Ga0207646_10043678
533 Ga0207646_11350151
534 Ga0207650_11915493
535 Ga0207659_11831486
536 Ga0207687_10698592
537 Ga0207644_11496349
538 Ga0207690_10874041
539 Ga0207706_10181593
540 Ga0207706_10241185
541 Ga0207686_11010957
542 Ga0207709_11121945
543 Ga0207670_10504126
544 Ga0207704_11054432
545 Ga0207691_10547898
546 Ga0207689_10322702
547 Ga0207667_10027174
548 Ga0207667_10799785
549 Ga0207651_11643679
550 Ga0207668_10042252
551 Ga0207677_11075210
552 Ga0207703_10359580
553 Ga0207703_11312659
554 Ga0207708_10184432
555 Ga0207708_10317701
556 Ga0207702_10955030
557 Ga0207641_11464580
558 Ga0207676_10351891
559 Ga0207676_11824949
560 Ga0207675_100054854
561 Ga0207675_100156789
562 Ga0207675_102266041
563 Ga0207428_10081471
564 Ga0207428_10861612
565 Ga0268265_10641339
566 Ga0265326_10019138
567 Ga0265326_10128046
568 Ga0265334_10036755
569 Ga0265334_10069547
570 Ga0265323_10034113
571 Ga0265322_10004991
572 Ga0265324_10072416
573 Ga0265324_10077937
574 Ga0307512_10237566
575 Ga0265325_10065890
576 Ga0265331_10458334
577 Ga0265331_10470341
578 Ga0265316_10043527
579 Ga0265316_10670332
580 Ga0265316_11260569
581 Ga0307513_10009943
582 Ga0265314_10201822
583 Ga0326468_10000770
584 Ga0307407_10094258
585 Ga0307412_11817334
586 Ga0307409_100302869
587 Ga0307409_100418087
588 Ga0307416_100289836
589 Ga0307416_103524322
590 Ga0307411_10370878
591 Ga0307411_10710036
592 Ga0307415_100414103
593 Ga0373948_0040091
594 Ga0373932_0062729
595 Ga0373939_0298215
596 Ga0373939_0363875
597 Ga0373953_0102459
598 Ga0373961_0021182
599 Ga0316574_0484885
600 Ga0373931_0501363
601 Ga0373937_0207601
602 Ga0373937_0422994
603 Ga0373925_0000374
604 Ga0436364_0701866
605 Ga0436365_1545819
606 Ga0439466_0163742
607 Ga0439465_0065283
608 Ga0451787_134758
609 Ga0451835_0797677
610 Ga0451841_0043413
611 Ga0439448_0217212
612 Ga0439450_032924
613 Ga0439463_014771
614 Ga0439463_085151
615 Ga0439463_132790
616 Ga0450917_003330
617 Ga0450902_050308
618 Ga0450905_047685
619 Ga0439464_0058933
620 Ga0439460_0148941
621 Ga0439440_0075389
622 Ga0439440_0115890
623 Ga0439440_0246072
624 Ga0453683_0639250
625 Ga0451576_1299983
626 Ga0495629_0042907
627 Ga0495641_0224044
628 Ga0495651_0600994
629 Ga0495651_0917433
630 Ga0495608_0375065
631 Ga0495625_0624348
632 Ga0495647_0397155
633 Ga0495675_0793007
634 Ga0495593_0059292
635 Ga0495602_0392224
636 Ga0496101_0350614
637 Ga0496102_0080413
638 Ga0496102_1676567
639 Ga0496103_0012571
640 Ga0496104_0824250
641 Ga0496105_1412850
642 Ga0496106_0014548
643 Ga0496107_0392691
644 Ga0496108_1411580
645 Ga0496109_0231093
646 Ga0496109_0511313
647 Ga0496109_1596715
648 Ga0496110_1327571
649 Ga0496112_0101013
650 Ga0496113_0028951
651 Ga0501031_0007534
652 Ga0501031_0125564
653 Ga0501031_0176606
654 Ga0501031_0244796
655 Ga0501031_0591975
656 Ga0501032_0992427
657 Ga0501033_0371179
658 Ga0501033_0905746
659 Ga0501034_0493976
660 Ga0501036_0006480
661 Ga0501036_0209127
662 Ga0501036_0659456
663 Ga0501037_0262516
664 Ga0501037_0679064
665 Ga0501037_1071196
666 Ga0501038_0242703
667 Ga0501038_0262130
668 Ga0501038_0685984
669 Ga0501038_0752372
670 Ga0501039_0001029
671 Ga0501039_0042950
672 Ga0501039_0216419
673 Ga0501040_0003992
674 Ga0501040_0108996
675 Ga0501040_0890264
676 Ga0501041_0015454
677 Ga0501041_0218331
678 Ga0501041_0809472
679 Ga0501042_0011654
680 Ga0501042_0156529
681 Ga0501042_0446066
682 Ga0501043_0392459
683 Ga0501046_0080433
684 Ga0501046_0830649
685 Ga0501048_0010446
686 Ga0501048_0237725
687 Ga0501048_0491193
688 Ga0501067_0073382
689 Ga0501067_0221041
690 Ga0501068_0002749
691 Ga0501068_0180680
692 Ga0501068_0239835
693 Ga0501069_0007289
694 Ga0501069_0084069
695 Ga0501069_0223822
696 Ga0501069_0627513
697 Ga0501069_0696508
698 Ga0501070_0036623
699 Ga0501070_0265055
700 Ga0501070_0278149
701 Ga0501070_1112466
702 Ga0501071_0000445
703 Ga0501071_0002994
704 Ga0501071_0489861
705 Ga0501071_0830622
706 Ga0501072_0017293
707 Ga0501072_0018043
708 Ga0501072_0058015
709 Ga0501073_0045000
710 Ga0501073_0145910
711 Ga0501074_0013342
712 Ga0501074_0053052
713 Ga0501074_0109999
714 Ga0501074_0175952
715 Ga0501075_0001623
716 Ga0501075_0035363
717 Ga0501075_0095145
718 Ga0501075_0267044
719 Ga0501076_0099261
720 Ga0501076_0177208
721 Ga0501076_0232134
722 Ga0501076_0311896
723 Ga0501076_0600135
724 Ga0501077_0000441
725 Ga0501077_0017697
726 Ga0501077_0028509
727 Ga0501077_0036866
728 Ga0501079_0001392
729 Ga0501079_0021844
730 Ga0501079_0031717
731 Ga0501079_0049298
732 Ga0501079_0117675
733 Ga0501079_1005228
734 Ga0501080_0002533
735 Ga0501080_0029468
736 Ga0501080_0042741
737 Ga0501080_0418024
738 Ga0501080_0511515
739 Ga0501081_0001005
740 Ga0501081_0287178
741 Ga0501081_0791434
742 Ga0501083_0016540
743 Ga0501083_0037547
744 Ga0501083_0479805
745 Ga0501035_0070794
746 Ga0501035_0713842
747 Ga0501045_0001458
748 Ga0501045_0008897
749 Ga0501045_0100749
750 nmdc:mga06z11_388164_c1
751 nmdc:mga05p37_1096429_c1
752 nmdc:mga05p37_550388_c1
753 nmdc:mga09592_1506572_c1
754 nmdc:mga08y16_1018466_c1
755 nmdc:mga08y16_1267303_c1
756 nmdc:mga08y16_769800_c1
757 nmdc:mga08y16_91792_c1
758 nmdc:mga0a205_896960_c1
759 Ga0495601_0212800
760 Ga0495601_0376245
761 Ga0495619_0064696
762 Ga0495619_0161912
763 Ga0501084_0001756
764 Ga0501084_0059792
765 Ga0501084_0073943
766 Ga0501084_0444912
767 Ga0501082_0034233
768 Ga0501082_0143481
769 Ga0501082_0554859
770 Ga0530510_0001711
771 Ga0530510_0302642
772 Ga0530510_1021188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

4

79

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.9765 2 81
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.9532 2 81
3rhu-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.829 34 55
3rfn-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.7603 34 56
1v4p-assembly3.cif.gz_C crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3 0.7577 34 58
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.9632 4 81 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.9398 4 81 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7818 1 77 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7337 1 77 3.30.70.3090
2pfdC01 Alpha Beta;2-Layer Sandwich;Formiminotransferase-cyclodeaminase; Chain B, domain 1;Formiminotransferase, N-terminal subdomain 0.7088 2 67 3.30.990.10
ID Description Score Start End GO Terms
AF-A0A5M3WIQ3-F1-model_v4 Guanylate cyclase 0.9866 1 82
AF-A0A5A7NPG7-F1-model_v4 DUF4242 domain-containing protein 0.985 1 81
AF-A0A385ZN06-F1-model_v4 deleted 0.9841 2 81
AF-M3F4U3-F1-model_v4 Gualylate cyclase 0.9837 2 81
AF-A0A5M3XJK3-F1-model_v4 Guanylate cyclase 0.9833 1 82

Map