F430535

General Info

Members Datasets Scaffolds Average Seq Length
386 178 772 294

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10087097|Ga0207703_100870972
Length 319
Sequence MAGAASPWPNLSELVSTTHSSAPVGLVGAPLAAGSVTPGRCDLAPGLLRSTLRRVGRYDVETGRELGTHVFDHGDVPLDGLSIEDATPLIRDKVAASAAAHGLTLLAGGNNAVTRPGVLGLGVPLNEVGLITLDAHFDMRDLDSGLGNGNPVRALIEDGLPGANIAQVGLAPFANSKNMHEDALAAGNLIVTIAEVRAEGIERAIERAVAHVKHCQVLAIDCDIDVIDRAQFPAAPGARPGGMSSTDFFAAVRRLAAEPRVRLIDLTEWDPPLDPSDLSALTAARWLAECLAGFELRSIYSPLLSGQWAQFRQECHMSP

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
177 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
178 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.26
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.11
Rhizosphere 96.63
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_10087097 3300026035 Bacteria 2618
2 JGI24740J21852_10003168 3300001979 Bacteria 7261
3 JGI24740J21852_10015586 3300001979 Bacteria 2770
4 JGI24744J21845_10001145 3300002077 Bacteria 5160
5 rootL2_10182658 3300003322 Bacteria 2175
6 Ga0065715_10096517 3300005293 Bacteria 3866
7 Ga0070658_10079751 3300005327 Bacteria 2688
8 Ga0070658_10322671 3300005327 Bacteria 1319
9 Ga0070658_10382642 3300005327 Bacteria 1207
10 Ga0070676_10006115 3300005328 Bacteria 6428
11 Ga0070683_100003508 3300005329 Bacteria 12758
12 Ga0070683_100066574 3300005329 Bacteria 3356
13 Ga0070683_100087365 3300005329 Bacteria 2924
14 Ga0070690_100007695 3300005330 Bacteria 6177
15 Ga0070670_100055479 3300005331 Bacteria 3401
16 Ga0070670_100110481 3300005331 Bacteria 2369
17 Ga0070677_10015979 3300005333 Bacteria 2666
18 Ga0070677_10031972 3300005333 Bacteria 2015
19 Ga0068869_100018329 3300005334 Bacteria 4763
20 Ga0068869_100058918 3300005334 Bacteria 2810
21 Ga0070666_10016352 3300005335 Bacteria 4745
22 Ga0070666_10021240 3300005335 Bacteria 4205
23 Ga0070666_10169443 3300005335 Bacteria 1529
24 Ga0070680_100005354 3300005336 Bacteria 9708
25 Ga0070680_100014198 3300005336 Bacteria 6221
26 Ga0070682_100131493 3300005337 Bacteria 1694
27 Ga0068868_100013844 3300005338 Bacteria 5929
28 Ga0068868_100024090 3300005338 Bacteria 4614
29 Ga0068868_100047823 3300005338 Bacteria 3354
30 Ga0070660_100199129 3300005339 Bacteria 1624
31 Ga0070661_100050375 3300005344 Bacteria 3047
32 Ga0070668_100002631 3300005347 Bacteria 13189
33 Ga0070669_100032611 3300005353 Bacteria 3763
34 Ga0070675_100035169 3300005354 Bacteria 4069
35 Ga0070671_100004138 3300005355 Bacteria 11451
36 Ga0070671_100055470 3300005355 Bacteria 3296
37 Ga0070671_100559696 3300005355 Bacteria 986
38 Ga0070674_100002665 3300005356 Bacteria 9891
39 Ga0070674_100014969 3300005356 Bacteria 4832
40 Ga0070674_100031950 3300005356 Bacteria 3493
41 Ga0070674_100125904 3300005356 Bacteria 1903
42 Ga0070674_100221869 3300005356 Bacteria 1471
43 Ga0070673_100033723 3300005364 Bacteria 3869
44 Ga0070673_100094475 3300005364 Bacteria 2451
45 Ga0070673_100271605 3300005364 Bacteria 1484
46 Ga0070659_100024411 3300005366 Bacteria 4634
47 Ga0070659_100038380 3300005366 Bacteria 3736
48 Ga0070659_100087509 3300005366 Bacteria 2494
49 Ga0070659_100376693 3300005366 Bacteria 1195
50 Ga0070667_100001584 3300005367 Bacteria 20376
51 Ga0070667_100025928 3300005367 Bacteria 4875
52 Ga0070667_100081479 3300005367 Bacteria 2770
53 Ga0070667_100134412 3300005367 Bacteria 2162
54 Ga0070709_10102936 3300005434 Bacteria 1905
55 Ga0070714_100030803 3300005435 Bacteria 4469
56 Ga0070713_100039648 3300005436 Bacteria 3824
57 Ga0070663_100142790 3300005455 Bacteria 1829
58 Ga0070663_100218892 3300005455 Bacteria 1494
59 Ga0070663_100259543 3300005455 Bacteria 1378
60 Ga0070663_100425763 3300005455 Bacteria 1089
61 Ga0070678_100154275 3300005456 Bacteria 1854
62 Ga0070662_100016105 3300005457 Bacteria 5015
63 Ga0068867_100009725 3300005459 Bacteria 6781
64 Ga0068867_100020902 3300005459 Bacteria 4668
65 Ga0068867_100031620 3300005459 Bacteria 3823
66 Ga0070685_10052361 3300005466 Bacteria 2362
67 Ga0070679_100088260 3300005530 Bacteria 3088
68 Ga0070679_100387318 3300005530 Bacteria 1344
69 Ga0070684_100005655 3300005535 Bacteria 9603
70 Ga0068853_100039158 3300005539 Bacteria 4042
71 Ga0070672_100023221 3300005543 Bacteria 4568
72 Ga0070672_100091539 3300005543 Bacteria 2454
73 Ga0070672_100108834 3300005543 Bacteria 2257
74 Ga0070686_100020141 3300005544 Bacteria 3944
75 Ga0070665_100007242 3300005548 Bacteria 11272
76 Ga0068855_100086722 3300005563 Bacteria 3619
77 Ga0068855_100546108 3300005563 Bacteria 1255
78 Ga0070664_100029394 3300005564 Bacteria 4581
79 Ga0070664_100055917 3300005564 Bacteria 3352
80 Ga0068854_100056611 3300005578 Bacteria 2826
81 Ga0068854_100288358 3300005578 Bacteria 1324
82 Ga0068856_100100626 3300005614 Bacteria 2882
83 Ga0068852_100029606 3300005616 Bacteria 4500
84 Ga0068852_100042069 3300005616 Bacteria 3866
85 Ga0068852_100202697 3300005616 Bacteria 1878
86 Ga0068859_100004327 3300005617 Bacteria 14483
87 Ga0068859_100020238 3300005617 Bacteria 6680
88 Ga0068864_100078995 3300005618 Bacteria 2880
89 Ga0068861_100001972 3300005719 Bacteria 13235
90 Ga0068851_10017534 3300005834 Bacteria 3440
91 Ga0068863_100013758 3300005841 Bacteria 7798
92 Ga0068863_100397818 3300005841 Bacteria 1347
93 Ga0068858_100001945 3300005842 Bacteria 21060
94 Ga0068858_100428927 3300005842 Bacteria 1272
95 Ga0068858_100445407 3300005842 Bacteria 1248
96 Ga0068860_100061365 3300005843 Bacteria 3572
97 Ga0068860_100106583 3300005843 Bacteria 2677
98 Ga0068862_100025451 3300005844 Bacteria 4969
99 Ga0081539_10031650 3300005985 Bacteria 3256
100 Ga0070717_10085354 3300006028 Bacteria 2657
101 Ga0070716_100019524 3300006173 Bacteria 3543
102 Ga0070712_100010341 3300006175 Bacteria 5884
103 Ga0097621_100103672 3300006237 Bacteria 2396
104 Ga0068871_100024877 3300006358 Bacteria 4649
105 Ga0068865_100001452 3300006881 Bacteria 13787
106 Ga0068865_100012192 3300006881 Bacteria 5406
107 Ga0068865_100034129 3300006881 Bacteria 3412
108 Ga0068865_100159044 3300006881 Bacteria 1721
109 Ga0097620_100004327 3300006931 Bacteria 14483
110 Ga0097620_100020236 3300006931 Bacteria 6680
111 Ga0105240_10215419 3300009093 Bacteria 2241
112 Ga0111539_10716020 3300009094 Bacteria 1165
113 Ga0105243_10035390 3300009148 Bacteria 3871
114 Ga0105241_10059280 3300009174 Bacteria 2943
115 Ga0105242_10145088 3300009176 Bacteria 2064
116 Ga0105248_10002422 3300009177 Bacteria 20691
117 Ga0105248_10053470 3300009177 Bacteria 4531
118 Ga0105238_10027776 3300009551 Bacteria 5767
119 Ga0105249_10082934 3300009553 Bacteria 2983
120 Ga0157373_10048072 3300013100 Bacteria 3042
121 Ga0157373_10266742 3300013100 Bacteria 1212
122 Ga0157370_10006602 3300013104 Bacteria 12755
123 Ga0157370_10071096 3300013104 Bacteria 3284
124 Ga0157370_10118299 3300013104 Bacteria 2475
125 Ga0157370_10126733 3300013104 Bacteria 2383
126 Ga0157369_10319481 3300013105 Bacteria 1614
127 Ga0157369_10581463 3300013105 Bacteria 1157
128 Ga0157374_10016891 3300013296 Bacteria 6423
129 Ga0157378_10023065 3300013297 Bacteria 5478
130 Ga0163162_10026405 3300013306 Bacteria 5738
131 Ga0157372_10030441 3300013307 Bacteria 5906
132 Ga0163163_10096814 3300014325 Bacteria 2972
133 Ga0163163_10262739 3300014325 Bacteria 1777
134 Ga0157380_10004324 3300014326 Bacteria 9850
135 Ga0163161_10084885 3300017792 Bacteria 2335
136 Ga0206356_11011222 3300020070 Bacteria 1697
137 Ga0207682_10000662 3300025893 Bacteria 16097
138 Ga0207682_10062506 3300025893 Bacteria 1561
139 Ga0207688_10015012 3300025901 Bacteria 4202
140 Ga0207688_10178224 3300025901 Bacteria 1266
141 Ga0207680_10000361 3300025903 Bacteria 21828
142 Ga0207647_10005880 3300025904 Bacteria 8940
143 Ga0207647_10015643 3300025904 Bacteria 5194
144 Ga0207645_10008491 3300025907 Bacteria 7162
145 Ga0207645_10009510 3300025907 Bacteria 6719
146 Ga0207645_10068687 3300025907 Bacteria 2266
147 Ga0207705_10029468 3300025909 Bacteria 3912
148 Ga0207705_10207344 3300025909 Bacteria 1486
149 Ga0207707_10024850 3300025912 Bacteria 5240
150 Ga0207707_10316693 3300025912 Bacteria 1347
151 Ga0207695_10251479 3300025913 Bacteria 1667
152 Ga0207660_10039469 3300025917 Bacteria 3300
153 Ga0207657_10012981 3300025919 Bacteria 8189
154 Ga0207657_10213056 3300025919 Bacteria 1550
155 Ga0207649_10039249 3300025920 Bacteria 2869
156 Ga0207649_10043828 3300025920 Bacteria 2738
157 Ga0207649_10057014 3300025920 Bacteria 2441
158 Ga0207649_10198651 3300025920 Bacteria 1415
159 Ga0207652_10095054 3300025921 Bacteria 2625
160 Ga0207652_10288105 3300025921 Bacteria 1482
161 Ga0207681_10028762 3300025923 Bacteria 3603
162 Ga0207681_10097194 3300025923 Bacteria 2116
163 Ga0207681_10188823 3300025923 Bacteria 1575
164 Ga0207681_10194590 3300025923 Bacteria 1553
165 Ga0207694_10226428 3300025924 Bacteria 1526
166 Ga0207650_10003080 3300025925 Bacteria 11482
167 Ga0207650_10044057 3300025925 Bacteria 3278
168 Ga0207700_10281270 3300025928 Bacteria 1431
169 Ga0207664_10072650 3300025929 Bacteria 2774
170 Ga0207664_10094016 3300025929 Bacteria 2463
171 Ga0207664_10196588 3300025929 Bacteria 1739
172 Ga0207664_10284803 3300025929 Bacteria 1451
173 Ga0207644_10000153 3300025931 Bacteria 49585
174 Ga0207644_10007741 3300025931 Bacteria 7013
175 Ga0207644_10106491 3300025931 Bacteria 2114
176 Ga0207644_10273757 3300025931 Bacteria 1354
177 Ga0207690_10305796 3300025932 Bacteria 1245
178 Ga0207690_10352389 3300025932 Bacteria 1164
179 Ga0207706_10005385 3300025933 Bacteria 11926
180 Ga0207706_10026617 3300025933 Bacteria 5176
181 Ga0207706_10077098 3300025933 Bacteria 2932
182 Ga0207706_10227237 3300025933 Bacteria 1633
183 Ga0207686_10173363 3300025934 Bacteria 1523
184 Ga0207709_10303676 3300025935 Bacteria 1188
185 Ga0207670_10319219 3300025936 Bacteria 1222
186 Ga0207669_10017258 3300025937 Bacteria 3697
187 Ga0207669_10049692 3300025937 Bacteria 2501
188 Ga0207669_10341470 3300025937 Bacteria 1153
189 Ga0207704_10005375 3300025938 Bacteria 5904
190 Ga0207704_10006534 3300025938 Bacteria 5446
191 Ga0207691_10004092 3300025940 Bacteria 14155
192 Ga0207691_10006985 3300025940 Bacteria 10892
193 Ga0207691_10029187 3300025940 Bacteria 5160
194 Ga0207691_10053574 3300025940 Bacteria 3683
195 Ga0207691_10073014 3300025940 Bacteria 3094
196 Ga0207711_10008538 3300025941 Bacteria 8569
197 Ga0207711_10025359 3300025941 Bacteria 4974
198 Ga0207711_10037689 3300025941 Bacteria 4108
199 Ga0207711_10189265 3300025941 Bacteria 1875
200 Ga0207689_10027769 3300025942 Bacteria 4736
201 Ga0207689_10182614 3300025942 Bacteria 1730
202 Ga0207661_10020766 3300025944 Bacteria 4914
203 Ga0207679_10264727 3300025945 Bacteria 1468
204 Ga0207667_10036750 3300025949 Bacteria 5244
205 Ga0207667_10143205 3300025949 Bacteria 2461
206 Ga0207667_10178054 3300025949 Bacteria 2184
207 Ga0207667_10496281 3300025949 Bacteria 1238
208 Ga0207651_10003515 3300025960 Bacteria 7701
209 Ga0207651_10006360 3300025960 Bacteria 6174
210 Ga0207651_10137345 3300025960 Bacteria 1882
211 Ga0207651_10165659 3300025960 Bacteria 1737
212 Ga0207651_10195289 3300025960 Bacteria 1617
213 Ga0207668_10000080 3300025972 Bacteria 72198
214 Ga0207668_10011998 3300025972 Bacteria 5287
215 Ga0207640_10052913 3300025981 Bacteria 2647
216 Ga0207640_10215133 3300025981 Bacteria 1467
217 Ga0207640_10229977 3300025981 Bacteria 1426
218 Ga0207658_10001711 3300025986 Bacteria 16642
219 Ga0207658_10064464 3300025986 Bacteria 2749
220 Ga0207658_10157751 3300025986 Bacteria 1856
221 Ga0207677_10000733 3300026023 Bacteria 19151
222 Ga0207677_10005076 3300026023 Bacteria 7114
223 Ga0207677_10024228 3300026023 Bacteria 3766
224 Ga0207677_10146127 3300026023 Bacteria 1817
225 Ga0207703_10000515 3300026035 Bacteria 39972
226 Ga0207639_10040004 3300026041 Bacteria 3497
227 Ga0207678_10004875 3300026067 Bacteria 12048
228 Ga0207678_10022023 3300026067 Bacteria 5585
229 Ga0207678_10030510 3300026067 Bacteria 4706
230 Ga0207678_10189243 3300026067 Bacteria 1758
231 Ga0207678_10241044 3300026067 Bacteria 1548
232 Ga0207702_10034639 3300026078 Bacteria 4222
233 Ga0207702_10073253 3300026078 Bacteria 2953
234 Ga0207641_10010778 3300026088 Bacteria 7493
235 Ga0207648_10018279 3300026089 Bacteria 6350
236 Ga0207648_10018472 3300026089 Bacteria 6311
237 Ga0207648_10027475 3300026089 Bacteria 5051
238 Ga0207648_10029114 3300026089 Bacteria 4897
239 Ga0207675_100004420 3300026118 Bacteria 13586
240 Ga0207675_100097095 3300026118 Bacteria 2774
241 Ga0207675_100371991 3300026118 Bacteria 1404
242 Ga0207683_10003191 3300026121 Bacteria 14300
243 Ga0207683_10050417 3300026121 Bacteria 3646
244 Ga0207698_10058595 3300026142 Bacteria 2985
245 Ga0209974_10001618 3300027876 Bacteria 8150
246 Ga0268266_10005198 3300028379 Bacteria 12252
247 Ga0268266_10025254 3300028379 Bacteria 5057
248 Ga0268265_10006065 3300028380 Bacteria 8209
249 Ga0268265_10123815 3300028380 Bacteria 2135
250 Ga0268264_10157620 3300028381 Bacteria 2042
251 Ga0268264_10433140 3300028381 Bacteria 1270
252 Ga0316182_1066678 3300030745 Bacteria 2432
253 Ga0307408_100085318 3300031548 Bacteria 2371
254 Ga0307408_100156671 3300031548 Bacteria 1804
255 Ga0307408_100250225 3300031548 Bacteria 1461
256 Ga0307405_10213901 3300031731 Bacteria 1409
257 Ga0307413_10082620 3300031824 Bacteria 2064
258 Ga0307413_10128379 3300031824 Bacteria 1730
259 Ga0307413_10156050 3300031824 Bacteria 1597
260 Ga0307413_10166591 3300031824 Bacteria 1555
261 Ga0307410_10004534 3300031852 Bacteria 7196
262 Ga0307410_10011339 3300031852 Bacteria 5093
263 Ga0307410_10143328 3300031852 Bacteria 1770
264 Ga0307410_10204084 3300031852 Bacteria 1511
265 Ga0307410_10222736 3300031852 Bacteria 1452
266 Ga0307406_10007320 3300031901 Bacteria 6116
267 Ga0307406_10007763 3300031901 Bacteria 5963
268 Ga0307406_10324933 3300031901 Bacteria 1192
269 Ga0307407_10005436 3300031903 Bacteria 5528
270 Ga0307407_10040189 3300031903 Bacteria 2606
271 Ga0307407_10081531 3300031903 Bacteria 1958
272 Ga0307407_10187766 3300031903 Bacteria 1375
273 Ga0307407_10329968 3300031903 Bacteria 1073
274 Ga0307412_10005759 3300031911 Bacteria 6969
275 Ga0307412_10019476 3300031911 Bacteria 4111
276 Ga0307409_100005874 3300031995 Bacteria 7128
277 Ga0307409_100024886 3300031995 Bacteria 4186
278 Ga0307409_100088026 3300031995 Bacteria 2534
279 Ga0307409_100129735 3300031995 Bacteria 2152
280 Ga0307409_100302499 3300031995 Bacteria 1488
281 Ga0307409_100332612 3300031995 Bacteria 1426
282 Ga0307409_100340741 3300031995 Bacteria 1410
283 Ga0307416_100015363 3300032002 Bacteria 5286
284 Ga0307416_100099715 3300032002 Bacteria 2523
285 Ga0307416_100102618 3300032002 Bacteria 2494
286 Ga0307416_100169437 3300032002 Bacteria 2030
287 Ga0307414_10009280 3300032004 Bacteria 5642
288 Ga0307414_10020094 3300032004 Bacteria 4154
289 Ga0307414_10028976 3300032004 Bacteria 3598
290 Ga0307414_10035389 3300032004 Bacteria 3323
291 Ga0307414_10073406 3300032004 Bacteria 2475
292 Ga0307414_10084731 3300032004 Bacteria 2332
293 Ga0307414_10130939 3300032004 Bacteria 1947
294 Ga0307414_10563343 3300032004 Bacteria 1017
295 Ga0307414_10609101 3300032004 Bacteria 980
296 Ga0307411_10000933 3300032005 Bacteria 11142
297 Ga0307411_10002464 3300032005 Bacteria 8196
298 Ga0307411_10010939 3300032005 Bacteria 4866
299 Ga0307411_10019711 3300032005 Bacteria 3903
300 Ga0307411_10054130 3300032005 Bacteria 2633
301 Ga0307411_10159203 3300032005 Bacteria 1688
302 Ga0307411_10178927 3300032005 Bacteria 1607
303 Ga0307415_100016635 3300032126 Bacteria 4389
304 Ga0307415_100262335 3300032126 Bacteria 1410
305 Ga0307415_100271511 3300032126 Bacteria 1389
306 Ga0307415_100287895 3300032126 Unclassified 1354
307 Ga0307415_100302688 3300032126 Bacteria 1325
308 Ga0307415_100342308 3300032126 Bacteria 1255
309 Ga0373943_0118668 3300035170 Bacteria 1404
310 Ga0373935_0020428 3300035692 Bacteria 4047
311 Ga0395899_0007876 3300037312 Bacteria 8212
312 Ga0395899_0016904 3300037312 Bacteria 5561
313 Ga0395899_0149601 3300037312 Bacteria 1655
314 Ga0395899_0185759 3300037312 Bacteria 1457
315 Ga0395900_0000993 3300037418 Bacteria 36883
316 Ga0395900_0001237 3300037418 Bacteria 31404
317 Ga0395900_0002997 3300037418 Bacteria 18375
318 Ga0395900_0005357 3300037418 Bacteria 13445
319 Ga0395900_0013905 3300037418 Bacteria 8212
320 Ga0395900_0041869 3300037418 Bacteria 4720
321 Ga0395900_0325774 3300037418 Bacteria 1515
322 Ga0395900_0525609 3300037418 Bacteria 1130
323 Ga0395898_0026382 3300037466 Bacteria 5846
324 Ga0395898_0128587 3300037466 Bacteria 2426
325 Ga0395905_0002237 3300037471 Bacteria 21801
326 Ga0395905_0002524 3300037471 Bacteria 20201
327 Ga0395905_0002679 3300037471 Bacteria 19517
328 Ga0395905_0005904 3300037471 Bacteria 12418
329 Ga0395905_0007956 3300037471 Bacteria 10482
330 Ga0395905_0014180 3300037471 Bacteria 7615
331 Ga0395905_0028923 3300037471 Bacteria 5224
332 Ga0395905_0031262 3300037471 Bacteria 5013
333 Ga0395905_0073779 3300037471 Bacteria 3199
334 Ga0395905_0094255 3300037471 Unclassified 2808
335 Ga0395905_0104779 3300037471 Bacteria 2655
336 Ga0395905_0109924 3300037471 Bacteria 2588
337 Ga0395905_0124370 3300037471 Bacteria 2425
338 Ga0395905_0507316 3300037471 Bacteria 1106
339 Ga0395901_0000369 3300038443 Bacteria 54034
340 Ga0395901_0008510 3300038443 Bacteria 10368
341 Ga0395901_0009083 3300038443 Bacteria 10062
342 Ga0395901_0044338 3300038443 Bacteria 4612
343 Ga0395901_0074685 3300038443 Bacteria 3536
344 Ga0395901_0207938 3300038443 Bacteria 2049
345 Ga0395901_0284437 3300038443 Bacteria 1717
346 Ga0395901_0501545 3300038443 Bacteria 1235
347 Ga0395901_0545528 3300038443 Bacteria 1175
348 Ga0439458_0000804 3300042157 Bacteria 8067
349 Ga0466972_0139645 3300044658 Bacteria 1140
350 Ga0466965_0153131 3300044683 Bacteria 1206
351 Ga0466966_0167407 3300044684 Bacteria 1336
352 Ga0466961_0038509 3300044693 Bacteria 3067
353 Ga0466963_0098330 3300044694 Bacteria 2000
354 Ga0466963_0171657 3300044694 Bacteria 1512
355 Ga0466960_0214913 3300044901 Bacteria 1056
356 Ga0466959_0083816 3300045049 Bacteria 2295
357 Ga0466959_0097860 3300045049 Bacteria 2102
358 Ga0466958_0049953 3300045836 Bacteria 2532
359 Ga0466958_0149008 3300045836 Bacteria 1475
360 Ga0466967_0031254 3300045976 Bacteria 4480
361 Ga0466967_0267035 3300045976 Bacteria 1638
362 Ga0495663_0034882 3300046525 Bacteria 1509
363 Ga0495598_0000877 3300046537 Bacteria 5802
364 Ga0495621_0000094 3300046539 Bacteria 18073
365 Ga0495621_0006943 3300046539 Bacteria 3331
366 Ga0495659_0035930 3300046664 Bacteria 1748
367 Ga0495669_0148266 3300046684 Bacteria 1110
368 Ga0495669_0164895 3300046684 Bacteria 1052
369 Ga0495670_0195037 3300046691 Bacteria 1071
370 Ga0496102_0047827 3300048905 Bacteria 3889
371 Ga0496104_0102738 3300048907 Bacteria 2738
372 Ga0496108_0010642 3300048911 Bacteria 7461
373 Ga0496108_0137105 3300048911 Bacteria 2106
374 Ga0496109_0131461 3300048912 Bacteria 2336
375 Ga0496110_0213972 3300048913 Bacteria 1752
376 Ga0496111_0029032 3300048914 Bacteria 3924
377 Ga0496111_0035996 3300048914 Bacteria 3539
378 Ga0496112_0299160 3300048915 Bacteria 1555
379 Ga0496113_0095348 3300048916 Bacteria 2299
380 Ga0496113_0205661 3300048916 Bacteria 1566
381 Ga0496114_0002576 3300048917 Bacteria 13855
382 Ga0501068_0048856 3300049584 Bacteria 2555
383 Ga0501249_011338 3300049679 Bacteria 1870
384 Ga0501221_032777 3300049704 Bacteria 1093
385 Ga0501268_005848 3300049765 Bacteria 1781
386 2896431958 2896429255 Bacteria 2557483
387 Ga0207703_10087097
388 JGI24740J21852_10003168
389 JGI24740J21852_10015586
390 JGI24744J21845_10001145
391 rootL2_10182658
392 Ga0065715_10096517
393 Ga0070658_10079751
394 Ga0070658_10322671
395 Ga0070658_10382642
396 Ga0070676_10006115
397 Ga0070683_100003508
398 Ga0070683_100066574
399 Ga0070683_100087365
400 Ga0070690_100007695
401 Ga0070670_100055479
402 Ga0070670_100110481
403 Ga0070677_10015979
404 Ga0070677_10031972
405 Ga0068869_100018329
406 Ga0068869_100058918
407 Ga0070666_10016352
408 Ga0070666_10021240
409 Ga0070666_10169443
410 Ga0070680_100005354
411 Ga0070680_100014198
412 Ga0070682_100131493
413 Ga0068868_100013844
414 Ga0068868_100024090
415 Ga0068868_100047823
416 Ga0070660_100199129
417 Ga0070661_100050375
418 Ga0070668_100002631
419 Ga0070669_100032611
420 Ga0070675_100035169
421 Ga0070671_100004138
422 Ga0070671_100055470
423 Ga0070671_100559696
424 Ga0070674_100002665
425 Ga0070674_100014969
426 Ga0070674_100031950
427 Ga0070674_100125904
428 Ga0070674_100221869
429 Ga0070673_100033723
430 Ga0070673_100094475
431 Ga0070673_100271605
432 Ga0070659_100024411
433 Ga0070659_100038380
434 Ga0070659_100087509
435 Ga0070659_100376693
436 Ga0070667_100001584
437 Ga0070667_100025928
438 Ga0070667_100081479
439 Ga0070667_100134412
440 Ga0070709_10102936
441 Ga0070714_100030803
442 Ga0070713_100039648
443 Ga0070663_100142790
444 Ga0070663_100218892
445 Ga0070663_100259543
446 Ga0070663_100425763
447 Ga0070678_100154275
448 Ga0070662_100016105
449 Ga0068867_100009725
450 Ga0068867_100020902
451 Ga0068867_100031620
452 Ga0070685_10052361
453 Ga0070679_100088260
454 Ga0070679_100387318
455 Ga0070684_100005655
456 Ga0068853_100039158
457 Ga0070672_100023221
458 Ga0070672_100091539
459 Ga0070672_100108834
460 Ga0070686_100020141
461 Ga0070665_100007242
462 Ga0068855_100086722
463 Ga0068855_100546108
464 Ga0070664_100029394
465 Ga0070664_100055917
466 Ga0068854_100056611
467 Ga0068854_100288358
468 Ga0068856_100100626
469 Ga0068852_100029606
470 Ga0068852_100042069
471 Ga0068852_100202697
472 Ga0068859_100004327
473 Ga0068859_100020238
474 Ga0068864_100078995
475 Ga0068861_100001972
476 Ga0068851_10017534
477 Ga0068863_100013758
478 Ga0068863_100397818
479 Ga0068858_100001945
480 Ga0068858_100428927
481 Ga0068858_100445407
482 Ga0068860_100061365
483 Ga0068860_100106583
484 Ga0068862_100025451
485 Ga0081539_10031650
486 Ga0070717_10085354
487 Ga0070716_100019524
488 Ga0070712_100010341
489 Ga0097621_100103672
490 Ga0068871_100024877
491 Ga0068865_100001452
492 Ga0068865_100012192
493 Ga0068865_100034129
494 Ga0068865_100159044
495 Ga0097620_100004327
496 Ga0097620_100020236
497 Ga0105240_10215419
498 Ga0111539_10716020
499 Ga0105243_10035390
500 Ga0105241_10059280
501 Ga0105242_10145088
502 Ga0105248_10002422
503 Ga0105248_10053470
504 Ga0105238_10027776
505 Ga0105249_10082934
506 Ga0157373_10048072
507 Ga0157373_10266742
508 Ga0157370_10006602
509 Ga0157370_10071096
510 Ga0157370_10118299
511 Ga0157370_10126733
512 Ga0157369_10319481
513 Ga0157369_10581463
514 Ga0157374_10016891
515 Ga0157378_10023065
516 Ga0163162_10026405
517 Ga0157372_10030441
518 Ga0163163_10096814
519 Ga0163163_10262739
520 Ga0157380_10004324
521 Ga0163161_10084885
522 Ga0206356_11011222
523 Ga0207682_10000662
524 Ga0207682_10062506
525 Ga0207688_10015012
526 Ga0207688_10178224
527 Ga0207680_10000361
528 Ga0207647_10005880
529 Ga0207647_10015643
530 Ga0207645_10008491
531 Ga0207645_10009510
532 Ga0207645_10068687
533 Ga0207705_10029468
534 Ga0207705_10207344
535 Ga0207707_10024850
536 Ga0207707_10316693
537 Ga0207695_10251479
538 Ga0207660_10039469
539 Ga0207657_10012981
540 Ga0207657_10213056
541 Ga0207649_10039249
542 Ga0207649_10043828
543 Ga0207649_10057014
544 Ga0207649_10198651
545 Ga0207652_10095054
546 Ga0207652_10288105
547 Ga0207681_10028762
548 Ga0207681_10097194
549 Ga0207681_10188823
550 Ga0207681_10194590
551 Ga0207694_10226428
552 Ga0207650_10003080
553 Ga0207650_10044057
554 Ga0207700_10281270
555 Ga0207664_10072650
556 Ga0207664_10094016
557 Ga0207664_10196588
558 Ga0207664_10284803
559 Ga0207644_10000153
560 Ga0207644_10007741
561 Ga0207644_10106491
562 Ga0207644_10273757
563 Ga0207690_10305796
564 Ga0207690_10352389
565 Ga0207706_10005385
566 Ga0207706_10026617
567 Ga0207706_10077098
568 Ga0207706_10227237
569 Ga0207686_10173363
570 Ga0207709_10303676
571 Ga0207670_10319219
572 Ga0207669_10017258
573 Ga0207669_10049692
574 Ga0207669_10341470
575 Ga0207704_10005375
576 Ga0207704_10006534
577 Ga0207691_10004092
578 Ga0207691_10006985
579 Ga0207691_10029187
580 Ga0207691_10053574
581 Ga0207691_10073014
582 Ga0207711_10008538
583 Ga0207711_10025359
584 Ga0207711_10037689
585 Ga0207711_10189265
586 Ga0207689_10027769
587 Ga0207689_10182614
588 Ga0207661_10020766
589 Ga0207679_10264727
590 Ga0207667_10036750
591 Ga0207667_10143205
592 Ga0207667_10178054
593 Ga0207667_10496281
594 Ga0207651_10003515
595 Ga0207651_10006360
596 Ga0207651_10137345
597 Ga0207651_10165659
598 Ga0207651_10195289
599 Ga0207668_10000080
600 Ga0207668_10011998
601 Ga0207640_10052913
602 Ga0207640_10215133
603 Ga0207640_10229977
604 Ga0207658_10001711
605 Ga0207658_10064464
606 Ga0207658_10157751
607 Ga0207677_10000733
608 Ga0207677_10005076
609 Ga0207677_10024228
610 Ga0207677_10146127
611 Ga0207703_10000515
612 Ga0207639_10040004
613 Ga0207678_10004875
614 Ga0207678_10022023
615 Ga0207678_10030510
616 Ga0207678_10189243
617 Ga0207678_10241044
618 Ga0207702_10034639
619 Ga0207702_10073253
620 Ga0207641_10010778
621 Ga0207648_10018279
622 Ga0207648_10018472
623 Ga0207648_10027475
624 Ga0207648_10029114
625 Ga0207675_100004420
626 Ga0207675_100097095
627 Ga0207675_100371991
628 Ga0207683_10003191
629 Ga0207683_10050417
630 Ga0207698_10058595
631 Ga0209974_10001618
632 Ga0268266_10005198
633 Ga0268266_10025254
634 Ga0268265_10006065
635 Ga0268265_10123815
636 Ga0268264_10157620
637 Ga0268264_10433140
638 Ga0316182_1066678
639 Ga0307408_100085318
640 Ga0307408_100156671
641 Ga0307408_100250225
642 Ga0307405_10213901
643 Ga0307413_10082620
644 Ga0307413_10128379
645 Ga0307413_10156050
646 Ga0307413_10166591
647 Ga0307410_10004534
648 Ga0307410_10011339
649 Ga0307410_10143328
650 Ga0307410_10204084
651 Ga0307410_10222736
652 Ga0307406_10007320
653 Ga0307406_10007763
654 Ga0307406_10324933
655 Ga0307407_10005436
656 Ga0307407_10040189
657 Ga0307407_10081531
658 Ga0307407_10187766
659 Ga0307407_10329968
660 Ga0307412_10005759
661 Ga0307412_10019476
662 Ga0307409_100005874
663 Ga0307409_100024886
664 Ga0307409_100088026
665 Ga0307409_100129735
666 Ga0307409_100302499
667 Ga0307409_100332612
668 Ga0307409_100340741
669 Ga0307416_100015363
670 Ga0307416_100099715
671 Ga0307416_100102618
672 Ga0307416_100169437
673 Ga0307414_10009280
674 Ga0307414_10020094
675 Ga0307414_10028976
676 Ga0307414_10035389
677 Ga0307414_10073406
678 Ga0307414_10084731
679 Ga0307414_10130939
680 Ga0307414_10563343
681 Ga0307414_10609101
682 Ga0307411_10000933
683 Ga0307411_10002464
684 Ga0307411_10010939
685 Ga0307411_10019711
686 Ga0307411_10054130
687 Ga0307411_10159203
688 Ga0307411_10178927
689 Ga0307415_100016635
690 Ga0307415_100262335
691 Ga0307415_100271511
692 Ga0307415_100287895
693 Ga0307415_100302688
694 Ga0307415_100342308
695 Ga0373943_0118668
696 Ga0373935_0020428
697 Ga0395899_0007876
698 Ga0395899_0016904
699 Ga0395899_0149601
700 Ga0395899_0185759
701 Ga0395900_0000993
702 Ga0395900_0001237
703 Ga0395900_0002997
704 Ga0395900_0005357
705 Ga0395900_0013905
706 Ga0395900_0041869
707 Ga0395900_0325774
708 Ga0395900_0525609
709 Ga0395898_0026382
710 Ga0395898_0128587
711 Ga0395905_0002237
712 Ga0395905_0002524
713 Ga0395905_0002679
714 Ga0395905_0005904
715 Ga0395905_0007956
716 Ga0395905_0014180
717 Ga0395905_0028923
718 Ga0395905_0031262
719 Ga0395905_0073779
720 Ga0395905_0094255
721 Ga0395905_0104779
722 Ga0395905_0109924
723 Ga0395905_0124370
724 Ga0395905_0507316
725 Ga0395901_0000369
726 Ga0395901_0008510
727 Ga0395901_0009083
728 Ga0395901_0044338
729 Ga0395901_0074685
730 Ga0395901_0207938
731 Ga0395901_0284437
732 Ga0395901_0501545
733 Ga0395901_0545528
734 Ga0439458_0000804
735 Ga0466972_0139645
736 Ga0466965_0153131
737 Ga0466966_0167407
738 Ga0466961_0038509
739 Ga0466963_0098330
740 Ga0466963_0171657
741 Ga0466960_0214913
742 Ga0466959_0083816
743 Ga0466959_0097860
744 Ga0466958_0049953
745 Ga0466958_0149008
746 Ga0466967_0031254
747 Ga0466967_0267035
748 Ga0495663_0034882
749 Ga0495598_0000877
750 Ga0495621_0000094
751 Ga0495621_0006943
752 Ga0495659_0035930
753 Ga0495669_0148266
754 Ga0495669_0164895
755 Ga0495670_0195037
756 Ga0496102_0047827
757 Ga0496104_0102738
758 Ga0496108_0010642
759 Ga0496108_0137105
760 Ga0496109_0131461
761 Ga0496110_0213972
762 Ga0496111_0029032
763 Ga0496111_0035996
764 Ga0496112_0299160
765 Ga0496113_0095348
766 Ga0496113_0205661
767 Ga0496114_0002576
768 Ga0501068_0048856
769 Ga0501249_011338
770 Ga0501221_032777
771 Ga0501268_005848
772 2896431958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

22

293

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1r-assembly1.cif.gz_D the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.9282 1 292
3m1r-assembly2.cif.gz_A the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.9236 1 292
3m1r-assembly1.cif.gz_D the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.9133 1 292
4mxr-assembly1.cif.gz_A crystal structure of trypanosoma cruzi formiminoglutamase with mn2+2 0.9096 5 293
4myl-assembly1.cif.gz_A crystal structure of trypanosoma cruzi formiminoglutamase (oxidized) at ph 4.6 0.9088 5 293
ID Description Score Start End Superfamily
3m1rA01 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.904 9 291 3.40.800.10
3m1rA01 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.892 9 291 3.40.800.10
1gq7A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8906 2 293 3.40.800.10
3pzlA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8767 13 292 3.40.800.10
1gq7A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8766 2 293 3.40.800.10
ID Description Score Start End GO Terms
AF-A0A6J4TQP2-F1-model_v4 Formimidoylglutamase 0.9965 165 293 GO:0016813
GO:0046872
AF-A0A7G9SIS4-F1-model_v4 Arginase family protein 0.9846 1 293 GO:0008783
GO:0033389
GO:0046872
AF-A0A7G9SIS4-F1-model_v4 Arginase family protein 0.9812 1 293 GO:0008783
GO:0033389
GO:0046872
AF-A0A6J4TQP2-F1-model_v4 Formimidoylglutamase 0.9739 165 293 GO:0016813
GO:0046872
AF-A0A0B0HNV2-F1-model_v4 deleted 0.9608 163 293

Map