F430530

General Info

Members Datasets Scaffolds Average Seq Length
386 217 772 64

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10175522|Ga0207646_101755222
Length 67
Sequence MKASIGDELTVKGRHQGDQDRHGAIIEVRRDDGNPPYLVRWTDGHETVFFPSADTIVQHHRRQTARK

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
92 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
115 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.52
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.25
Nodule 0.26
Rhizoplane 16.32
Rhizosphere 75.65
Stem 0
Stem Tuber 0
Unclassified 17.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10175522 3300025922 Bacteria 1935
2 Ga0070658_11345363 3300005327 Unclassified 620
3 Ga0070683_100082088 3300005329 Bacteria 3018
4 Ga0070682_100113341 3300005337 Bacteria 1811
5 Ga0070660_100067706 3300005339 Bacteria 2782
6 Ga0070661_100967510 3300005344 Bacteria 705
7 Ga0070668_100505171 3300005347 Bacteria 1047
8 Ga0070659_101329297 3300005366 Bacteria 638
9 Ga0070667_100001478 3300005367 Bacteria 21095
10 Ga0070713_100221835 3300005436 Bacteria 1715
11 Ga0070701_11156103 3300005438 Bacteria 547
12 Ga0070700_100158234 3300005441 Bacteria 1557
13 Ga0070663_100848232 3300005455 Bacteria 786
14 Ga0070662_101481775 3300005457 Bacteria 585
15 Ga0070685_10577309 3300005466 Bacteria 806
16 Ga0070685_10900650 3300005466 Bacteria 658
17 Ga0070706_100032649 3300005467 Bacteria 4802
18 Ga0070707_100206206 3300005468 Bacteria 1916
19 Ga0070679_102185509 3300005530 Bacteria 503
20 Ga0070686_100971537 3300005544 Bacteria 695
21 Ga0070696_102020319 3300005546 Unclassified 501
22 Ga0068855_101278979 3300005563 Bacteria 760
23 Ga0070664_102367081 3300005564 Bacteria 504
24 Ga0070702_100399323 3300005615 Bacteria 983
25 Ga0070702_100479241 3300005615 Bacteria 909
26 Ga0070702_100652265 3300005615 Bacteria 796
27 Ga0068864_101422528 3300005618 Bacteria 695
28 Ga0068864_101676904 3300005618 Bacteria 640
29 Ga0068864_101920665 3300005618 Unclassified 598
30 Ga0068866_10739790 3300005718 Bacteria 678
31 Ga0068861_100615236 3300005719 Bacteria 999
32 Ga0068870_10878756 3300005840 Bacteria 632
33 Ga0068860_102659466 3300005843 Unclassified 519
34 Ga0081455_10716525 3300005937 Bacteria 636
35 Ga0075365_10026898 3300006038 Bacteria 3655
36 Ga0075365_10232346 3300006038 Bacteria 1295
37 Ga0075365_10541706 3300006038 Bacteria 823
38 Ga0075365_11133079 3300006038 Bacteria 551
39 Ga0075368_10309935 3300006042 Bacteria 682
40 Ga0075363_100001299 3300006048 Bacteria 9316
41 Ga0075363_100147897 3300006048 Bacteria 1325
42 Ga0075363_100352026 3300006048 Bacteria 860
43 Ga0075363_100582689 3300006048 Bacteria 669
44 Ga0075364_10253946 3300006051 Bacteria 1195
45 Ga0075364_10695850 3300006051 Bacteria 694
46 Ga0070715_10016574 3300006163 Bacteria 2771
47 Ga0070716_100131982 3300006173 Bacteria 1580
48 Ga0070712_100325073 3300006175 Bacteria 1252
49 Ga0075362_10684220 3300006177 Bacteria 534
50 Ga0075367_10005907 3300006178 Bacteria 6139
51 Ga0075367_10114036 3300006178 Bacteria 1661
52 Ga0075367_10322881 3300006178 Bacteria 973
53 Ga0075428_102004428 3300006844 Bacteria 600
54 Ga0075433_10493411 3300006852 Bacteria 1078
55 Ga0111539_10141100 3300009094 Bacteria 2820
56 Ga0111539_10828748 3300009094 Bacteria 1076
57 Ga0111539_12008641 3300009094 Unclassified 671
58 Ga0111539_12273028 3300009094 Bacteria 629
59 Ga0105245_10149901 3300009098 Bacteria 2204
60 Ga0105245_11072865 3300009098 Bacteria 851
61 Ga0105245_11321570 3300009098 Bacteria 770
62 Ga0105245_12460508 3300009098 Unclassified 574
63 Ga0105247_10811520 3300009101 Bacteria 715
64 Ga0114129_11552752 3300009147 Bacteria 812
65 Ga0105243_10238489 3300009148 Bacteria 1617
66 Ga0105243_10886951 3300009148 Bacteria 886
67 Ga0105243_10908302 3300009148 Bacteria 876
68 Ga0105243_11962492 3300009148 Bacteria 619
69 Ga0105243_12360680 3300009148 Bacteria 570
70 Ga0105241_11538560 3300009174 Bacteria 641
71 Ga0105242_11104201 3300009176 Bacteria 807
72 Ga0105248_11259881 3300009177 Unclassified 836
73 Ga0105237_10172985 3300009545 Bacteria 2160
74 Ga0105237_10877488 3300009545 Bacteria 904
75 Ga0105238_10954488 3300009551 Unclassified 877
76 Ga0105238_12228148 3300009551 Unclassified 583
77 Ga0105249_10258117 3300009553 Bacteria 1730
78 Ga0105249_12670928 3300009553 Bacteria 571
79 Ga0105249_13533514 3300009553 Unclassified 503
80 Ga0105246_10639612 3300011119 Bacteria 924
81 Ga0105246_11082174 3300011119 Unclassified 731
82 Ga0105246_11597260 3300011119 Bacteria 616
83 Ga0105246_11801905 3300011119 Bacteria 585
84 Ga0157371_10700945 3300013102 Bacteria 758
85 Ga0157369_10482213 3300013105 Bacteria 1283
86 Ga0157374_11506472 3300013296 Bacteria 696
87 Ga0157372_10844113 3300013307 Unclassified 1063
88 Ga0157372_11163955 3300013307 Unclassified 892
89 Ga0157372_12653403 3300013307 Unclassified 575
90 Ga0157372_12863650 3300013307 Unclassified 553
91 Ga0157375_10643179 3300013308 Bacteria 1217
92 Ga0157375_11260592 3300013308 Bacteria 868
93 Ga0157375_13119886 3300013308 Bacteria 553
94 Ga0163163_10636461 3300014325 Bacteria 1130
95 Ga0163163_10754471 3300014325 Bacteria 1036
96 Ga0163163_11216709 3300014325 Bacteria 816
97 Ga0163163_11273786 3300014325 Bacteria 797
98 Ga0163163_12195937 3300014325 Bacteria 611
99 Ga0157380_10525061 3300014326 Bacteria 1155
100 Ga0157380_11223922 3300014326 Bacteria 795
101 Ga0157380_12640108 3300014326 Unclassified 569
102 Ga0157377_10408410 3300014745 Bacteria 927
103 Ga0157379_10384128 3300014968 Unclassified 1289
104 Ga0157376_12615451 3300014969 Bacteria 544
105 Ga0163161_10179860 3300017792 Bacteria 1621
106 Ga0163161_11598074 3300017792 Bacteria 575
107 Ga0206353_11728487 3300020082 Bacteria 948
108 Ga0224712_10499428 3300022467 Bacteria 588
109 Ga0207688_10311339 3300025901 Bacteria 964
110 Ga0207688_10806462 3300025901 Bacteria 595
111 Ga0207685_10005392 3300025905 Bacteria 3372
112 Ga0207705_10055567 3300025909 Bacteria 2854
113 Ga0207684_10121185 3300025910 Bacteria 2242
114 Ga0207671_10173971 3300025914 Bacteria 1673
115 Ga0207693_10046293 3300025915 Bacteria 3417
116 Ga0207693_10308556 3300025915 Bacteria 1239
117 Ga0207693_11024289 3300025915 Bacteria 629
118 Ga0207657_10044551 3300025919 Bacteria 3899
119 Ga0207694_11511032 3300025924 Unclassified 567
120 Ga0207687_10239423 3300025927 Bacteria 1437
121 Ga0207687_10346060 3300025927 Bacteria 1210
122 Ga0207687_11880929 3300025927 Unclassified 512
123 Ga0207700_10371069 3300025928 Bacteria 1249
124 Ga0207690_10909907 3300025932 Bacteria 730
125 Ga0207706_10756069 3300025933 Bacteria 828
126 Ga0207709_10575688 3300025935 Bacteria 889
127 Ga0207709_11004034 3300025935 Bacteria 682
128 Ga0207709_11442316 3300025935 Bacteria 570
129 Ga0207709_11736468 3300025935 Bacteria 519
130 Ga0207665_10097963 3300025939 Bacteria 2042
131 Ga0207661_10089111 3300025944 Bacteria 2566
132 Ga0207651_12070665 3300025960 Unclassified 511
133 Ga0207658_10140539 3300025986 Bacteria 1953
134 Ga0207677_11367347 3300026023 Unclassified 652
135 Ga0207703_11789609 3300026035 Bacteria 590
136 Ga0207678_10261378 3300026067 Bacteria 1483
137 Ga0207678_10702578 3300026067 Bacteria 890
138 Ga0207708_10034284 3300026075 Bacteria 3861
139 Ga0207702_10244027 3300026078 Unclassified 1684
140 Ga0207675_100447076 3300026118 Bacteria 1280
141 Ga0207675_101865340 3300026118 Bacteria 620
142 Ga0207683_10432075 3300026121 Bacteria 1213
143 Ga0207428_10576853 3300027907 Bacteria 812
144 Ga0314311_1171031 3300030733 Bacteria 510
145 Ga0316181_1172031 3300030744 Bacteria 929
146 Ga0307413_10366873 3300031824 Bacteria 1117
147 Ga0307413_11002001 3300031824 Bacteria 716
148 Ga0307410_10471925 3300031852 Unclassified 1028
149 Ga0307410_10592096 3300031852 Bacteria 924
150 Ga0307409_100382394 3300031995 Bacteria 1339
151 Ga0307409_100454595 3300031995 Bacteria 1237
152 Ga0307409_101045575 3300031995 Bacteria 836
153 Ga0307409_102956255 3300031995 Bacteria 502
154 Ga0307416_101172298 3300032002 Bacteria 874
155 Ga0307414_10688297 3300032004 Bacteria 925
156 Ga0307411_10439157 3300032005 Bacteria 1089
157 Ga0307411_11364938 3300032005 Bacteria 648
158 Ga0373938_0035951 3300034957 Bacteria 1082
159 Ga0373940_0243502 3300035088 Bacteria 604
160 Ga0373936_0403735 3300035113 Bacteria 628
161 Ga0373945_0077054 3300035116 Unclassified 1272
162 Ga0373957_0510627 3300035120 Unclassified 524
163 Ga0373943_0659228 3300035170 Unclassified 619
164 Ga0373946_0298453 3300035171 Unclassified 796
165 Ga0373927_0229179 3300035695 Bacteria 1221
166 Ga0373937_0342736 3300036401 Bacteria 1415
167 Ga0373925_0925016 3300037068 Bacteria 718
168 Ga0395900_0304466 3300037418 Bacteria 1579
169 Ga0395898_0129041 3300037466 Bacteria 2422
170 Ga0395905_0090038 3300037471 Bacteria 2876
171 Ga0395905_1594934 3300037471 Bacteria 557
172 Ga0395901_0063289 3300038443 Bacteria 3850
173 Ga0395901_1034344 3300038443 Bacteria 795
174 Ga0451791_0658588 3300041451 Bacteria 1824
175 Ga0451797_0167461 3300041453 Unclassified 796
176 Ga0451800_1081515 3300041459 Bacteria 547
177 Ga0451802_0603043 3300041460 Bacteria 555
178 Ga0451837_0605745 3300041494 Bacteria 965
179 Ga0451853_1392166 3300041512 Bacteria 650
180 Ga0466972_0082288 3300044658 Bacteria 1532
181 Ga0466965_0026476 3300044683 Bacteria 2811
182 Ga0466965_0131495 3300044683 Bacteria 1298
183 Ga0466966_0295754 3300044684 Bacteria 973
184 Ga0466961_0113514 3300044693 Bacteria 1703
185 Ga0466963_0472627 3300044694 Bacteria 885
186 Ga0466963_0782620 3300044694 Bacteria 673
187 Ga0466964_0068424 3300044706 Bacteria 1495
188 Ga0466968_0297974 3300044735 Bacteria 775
189 Ga0466970_0009108 3300044765 Bacteria 5009
190 Ga0466970_0033224 3300044765 Bacteria 2727
191 Ga0466970_0534314 3300044765 Bacteria 677
192 Ga0466970_0833790 3300044765 Bacteria 541
193 Ga0466957_0096248 3300044842 Bacteria 1860
194 Ga0466960_0012227 3300044901 Bacteria 3617
195 Ga0466960_0015447 3300044901 Bacteria 3291
196 Ga0466960_0093831 3300044901 Bacteria 1534
197 Ga0466967_0091617 3300045976 Bacteria 2763
198 Ga0495592_0199032 3300046454 Bacteria 1353
199 Ga0495603_0093411 3300046455 Bacteria 1758
200 Ga0495629_0208498 3300046459 Bacteria 1350
201 Ga0495651_0500465 3300046462 Bacteria 778
202 Ga0495582_0437774 3300046473 Bacteria 755
203 Ga0495639_0720727 3300046475 Unclassified 516
204 Ga0495662_0236793 3300046476 Bacteria 900
205 Ga0495618_0204860 3300046514 Bacteria 1248
206 Ga0495618_0239953 3300046514 Bacteria 1140
207 Ga0495620_0034665 3300046515 Bacteria 2278
208 Ga0495628_0489745 3300046516 Unclassified 889
209 Ga0495630_0711973 3300046517 Unclassified 768
210 Ga0495630_1487697 3300046517 Bacteria 508
211 Ga0495652_0217625 3300046529 Bacteria 1437
212 Ga0495652_0479364 3300046529 Bacteria 866
213 Ga0495652_0573049 3300046529 Unclassified 773
214 Ga0495640_0685761 3300046533 Bacteria 615
215 Ga0495645_0296558 3300046543 Unclassified 1058
216 Ga0495667_0081542 3300046559 Unclassified 2102
217 Ga0495635_0140060 3300046663 Bacteria 1648
218 Ga0495635_0238907 3300046663 Bacteria 1226
219 Ga0495635_0367879 3300046663 Unclassified 958
220 Ga0495635_0774160 3300046663 Archaea 619
221 Ga0495588_0687033 3300046674 Bacteria 535
222 Ga0495599_0195120 3300046678 Bacteria 1245
223 Ga0495599_0551316 3300046678 Unclassified 675
224 Ga0495646_0548089 3300046680 Unclassified 591
225 Ga0495613_0093944 3300046689 Bacteria 2171
226 Ga0495624_0068605 3300046690 Bacteria 2210
227 Ga0495600_0374764 3300046809 Bacteria 889
228 Ga0495581_0762165 3300047315 Bacteria 556
229 Ga0495604_0202605 3300047317 Bacteria 1376
230 Ga0495674_0383528 3300047319 Unclassified 1137
231 Ga0495676_0634479 3300047321 Unclassified 694
232 Ga0495676_0946068 3300047321 Bacteria 551
233 Ga0495680_0184909 3300047322 Bacteria 1502
234 Ga0495680_0337456 3300047322 Unclassified 1052
235 Ga0495675_0204852 3300047444 Bacteria 1200
236 Ga0495684_0179427 3300047471 Bacteria 1570
237 Ga0495684_0342222 3300047471 Bacteria 1064
238 Ga0495602_0184652 3300048088 Bacteria 1605
239 Ga0496100_0067318 3300048903 Bacteria 2378
240 Ga0496100_0067456 3300048903 Bacteria 2376
241 Ga0496100_0472946 3300048903 Bacteria 963
242 Ga0496101_0022354 3300048904 Bacteria 4353
243 Ga0496101_0058177 3300048904 Bacteria 2798
244 Ga0496101_1351187 3300048904 Unclassified 556
245 Ga0496102_0024072 3300048905 Bacteria 5412
246 Ga0496102_0478686 3300048905 Bacteria 1166
247 Ga0496102_1369521 3300048905 Bacteria 627
248 Ga0496103_0105683 3300048906 Bacteria 1785
249 Ga0496103_0640553 3300048906 Bacteria 676
250 Ga0496104_0001715 3300048907 Bacteria 18910
251 Ga0496104_0130546 3300048907 Bacteria 2413
252 Ga0496104_0279727 3300048907 Unclassified 1582
253 Ga0496105_0001812 3300048908 Bacteria 15289
254 Ga0496105_0028749 3300048908 Bacteria 4548
255 Ga0496105_0909054 3300048908 Bacteria 663
256 Ga0496106_0025757 3300048909 Bacteria 4377
257 Ga0496106_0235582 3300048909 Bacteria 1462
258 Ga0496107_0096772 3300048910 Bacteria 2160
259 Ga0496107_0311438 3300048910 Unclassified 1172
260 Ga0496107_1136157 3300048910 Bacteria 563
261 Ga0496108_0198331 3300048911 Bacteria 1741
262 Ga0496108_0248417 3300048911 Bacteria 1547
263 Ga0496108_0305791 3300048911 Unclassified 1385
264 Ga0496108_0478090 3300048911 Bacteria 1089
265 Ga0496108_0734338 3300048911 Bacteria 855
266 Ga0496108_1743319 3300048911 Unclassified 511
267 Ga0496109_0059048 3300048912 Bacteria 3504
268 Ga0496109_0085499 3300048912 Bacteria 2911
269 Ga0496109_0186207 3300048912 Bacteria 1950
270 Ga0496109_0490779 3300048912 Bacteria 1159
271 Ga0496109_0933767 3300048912 Unclassified 805
272 Ga0496109_1773387 3300048912 Bacteria 550
273 Ga0496110_0134348 3300048913 Bacteria 2235
274 Ga0496110_0259260 3300048913 Bacteria 1582
275 Ga0496110_0261964 3300048913 Bacteria 1574
276 Ga0496110_0344011 3300048913 Bacteria 1358
277 Ga0496110_1839346 3300048913 Unclassified 516
278 Ga0496111_0098118 3300048914 Bacteria 2151
279 Ga0496111_0278375 3300048914 Bacteria 1241
280 Ga0496111_0735115 3300048914 Unclassified 716
281 Ga0496111_0999249 3300048914 Bacteria 599
282 Ga0496112_0603722 3300048915 Bacteria 1029
283 Ga0496112_0643312 3300048915 Bacteria 990
284 Ga0496112_1570607 3300048915 Bacteria 571
285 Ga0496113_0073690 3300048916 Bacteria 2602
286 Ga0496113_1166098 3300048916 Unclassified 602
287 Ga0496114_0017457 3300048917 Bacteria 5791
288 Ga0496114_0019288 3300048917 Bacteria 5524
289 Ga0496114_0021306 3300048917 Bacteria 5272
290 Ga0496114_0100126 3300048917 Bacteria 2473
291 Ga0496114_0205389 3300048917 Bacteria 1727
292 Ga0496114_0707423 3300048917 Unclassified 883
293 Ga0496114_1427913 3300048917 Bacteria 579
294 Ga0496114_1487357 3300048917 Unclassified 565
295 Ga0496114_1718286 3300048917 Bacteria 516
296 Ga0496115_0080652 3300048918 Bacteria 2650
297 Ga0496115_0105336 3300048918 Bacteria 2314
298 Ga0501031_0147211 3300049568 Bacteria 1539
299 Ga0501031_0492859 3300049568 Bacteria 790
300 Ga0501031_0657178 3300049568 Bacteria 674
301 Ga0501032_1072141 3300049569 Bacteria 505
302 Ga0501033_0623400 3300049570 Unclassified 738
303 Ga0501036_0041697 3300049572 Bacteria 3884
304 Ga0501037_0846713 3300049573 Bacteria 602
305 Ga0501039_0061870 3300049575 Bacteria 2900
306 Ga0501039_0511019 3300049575 Unclassified 943
307 Ga0501039_1236231 3300049575 Unclassified 577
308 Ga0501040_0390847 3300049576 Bacteria 998
309 Ga0501041_0038196 3300049577 Bacteria 2911
310 Ga0501041_0913323 3300049577 Bacteria 564
311 Ga0501042_0036176 3300049578 Bacteria 3503
312 Ga0501042_0290951 3300049578 Unclassified 1180
313 Ga0501042_1148282 3300049578 Bacteria 566
314 Ga0501042_1230760 3300049578 Bacteria 546
315 Ga0501046_1032913 3300049580 Bacteria 570
316 Ga0501046_1162790 3300049580 Bacteria 531
317 Ga0501048_0524620 3300049582 Unclassified 849
318 Ga0501048_1296967 3300049582 Unclassified 523
319 Ga0501048_1336276 3300049582 Bacteria 515
320 Ga0501067_0058902 3300049583 Bacteria 2126
321 Ga0501067_0060767 3300049583 Bacteria 2091
322 Ga0501067_0451989 3300049583 Bacteria 718
323 Ga0501067_0558683 3300049583 Bacteria 641
324 Ga0501068_0041201 3300049584 Bacteria 2775
325 Ga0501068_0087400 3300049584 Bacteria 1920
326 Ga0501068_0131789 3300049584 Bacteria 1563
327 Ga0501068_0577433 3300049584 Bacteria 732
328 Ga0501069_0008648 3300049585 Bacteria 5361
329 Ga0501069_1036019 3300049585 Bacteria 502
330 Ga0501070_0158680 3300049586 Bacteria 1865
331 Ga0501071_0309932 3300049587 Bacteria 1197
332 Ga0501071_0597576 3300049587 Bacteria 848
333 Ga0501072_0284471 3300049588 Bacteria 1315
334 Ga0501072_0450402 3300049588 Unclassified 1019
335 Ga0501072_0533100 3300049588 Bacteria 928
336 Ga0501074_0208519 3300049590 Bacteria 1392
337 Ga0501074_0712279 3300049590 Bacteria 708
338 Ga0501075_0842384 3300049591 Bacteria 698
339 Ga0501075_0897209 3300049591 Bacteria 674
340 Ga0501076_0240108 3300049592 Bacteria 1482
341 Ga0501076_0623254 3300049592 Unclassified 890
342 Ga0501076_0925025 3300049592 Unclassified 719
343 Ga0501076_1002757 3300049592 Bacteria 688
344 Ga0501077_0270325 3300049593 Unclassified 1081
345 Ga0501077_0471783 3300049593 Bacteria 804
346 Ga0501079_0171314 3300049741 Bacteria 1693
347 Ga0501079_0199424 3300049741 Bacteria 1563
348 Ga0501079_0677289 3300049741 Bacteria 812
349 Ga0501080_0756326 3300049742 Bacteria 854
350 Ga0501081_0068944 3300049743 Bacteria 2463
351 Ga0501081_0475034 3300049743 Unclassified 930
352 Ga0501035_0762039 3300049822 Bacteria 776
353 Ga0501045_0040590 3300049824 Bacteria 3385
354 Ga0501045_0323850 3300049824 Bacteria 1147
355 Ga0501045_0446967 3300049824 Unclassified 961
356 Ga0501045_0471146 3300049824 Bacteria 933
357 nmdc:mga03683_23530_c1 3300050489 Bacteria 2400
358 nmdc:mga03n38_413211_c1 3300050490 Bacteria 745
359 nmdc:mga03n38_434813_c1 3300050490 Bacteria 728
360 nmdc:mga03n38_762671_c1 3300050490 Bacteria 561
361 nmdc:mga00v17_321098_c1 3300050491 Bacteria 1006
362 nmdc:mga00v17_589723_c1 3300050491 Bacteria 717
363 nmdc:mga0yw44_347001_c1 3300050492 Bacteria 999
364 nmdc:mga0yw44_366897_c1 3300050492 Bacteria 971
365 nmdc:mga0yw44_66135_c1 3300050492 Bacteria 2230
366 nmdc:mga06z11_109498_c1 3300050494 Bacteria 1528
367 nmdc:mga06z11_44280_c1 3300050494 Bacteria 2244
368 nmdc:mga06z11_72983_c1 3300050494 Bacteria 1821
369 nmdc:mga04h51_245807_c1 3300050495 Bacteria 716
370 nmdc:mga08y16_323562_c1 3300050511 Bacteria 1587
371 nmdc:mga08y16_494784_c1 3300050511 Bacteria 1243
372 Ga0495612_0023632 3300053078 Bacteria 2467
373 Ga0495619_0737138 3300053085 Bacteria 669
374 Ga0495619_0793734 3300053085 Unclassified 641
375 Ga0501084_0063210 3300054114 Bacteria 3099
376 Ga0501084_0068084 3300054114 Unclassified 2981
377 Ga0501084_0747165 3300054114 Bacteria 824
378 Ga0590071_112151 3300059421 Unclassified 692
379 Ga0590075_052133 3300059424 Bacteria 1050
380 Ga0501082_0637756 3300060353 Unclassified 932
381 Ga0501082_0952923 3300060353 Bacteria 750
382 Ga0466962_0297551 3300061719 Bacteria 798
383 Ga0530510_0008307 3300061734 Bacteria 7240
384 Ga0530510_0207033 3300061734 Bacteria 1457
385 Ga0530510_0862847 3300061734 Bacteria 691
386 8054610023 8054609563 Bacteria 5170090
387 Ga0207646_10175522
388 Ga0070658_11345363
389 Ga0070683_100082088
390 Ga0070682_100113341
391 Ga0070660_100067706
392 Ga0070661_100967510
393 Ga0070668_100505171
394 Ga0070659_101329297
395 Ga0070667_100001478
396 Ga0070713_100221835
397 Ga0070701_11156103
398 Ga0070700_100158234
399 Ga0070663_100848232
400 Ga0070662_101481775
401 Ga0070685_10577309
402 Ga0070685_10900650
403 Ga0070706_100032649
404 Ga0070707_100206206
405 Ga0070679_102185509
406 Ga0070686_100971537
407 Ga0070696_102020319
408 Ga0068855_101278979
409 Ga0070664_102367081
410 Ga0070702_100399323
411 Ga0070702_100479241
412 Ga0070702_100652265
413 Ga0068864_101422528
414 Ga0068864_101676904
415 Ga0068864_101920665
416 Ga0068866_10739790
417 Ga0068861_100615236
418 Ga0068870_10878756
419 Ga0068860_102659466
420 Ga0081455_10716525
421 Ga0075365_10026898
422 Ga0075365_10232346
423 Ga0075365_10541706
424 Ga0075365_11133079
425 Ga0075368_10309935
426 Ga0075363_100001299
427 Ga0075363_100147897
428 Ga0075363_100352026
429 Ga0075363_100582689
430 Ga0075364_10253946
431 Ga0075364_10695850
432 Ga0070715_10016574
433 Ga0070716_100131982
434 Ga0070712_100325073
435 Ga0075362_10684220
436 Ga0075367_10005907
437 Ga0075367_10114036
438 Ga0075367_10322881
439 Ga0075428_102004428
440 Ga0075433_10493411
441 Ga0111539_10141100
442 Ga0111539_10828748
443 Ga0111539_12008641
444 Ga0111539_12273028
445 Ga0105245_10149901
446 Ga0105245_11072865
447 Ga0105245_11321570
448 Ga0105245_12460508
449 Ga0105247_10811520
450 Ga0114129_11552752
451 Ga0105243_10238489
452 Ga0105243_10886951
453 Ga0105243_10908302
454 Ga0105243_11962492
455 Ga0105243_12360680
456 Ga0105241_11538560
457 Ga0105242_11104201
458 Ga0105248_11259881
459 Ga0105237_10172985
460 Ga0105237_10877488
461 Ga0105238_10954488
462 Ga0105238_12228148
463 Ga0105249_10258117
464 Ga0105249_12670928
465 Ga0105249_13533514
466 Ga0105246_10639612
467 Ga0105246_11082174
468 Ga0105246_11597260
469 Ga0105246_11801905
470 Ga0157371_10700945
471 Ga0157369_10482213
472 Ga0157374_11506472
473 Ga0157372_10844113
474 Ga0157372_11163955
475 Ga0157372_12653403
476 Ga0157372_12863650
477 Ga0157375_10643179
478 Ga0157375_11260592
479 Ga0157375_13119886
480 Ga0163163_10636461
481 Ga0163163_10754471
482 Ga0163163_11216709
483 Ga0163163_11273786
484 Ga0163163_12195937
485 Ga0157380_10525061
486 Ga0157380_11223922
487 Ga0157380_12640108
488 Ga0157377_10408410
489 Ga0157379_10384128
490 Ga0157376_12615451
491 Ga0163161_10179860
492 Ga0163161_11598074
493 Ga0206353_11728487
494 Ga0224712_10499428
495 Ga0207688_10311339
496 Ga0207688_10806462
497 Ga0207685_10005392
498 Ga0207705_10055567
499 Ga0207684_10121185
500 Ga0207671_10173971
501 Ga0207693_10046293
502 Ga0207693_10308556
503 Ga0207693_11024289
504 Ga0207657_10044551
505 Ga0207694_11511032
506 Ga0207687_10239423
507 Ga0207687_10346060
508 Ga0207687_11880929
509 Ga0207700_10371069
510 Ga0207690_10909907
511 Ga0207706_10756069
512 Ga0207709_10575688
513 Ga0207709_11004034
514 Ga0207709_11442316
515 Ga0207709_11736468
516 Ga0207665_10097963
517 Ga0207661_10089111
518 Ga0207651_12070665
519 Ga0207658_10140539
520 Ga0207677_11367347
521 Ga0207703_11789609
522 Ga0207678_10261378
523 Ga0207678_10702578
524 Ga0207708_10034284
525 Ga0207702_10244027
526 Ga0207675_100447076
527 Ga0207675_101865340
528 Ga0207683_10432075
529 Ga0207428_10576853
530 Ga0314311_1171031
531 Ga0316181_1172031
532 Ga0307413_10366873
533 Ga0307413_11002001
534 Ga0307410_10471925
535 Ga0307410_10592096
536 Ga0307409_100382394
537 Ga0307409_100454595
538 Ga0307409_101045575
539 Ga0307409_102956255
540 Ga0307416_101172298
541 Ga0307414_10688297
542 Ga0307411_10439157
543 Ga0307411_11364938
544 Ga0373938_0035951
545 Ga0373940_0243502
546 Ga0373936_0403735
547 Ga0373945_0077054
548 Ga0373957_0510627
549 Ga0373943_0659228
550 Ga0373946_0298453
551 Ga0373927_0229179
552 Ga0373937_0342736
553 Ga0373925_0925016
554 Ga0395900_0304466
555 Ga0395898_0129041
556 Ga0395905_0090038
557 Ga0395905_1594934
558 Ga0395901_0063289
559 Ga0395901_1034344
560 Ga0451791_0658588
561 Ga0451797_0167461
562 Ga0451800_1081515
563 Ga0451802_0603043
564 Ga0451837_0605745
565 Ga0451853_1392166
566 Ga0466972_0082288
567 Ga0466965_0026476
568 Ga0466965_0131495
569 Ga0466966_0295754
570 Ga0466961_0113514
571 Ga0466963_0472627
572 Ga0466963_0782620
573 Ga0466964_0068424
574 Ga0466968_0297974
575 Ga0466970_0009108
576 Ga0466970_0033224
577 Ga0466970_0534314
578 Ga0466970_0833790
579 Ga0466957_0096248
580 Ga0466960_0012227
581 Ga0466960_0015447
582 Ga0466960_0093831
583 Ga0466967_0091617
584 Ga0495592_0199032
585 Ga0495603_0093411
586 Ga0495629_0208498
587 Ga0495651_0500465
588 Ga0495582_0437774
589 Ga0495639_0720727
590 Ga0495662_0236793
591 Ga0495618_0204860
592 Ga0495618_0239953
593 Ga0495620_0034665
594 Ga0495628_0489745
595 Ga0495630_0711973
596 Ga0495630_1487697
597 Ga0495652_0217625
598 Ga0495652_0479364
599 Ga0495652_0573049
600 Ga0495640_0685761
601 Ga0495645_0296558
602 Ga0495667_0081542
603 Ga0495635_0140060
604 Ga0495635_0238907
605 Ga0495635_0367879
606 Ga0495635_0774160
607 Ga0495588_0687033
608 Ga0495599_0195120
609 Ga0495599_0551316
610 Ga0495646_0548089
611 Ga0495613_0093944
612 Ga0495624_0068605
613 Ga0495600_0374764
614 Ga0495581_0762165
615 Ga0495604_0202605
616 Ga0495674_0383528
617 Ga0495676_0634479
618 Ga0495676_0946068
619 Ga0495680_0184909
620 Ga0495680_0337456
621 Ga0495675_0204852
622 Ga0495684_0179427
623 Ga0495684_0342222
624 Ga0495602_0184652
625 Ga0496100_0067318
626 Ga0496100_0067456
627 Ga0496100_0472946
628 Ga0496101_0022354
629 Ga0496101_0058177
630 Ga0496101_1351187
631 Ga0496102_0024072
632 Ga0496102_0478686
633 Ga0496102_1369521
634 Ga0496103_0105683
635 Ga0496103_0640553
636 Ga0496104_0001715
637 Ga0496104_0130546
638 Ga0496104_0279727
639 Ga0496105_0001812
640 Ga0496105_0028749
641 Ga0496105_0909054
642 Ga0496106_0025757
643 Ga0496106_0235582
644 Ga0496107_0096772
645 Ga0496107_0311438
646 Ga0496107_1136157
647 Ga0496108_0198331
648 Ga0496108_0248417
649 Ga0496108_0305791
650 Ga0496108_0478090
651 Ga0496108_0734338
652 Ga0496108_1743319
653 Ga0496109_0059048
654 Ga0496109_0085499
655 Ga0496109_0186207
656 Ga0496109_0490779
657 Ga0496109_0933767
658 Ga0496109_1773387
659 Ga0496110_0134348
660 Ga0496110_0259260
661 Ga0496110_0261964
662 Ga0496110_0344011
663 Ga0496110_1839346
664 Ga0496111_0098118
665 Ga0496111_0278375
666 Ga0496111_0735115
667 Ga0496111_0999249
668 Ga0496112_0603722
669 Ga0496112_0643312
670 Ga0496112_1570607
671 Ga0496113_0073690
672 Ga0496113_1166098
673 Ga0496114_0017457
674 Ga0496114_0019288
675 Ga0496114_0021306
676 Ga0496114_0100126
677 Ga0496114_0205389
678 Ga0496114_0707423
679 Ga0496114_1427913
680 Ga0496114_1487357
681 Ga0496114_1718286
682 Ga0496115_0080652
683 Ga0496115_0105336
684 Ga0501031_0147211
685 Ga0501031_0492859
686 Ga0501031_0657178
687 Ga0501032_1072141
688 Ga0501033_0623400
689 Ga0501036_0041697
690 Ga0501037_0846713
691 Ga0501039_0061870
692 Ga0501039_0511019
693 Ga0501039_1236231
694 Ga0501040_0390847
695 Ga0501041_0038196
696 Ga0501041_0913323
697 Ga0501042_0036176
698 Ga0501042_0290951
699 Ga0501042_1148282
700 Ga0501042_1230760
701 Ga0501046_1032913
702 Ga0501046_1162790
703 Ga0501048_0524620
704 Ga0501048_1296967
705 Ga0501048_1336276
706 Ga0501067_0058902
707 Ga0501067_0060767
708 Ga0501067_0451989
709 Ga0501067_0558683
710 Ga0501068_0041201
711 Ga0501068_0087400
712 Ga0501068_0131789
713 Ga0501068_0577433
714 Ga0501069_0008648
715 Ga0501069_1036019
716 Ga0501070_0158680
717 Ga0501071_0309932
718 Ga0501071_0597576
719 Ga0501072_0284471
720 Ga0501072_0450402
721 Ga0501072_0533100
722 Ga0501074_0208519
723 Ga0501074_0712279
724 Ga0501075_0842384
725 Ga0501075_0897209
726 Ga0501076_0240108
727 Ga0501076_0623254
728 Ga0501076_0925025
729 Ga0501076_1002757
730 Ga0501077_0270325
731 Ga0501077_0471783
732 Ga0501079_0171314
733 Ga0501079_0199424
734 Ga0501079_0677289
735 Ga0501080_0756326
736 Ga0501081_0068944
737 Ga0501081_0475034
738 Ga0501035_0762039
739 Ga0501045_0040590
740 Ga0501045_0323850
741 Ga0501045_0446967
742 Ga0501045_0471146
743 nmdc:mga03683_23530_c1
744 nmdc:mga03n38_413211_c1
745 nmdc:mga03n38_434813_c1
746 nmdc:mga03n38_762671_c1
747 nmdc:mga00v17_321098_c1
748 nmdc:mga00v17_589723_c1
749 nmdc:mga0yw44_347001_c1
750 nmdc:mga0yw44_366897_c1
751 nmdc:mga0yw44_66135_c1
752 nmdc:mga06z11_109498_c1
753 nmdc:mga06z11_44280_c1
754 nmdc:mga06z11_72983_c1
755 nmdc:mga04h51_245807_c1
756 nmdc:mga08y16_323562_c1
757 nmdc:mga08y16_494784_c1
758 Ga0495612_0023632
759 Ga0495619_0737138
760 Ga0495619_0793734
761 Ga0501084_0063210
762 Ga0501084_0068084
763 Ga0501084_0747165
764 Ga0590071_112151
765 Ga0590075_052133
766 Ga0501082_0637756
767 Ga0501082_0952923
768 Ga0466962_0297551
769 Ga0530510_0008307
770 Ga0530510_0207033
771 Ga0530510_0862847
772 8054610023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08940

DUF1918

Domain of unknown function (DUF1918)

1

57

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6epd-assembly1.cif.gz_L substrate processing state 26s proteasome (sps1) 0.7759 15 53
5xfp-assembly2.cif.gz_B binary complex of phf1 and a double stranded dna 0.7584 2 50
7qep-assembly1.cif.gz_M4 cryo-em structure of the ribosome from encephalitozoon cuniculi 0.7426 1 58
5xfr-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7302 2 56
5xfq-assembly1.cif.gz_A ternary complex of phf1, a dna duplex and a histone peptide 0.7261 1 57
ID Description Score Start End Superfamily
af_K7LJT2_10_49_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.7596 6 51 2.30.30.140
af_A0A0P0VAX1_196_255_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.7533 5 49 2.30.30.140
af_K7LJT2_10_49_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.7437 6 51 2.30.30.140
af_F4JV27_353_401_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.7169 5 49 2.30.30.140
af_G2TRL4_1_65_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.7167 2 50 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1B1B5F2-F1-model_v4 DUF1918 domain-containing protein 0.9991 1 61
AF-A0A7K2JN99-F1-model_v4 DUF1918 domain-containing protein 0.9953 1 61
AF-A0A2U9NXQ5-F1-model_v4 DUF1918 domain-containing protein 0.9941 1 60
AF-A0A2R4JPM4-F1-model_v4 DUF1918 domain-containing protein 0.9937 1 61
AF-A0A554V992-F1-model_v4 DUF1918 domain-containing protein 0.9932 1 60

Map