F430510

General Info

Members Datasets Scaffolds Average Seq Length
386 243 772 313

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10063121|Ga0182008_100631212
Length 372
Sequence LTCHGYFEKALSGLSSPAKSRDPAKLPESYATGFRNSVRNDFYDATPTVALAMNRFAHKLTEQSIALRRGRPEILQVNVGKLCNLTCAHCHVNAGPKRKEIMTRETVDRIIDWLAKTELPTVDLTGGAPEMIPDFRYFIERVKELQPSRHVIDRCNLTILIEDGYHDLPRFLAGKQVEIIASMPCYSSENVNAQRGEGVFEGSIAALQLLNSLGYGIDPMLPLHLVYNPVGEFLPSPQRELEADYKRELQKHFGIVFNRLYTIANLPIGRFAAYLRHHNRLDEYMQLLVESFNPATIEGLMCRNTISVGWRGEVYDCDFNQQLGMQWNNPDRSEMFLWEVDPHSVENREIMTGDHCFGCTAGAGSTCGGAIV

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
186 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
187 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
188 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
189 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
190 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
191 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
192 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
193 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
196 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
199 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
200 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
201 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
202 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
203 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
204 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
205 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
206 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
207 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
208 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
209 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
210 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
211 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
212 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
213 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
214 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
215 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
216 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
217 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
218 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
219 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
220 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
221 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
222 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
223 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
224 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
225 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
226 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
227 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
228 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
229 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
230 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
231 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
232 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
233 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
234 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
235 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
236 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
237 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
238 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.4
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 10.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10063121 3300014497 Bacteria 1825
2 CNXas_1000118 3300000545 Bacteria 14285
3 JGI24743J22301_10014367 3300001991 Bacteria 1460
4 JGI24035J26624_1004776 3300002126 Bacteria 1288
5 JGI26145J50221_1000589 3300003371 Bacteria 3082
6 Ga0065703_1020123 3300005272 Bacteria 2048
7 Ga0065715_10002111 3300005293 Bacteria 6157
8 Ga0065715_10011199 3300005293 Bacteria 3301
9 Ga0065715_10160579 3300005293 Bacteria 1633
10 Ga0070676_10008357 3300005328 Bacteria 5577
11 Ga0070683_100013165 3300005329 Bacteria 7204
12 Ga0070683_100213060 3300005329 Bacteria 1835
13 Ga0070670_100016901 3300005331 Bacteria 6263
14 Ga0070670_100020632 3300005331 Bacteria 5667
15 Ga0070666_10031481 3300005335 Bacteria 3501
16 Ga0070666_10074747 3300005335 Bacteria 2310
17 Ga0070666_10153599 3300005335 Bacteria 1606
18 Ga0068868_100012389 3300005338 Bacteria 6232
19 Ga0068868_100067242 3300005338 Bacteria 2852
20 Ga0068868_100123215 3300005338 Bacteria 2115
21 Ga0070689_100000804 3300005340 Bacteria 19320
22 Ga0070691_10000240 3300005341 Bacteria 18772
23 Ga0070661_100107625 3300005344 Bacteria 2079
24 Ga0070692_10124067 3300005345 Bacteria 1444
25 Ga0070668_100169532 3300005347 Bacteria 1776
26 Ga0070668_100225419 3300005347 Bacteria 1548
27 Ga0070669_100017366 3300005353 Bacteria 5132
28 Ga0070669_100043989 3300005353 Bacteria 3254
29 Ga0070669_100065242 3300005353 Bacteria 2682
30 Ga0070675_100019522 3300005354 Bacteria 5405
31 Ga0070675_100036435 3300005354 Unclassified 4003
32 Ga0070675_100063846 3300005354 Bacteria 3045
33 Ga0070675_100067409 3300005354 Bacteria 2961
34 Ga0070675_100080098 3300005354 Bacteria 2722
35 Ga0070675_100438250 3300005354 Bacteria 1170
36 Ga0070671_100002615 3300005355 Bacteria 13935
37 Ga0070671_100052733 3300005355 Bacteria 3382
38 Ga0070671_100073606 3300005355 Bacteria 2853
39 Ga0070671_100130393 3300005355 Bacteria 2117
40 Ga0070674_100017101 3300005356 Bacteria 4554
41 Ga0070674_100025325 3300005356 Bacteria 3861
42 Ga0070673_100003639 3300005364 Bacteria 9645
43 Ga0070673_100023937 3300005364 Bacteria 4469
44 Ga0070673_100292542 3300005364 Unclassified 1432
45 Ga0070688_100011517 3300005365 Bacteria 4915
46 Ga0070688_100104058 3300005365 Bacteria 1877
47 Ga0070667_100006441 3300005367 Bacteria 9757
48 Ga0070709_10020595 3300005434 Bacteria 3829
49 Ga0070709_10020868 3300005434 Bacteria 3810
50 Ga0070709_10148357 3300005434 Bacteria 1618
51 Ga0070714_100050564 3300005435 Bacteria 3541
52 Ga0070713_100071476 3300005436 Unclassified 2932
53 Ga0070713_100266780 3300005436 Unclassified 1566
54 Ga0070711_100053329 3300005439 Bacteria 2786
55 Ga0070711_100092337 3300005439 Bacteria 2184
56 Ga0070705_100075182 3300005440 Unclassified 2056
57 Ga0070705_100193892 3300005440 Bacteria 1387
58 Ga0070708_100030543 3300005445 Bacteria 4658
59 Ga0070708_100069067 3300005445 Unclassified 3177
60 Ga0070708_100191678 3300005445 Bacteria 1912
61 Ga0070708_100193595 3300005445 Unclassified 1902
62 Ga0070708_100268644 3300005445 Unclassified 1604
63 Ga0070678_100001475 3300005456 Bacteria 12541
64 Ga0070678_100078581 3300005456 Bacteria 2493
65 Ga0070678_100175492 3300005456 Bacteria 1749
66 Ga0070662_100000059 3300005457 Bacteria 59672
67 Ga0070662_100070138 3300005457 Bacteria 2582
68 Ga0070662_100278358 3300005457 Bacteria 1353
69 Ga0070681_10128461 3300005458 Bacteria 2467
70 Ga0068867_100002045 3300005459 Bacteria 14130
71 Ga0068867_100010999 3300005459 Bacteria 6380
72 Ga0070685_10006563 3300005466 Bacteria 5935
73 Ga0070706_100000244 3300005467 Bacteria 66317
74 Ga0070706_100036795 3300005467 Bacteria 4521
75 Ga0070706_100225588 3300005467 Unclassified 1749
76 Ga0070707_100068818 3300005468 Bacteria 3408
77 Ga0070707_100142032 3300005468 Bacteria 2336
78 Ga0070698_100006278 3300005471 Bacteria 12916
79 Ga0070698_100016083 3300005471 Bacteria 7899
80 Ga0070698_100021408 3300005471 Bacteria 6772
81 Ga0070698_100022026 3300005471 Bacteria 6672
82 Ga0070699_100064313 3300005518 Bacteria 3182
83 Ga0070679_100022201 3300005530 Bacteria 6203
84 Ga0070679_100083697 3300005530 Bacteria 3178
85 Ga0070684_100002952 3300005535 Bacteria 12658
86 Ga0070684_100095376 3300005535 Bacteria 2650
87 Ga0070697_100023785 3300005536 Unclassified 4875
88 Ga0070697_100031592 3300005536 Bacteria 4260
89 Ga0070697_100043096 3300005536 Bacteria 3653
90 Ga0070697_100066742 3300005536 Bacteria 2942
91 Ga0070697_100095140 3300005536 Bacteria 2469
92 Ga0070697_100113215 3300005536 Bacteria 2263
93 Ga0068853_100148572 3300005539 Bacteria 2108
94 Ga0070672_100012588 3300005543 Bacteria 5946
95 Ga0070686_100015177 3300005544 Bacteria 4455
96 Ga0070695_100005575 3300005545 Bacteria 7413
97 Ga0070696_100015378 3300005546 Bacteria 5140
98 Ga0070693_100082027 3300005547 Bacteria 1925
99 Ga0070665_100065388 3300005548 Bacteria 3648
100 Ga0070665_100095018 3300005548 Bacteria 2985
101 Ga0070665_100182347 3300005548 Unclassified 2100
102 Ga0070664_100032594 3300005564 Bacteria 4359
103 Ga0070664_100057057 3300005564 Bacteria 3319
104 Ga0070664_100599382 3300005564 Unclassified 1021
105 Ga0068857_100082132 3300005577 Bacteria 2878
106 Ga0068856_100071116 3300005614 Bacteria 3443
107 Ga0068856_100352327 3300005614 Bacteria 1491
108 Ga0070702_100097125 3300005615 Bacteria 1799
109 Ga0068864_100330466 3300005618 Bacteria 1434
110 Ga0068866_10004880 3300005718 Bacteria 5508
111 Ga0068863_100191163 3300005841 Bacteria 1967
112 Ga0068858_100138211 3300005842 Bacteria 2287
113 Ga0068860_100592167 3300005843 Bacteria 1114
114 Ga0081455_10012015 3300005937 Bacteria 8664
115 Ga0081455_10036970 3300005937 Bacteria 4341
116 Ga0081540_1000506 3300005983 Bacteria 38278
117 Ga0081539_10030403 3300005985 Bacteria 3353
118 Ga0081539_10115621 3300005985 Unclassified 1342
119 Ga0070717_10047842 3300006028 Bacteria 3506
120 Ga0075432_10009066 3300006058 Bacteria 3389
121 Ga0070716_100029334 3300006173 Bacteria 2973
122 Ga0070712_100052740 3300006175 Bacteria 2837
123 Ga0070712_100083300 3300006175 Bacteria 2322
124 Ga0070712_100132236 3300006175 Bacteria 1892
125 Ga0097621_100061959 3300006237 Unclassified 3069
126 Ga0097621_100067441 3300006237 Bacteria 2949
127 Ga0097621_100134177 3300006237 Unclassified 2110
128 Ga0097621_100142771 3300006237 Bacteria 2047
129 Ga0068871_100079225 3300006358 Bacteria 2718
130 Ga0075428_100024965 3300006844 Bacteria 6613
131 Ga0075430_100003363 3300006846 Bacteria 13391
132 Ga0075434_100033736 3300006871 Bacteria 5053
133 Ga0075434_100243879 3300006871 Bacteria 1817
134 Ga0075434_100428212 3300006871 Bacteria 1344
135 Ga0068865_100000247 3300006881 Bacteria 30118
136 Ga0075436_100166810 3300006914 Bacteria 1554
137 Ga0075436_100266264 3300006914 Unclassified 1223
138 Ga0075435_100028117 3300007076 Bacteria 4407
139 Ga0075435_100043059 3300007076 Unclassified 3613
140 Ga0099795_10067524 3300007788 Unclassified 1342
141 Ga0099795_10122667 3300007788 Bacteria 1041
142 Ga0105245_10029007 3300009098 Bacteria 4886
143 Ga0105245_10041879 3300009098 Bacteria 4084
144 Ga0105245_10116470 3300009098 Bacteria 2492
145 Ga0114129_10050102 3300009147 Bacteria 5867
146 Ga0114129_10580763 3300009147 Bacteria 1454
147 Ga0105242_10014302 3300009176 Bacteria 6147
148 Ga0105249_10268408 3300009553 Bacteria 1699
149 Ga0105239_10161570 3300010375 Bacteria 2503
150 Ga0105239_10244435 3300010375 Bacteria 2014
151 Ga0157370_10416441 3300013104 Unclassified 1236
152 Ga0157369_10129426 3300013105 Bacteria 2675
153 Ga0157374_10002900 3300013296 Bacteria 14369
154 Ga0157374_10005781 3300013296 Bacteria 10443
155 Ga0157374_10031006 3300013296 Bacteria 4855
156 Ga0157374_10268842 3300013296 Bacteria 1681
157 Ga0157374_10332898 3300013296 Bacteria 1506
158 Ga0157378_10012664 3300013297 Bacteria 7378
159 Ga0157378_10058586 3300013297 Bacteria 3435
160 Ga0157378_10074351 3300013297 Unclassified 3057
161 Ga0157378_10102249 3300013297 Unclassified 2618
162 Ga0163162_10012284 3300013306 Bacteria 8361
163 Ga0157372_10225849 3300013307 Bacteria 2171
164 Ga0157375_10043386 3300013308 Bacteria 4361
165 Ga0157375_10046643 3300013308 Bacteria 4227
166 Ga0157375_10238887 3300013308 Bacteria 1976
167 Ga0157375_10340649 3300013308 Unclassified 1665
168 Ga0163163_10093498 3300014325 Bacteria 3023
169 Ga0157379_10426997 3300014968 Bacteria 1221
170 Ga0157376_10005803 3300014969 Bacteria 8653
171 Ga0157376_10111785 3300014969 Unclassified 2406
172 Ga0157376_10238862 3300014969 Unclassified 1692
173 Ga0163161_10004575 3300017792 Bacteria 9629
174 Ga0213876_10006488 3300021384 Bacteria 6378
175 Ga0207666_1000929 3300025271 Bacteria 3466
176 Ga0207697_10000329 3300025315 Bacteria 26516
177 Ga0207697_10001274 3300025315 Bacteria 13822
178 Ga0207653_10048940 3300025885 Bacteria 1402
179 Ga0207688_10002508 3300025901 Bacteria 9896
180 Ga0207680_10008036 3300025903 Bacteria 5168
181 Ga0207680_10043787 3300025903 Bacteria 2628
182 Ga0207680_10127007 3300025903 Bacteria 1675
183 Ga0207647_10032032 3300025904 Bacteria 3381
184 Ga0207699_10018614 3300025906 Bacteria 3684
185 Ga0207645_10000009 3300025907 Bacteria 142449
186 Ga0207645_10002260 3300025907 Bacteria 15310
187 Ga0207645_10013269 3300025907 Bacteria 5558
188 Ga0207645_10144866 3300025907 Bacteria 1549
189 Ga0207684_10000282 3300025910 Bacteria 73951
190 Ga0207684_10006943 3300025910 Bacteria 10244
191 Ga0207684_10016726 3300025910 Bacteria 6297
192 Ga0207684_10025661 3300025910 Bacteria 5022
193 Ga0207693_10043183 3300025915 Bacteria 3548
194 Ga0207693_10044597 3300025915 Bacteria 3485
195 Ga0207693_10093894 3300025915 Bacteria 2351
196 Ga0207693_10136804 3300025915 Bacteria 1926
197 Ga0207663_10014025 3300025916 Bacteria 4375
198 Ga0207660_10153826 3300025917 Bacteria 1769
199 Ga0207649_10002918 3300025920 Bacteria 9412
200 Ga0207652_10037466 3300025921 Bacteria 4104
201 Ga0207652_10050808 3300025921 Bacteria 3553
202 Ga0207646_10000130 3300025922 Bacteria 101961
203 Ga0207646_10006445 3300025922 Bacteria 12117
204 Ga0207646_10017464 3300025922 Bacteria 6712
205 Ga0207646_10124689 3300025922 Bacteria 2315
206 Ga0207646_10195719 3300025922 Unclassified 1825
207 Ga0207646_10272979 3300025922 Bacteria 1528
208 Ga0207646_10298543 3300025922 Unclassified 1455
209 Ga0207646_10354031 3300025922 Bacteria 1327
210 Ga0207681_10073639 3300025923 Bacteria 2390
211 Ga0207681_10105839 3300025923 Bacteria 2037
212 Ga0207650_10057473 3300025925 Bacteria 2893
213 Ga0207650_10062721 3300025925 Bacteria 2777
214 Ga0207650_10459167 3300025925 Bacteria 1061
215 Ga0207659_10047184 3300025926 Bacteria 3046
216 Ga0207687_10011533 3300025927 Bacteria 5777
217 Ga0207700_10006614 3300025928 Bacteria 7022
218 Ga0207644_10012887 3300025931 Bacteria 5558
219 Ga0207644_10037343 3300025931 Bacteria 3417
220 Ga0207644_10182029 3300025931 Bacteria 1647
221 Ga0207706_10000134 3300025933 Bacteria 80573
222 Ga0207706_10002257 3300025933 Bacteria 18819
223 Ga0207706_10028347 3300025933 Bacteria 5002
224 Ga0207706_10336908 3300025933 Bacteria 1312
225 Ga0207686_10002747 3300025934 Bacteria 9540
226 Ga0207686_10013244 3300025934 Bacteria 4560
227 Ga0207669_10009070 3300025937 Bacteria 4714
228 Ga0207669_10009191 3300025937 Bacteria 4691
229 Ga0207665_10014553 3300025939 Bacteria 5180
230 Ga0207665_10155313 3300025939 Unclassified 1642
231 Ga0207691_10000066 3300025940 Bacteria 84662
232 Ga0207691_10001790 3300025940 Bacteria 21136
233 Ga0207691_10002583 3300025940 Bacteria 17689
234 Ga0207691_10119712 3300025940 Bacteria 2335
235 Ga0207689_10006708 3300025942 Bacteria 10156
236 Ga0207661_10164667 3300025944 Bacteria 1926
237 Ga0207661_10405134 3300025944 Bacteria 1237
238 Ga0207679_10002206 3300025945 Bacteria 12034
239 Ga0207679_10019053 3300025945 Unclassified 4606
240 Ga0207679_10147114 3300025945 Bacteria 1912
241 Ga0207651_10026133 3300025960 Bacteria 3641
242 Ga0207651_10060508 3300025960 Bacteria 2629
243 Ga0207712_10372786 3300025961 Bacteria 1192
244 Ga0207668_10075948 3300025972 Bacteria 2417
245 Ga0207668_10083902 3300025972 Bacteria 2320
246 Ga0207668_10327960 3300025972 Bacteria 1272
247 Ga0207658_10014071 3300025986 Bacteria 5477
248 Ga0207658_10461464 3300025986 Unclassified 1126
249 Ga0207677_10012130 3300026023 Bacteria 4940
250 Ga0207677_10022018 3300026023 Unclassified 3908
251 Ga0207678_10025664 3300026067 Bacteria 5143
252 Ga0207708_10000336 3300026075 Bacteria 36973
253 Ga0207708_10196118 3300026075 Bacteria 1609
254 Ga0207641_10246959 3300026088 Bacteria 1665
255 Ga0207641_10417222 3300026088 Unclassified 1292
256 Ga0207648_10000049 3300026089 Bacteria 108876
257 Ga0207648_10019219 3300026089 Bacteria 6166
258 Ga0207675_100055889 3300026118 Bacteria 3683
259 Ga0207683_10000023 3300026121 Bacteria 114463
260 Ga0207683_10120993 3300026121 Bacteria 2350
261 Ga0209969_1000756 3300027360 Bacteria 4343
262 Ga0209981_1000063 3300027378 Bacteria 11574
263 Ga0210000_1000014 3300027462 Bacteria 31267
264 Ga0209968_1000036 3300027526 Bacteria 24144
265 Ga0209982_1000286 3300027552 Bacteria 6116
266 Ga0209970_1000140 3300027614 Bacteria 10988
267 Ga0210002_1000004 3300027617 Bacteria 38105
268 Ga0209983_1000028 3300027665 Bacteria 19716
269 Ga0209971_1000211 3300027682 Bacteria 17212
270 Ga0209966_1000028 3300027695 Bacteria 65208
271 Ga0209998_10000144 3300027717 Bacteria 27469
272 Ga0209974_10001002 3300027876 Bacteria 9957
273 Ga0207428_10005567 3300027907 Bacteria 11728
274 Ga0268266_10048753 3300028379 Bacteria 3631
275 Ga0268266_10350060 3300028379 Unclassified 1388
276 Ga0307408_100066563 3300031548 Bacteria 2646
277 Ga0307405_10003115 3300031731 Bacteria 7534
278 Ga0307410_10050151 3300031852 Bacteria 2805
279 Ga0307415_100018940 3300032126 Bacteria 4169
280 Ga0373961_0016121 3300035241 Bacteria 1922
281 Ga0373935_0083352 3300035692 Bacteria 2081
282 Ga0373927_0114026 3300035695 Bacteria 1762
283 Ga0373947_0005542 3300035725 Bacteria 7362
284 Ga0373947_0248186 3300035725 Unclassified 1176
285 Ga0373925_0139489 3300037068 Bacteria 1897
286 Ga0395899_0024668 3300037312 Bacteria 4545
287 Ga0395900_0002411 3300037418 Bacteria 20621
288 Ga0395900_0121069 3300037418 Unclassified 2685
289 Ga0395900_0469585 3300037418 Unclassified 1212
290 Ga0395898_0002152 3300037466 Bacteria 24211
291 Ga0395905_0022441 3300037471 Bacteria 5969
292 Ga0395901_0023650 3300038443 Bacteria 6299
293 Ga0395901_0766904 3300038443 Unclassified 956
294 Ga0400483_089197 3300039062 Bacteria 58119
295 Ga0400483_134009 3300039062 Bacteria 204879
296 Ga0436365_0792801 3300039437 Bacteria 20322
297 Ga0436360_0368021 3300039438 Bacteria 3458
298 Ga0439432_020149 3300042006 Unclassified 2219
299 Ga0453683_0041648 3300044673 Bacteria 2885
300 Ga0453684_0039129 3300044712 Bacteria 6469
301 Ga0451576_0092717 3300045051 Bacteria 3141
302 Ga0451576_0200891 3300045051 Bacteria 2082
303 Ga0495592_0217920 3300046454 Unclassified 1278
304 Ga0495586_0101617 3300046535 Bacteria 1596
305 Ga0495645_0070487 3300046543 Bacteria 2523
306 Ga0495599_0006999 3300046678 Bacteria 6823
307 Ga0495636_0038999 3300047318 Bacteria 1967
308 Ga0495680_0146852 3300047322 Unclassified 1722
309 Ga0496101_0014601 3300048904 Bacteria 5281
310 Ga0496102_0130326 3300048905 Bacteria 2353
311 Ga0496103_0036858 3300048906 Bacteria 2996
312 Ga0496104_0146362 3300048907 Bacteria 2269
313 Ga0496104_0294701 3300048907 Bacteria 1535
314 Ga0496105_0296505 3300048908 Bacteria 1301
315 Ga0496106_0016007 3300048909 Bacteria 5546
316 Ga0496109_0079967 3300048912 Bacteria 3012
317 Ga0496109_0087392 3300048912 Unclassified 2880
318 Ga0496110_0432784 3300048913 Unclassified 1199
319 Ga0496112_0038489 3300048915 Unclassified 4670
320 Ga0496113_0385409 3300048916 Bacteria 1125
321 Ga0496113_0436391 3300048916 Bacteria 1052
322 Ga0496114_0007951 3300048917 Bacteria 8391
323 Ga0496114_0064098 3300048917 Bacteria 3077
324 Ga0496115_0013912 3300048918 Bacteria 6089
325 Ga0496115_0019164 3300048918 Bacteria 5263
326 Ga0501290_000013 3300049513 Bacteria 26331
327 Ga0501292_000386 3300049515 Bacteria 5893
328 Ga0501294_000953 3300049517 Bacteria 3082
329 Ga0501295_000322 3300049518 Bacteria 4637
330 Ga0501296_000067 3300049519 Bacteria 12031
331 Ga0501298_009248 3300049521 Bacteria 1672
332 Ga0501299_000009 3300049522 Bacteria 29464
333 Ga0501300_000176 3300049523 Bacteria 9630
334 Ga0501303_000303 3300049526 Bacteria 4017
335 Ga0501075_0013263 3300049591 Bacteria 5879
336 Ga0501199_006522 3300049650 Bacteria 1190
337 Ga0501202_000082 3300049652 Bacteria 10213
338 Ga0501207_000269 3300049654 Bacteria 5415
339 Ga0501208_002029 3300049655 Bacteria 2051
340 Ga0501209_001477 3300049656 Bacteria 3337
341 Ga0501214_000895 3300049659 Bacteria 2199
342 Ga0501216_000021 3300049660 Bacteria 13034
343 Ga0501217_000123 3300049661 Bacteria 10183
344 Ga0501227_012700 3300049665 Bacteria 1847
345 Ga0501228_000064 3300049666 Bacteria 5252
346 Ga0501233_000076 3300049668 Bacteria 13232
347 Ga0501235_000118 3300049669 Bacteria 12975
348 Ga0501236_003114 3300049670 Bacteria 1924
349 Ga0501238_009235 3300049671 Bacteria 1306
350 Ga0501243_000453 3300049675 Bacteria 5463
351 Ga0501246_000140 3300049676 Bacteria 4438
352 Ga0501248_001996 3300049678 Bacteria 1352
353 Ga0501249_000136 3300049679 Bacteria 22950
354 Ga0501250_001221 3300049680 Bacteria 2051
355 Ga0501251_002623 3300049681 Bacteria 1753
356 Ga0501253_001074 3300049683 Bacteria 2662
357 Ga0501256_001321 3300049685 Bacteria 1806
358 Ga0501258_000133 3300049687 Bacteria 4105
359 Ga0501260_000007 3300049689 Bacteria 14014
360 Ga0501261_001144 3300049690 Bacteria 3256
361 Ga0501219_000423 3300049703 Bacteria 6935
362 Ga0501221_000478 3300049704 Bacteria 6263
363 Ga0501225_0001238 3300049705 Bacteria 7940
364 Ga0501229_001069 3300049706 Bacteria 3152
365 Ga0501234_000374 3300049707 Bacteria 6625
366 Ga0501245_004018 3300049708 Bacteria 2011
367 Ga0501232_003051 3300049757 Bacteria 1503
368 Ga0501264_000849 3300049761 Bacteria 3954
369 Ga0501265_000750 3300049762 Bacteria 3538
370 Ga0501266_001435 3300049763 Bacteria 3038
371 Ga0501269_006244 3300049766 Bacteria 1436
372 Ga0501270_013799 3300049767 Bacteria 1126
373 Ga0501272_000572 3300049769 Bacteria 3270
374 Ga0501273_003412 3300049770 Bacteria 1686
375 Ga0501275_001196 3300049772 Bacteria 2617
376 Ga0501276_003581 3300049773 Bacteria 1134
377 Ga0501279_000060 3300049775 Bacteria 19728
378 Ga0501280_000675 3300049776 Bacteria 7576
379 Ga0501283_000248 3300049779 Bacteria 7097
380 nmdc:mga05p37_355202_c1 3300050507 Bacteria 1724
381 nmdc:mga05p37_39529_c1 3300050507 Bacteria 5792
382 nmdc:mga0n895_182262_c1 3300050512 Bacteria 2131
383 nmdc:mga0n895_544891_c1 3300050512 Bacteria 1166
384 nmdc:mga08x19_192116_c1 3300050514 Bacteria 1397
385 Ga0495601_0004828 3300053077 Bacteria 7816
386 Ga0495619_0129146 3300053085 Bacteria 1736
387 Ga0182008_10063121
388 CNXas_1000118
389 JGI24743J22301_10014367
390 JGI24035J26624_1004776
391 JGI26145J50221_1000589
392 Ga0065703_1020123
393 Ga0065715_10002111
394 Ga0065715_10011199
395 Ga0065715_10160579
396 Ga0070676_10008357
397 Ga0070683_100013165
398 Ga0070683_100213060
399 Ga0070670_100016901
400 Ga0070670_100020632
401 Ga0070666_10031481
402 Ga0070666_10074747
403 Ga0070666_10153599
404 Ga0068868_100012389
405 Ga0068868_100067242
406 Ga0068868_100123215
407 Ga0070689_100000804
408 Ga0070691_10000240
409 Ga0070661_100107625
410 Ga0070692_10124067
411 Ga0070668_100169532
412 Ga0070668_100225419
413 Ga0070669_100017366
414 Ga0070669_100043989
415 Ga0070669_100065242
416 Ga0070675_100019522
417 Ga0070675_100036435
418 Ga0070675_100063846
419 Ga0070675_100067409
420 Ga0070675_100080098
421 Ga0070675_100438250
422 Ga0070671_100002615
423 Ga0070671_100052733
424 Ga0070671_100073606
425 Ga0070671_100130393
426 Ga0070674_100017101
427 Ga0070674_100025325
428 Ga0070673_100003639
429 Ga0070673_100023937
430 Ga0070673_100292542
431 Ga0070688_100011517
432 Ga0070688_100104058
433 Ga0070667_100006441
434 Ga0070709_10020595
435 Ga0070709_10020868
436 Ga0070709_10148357
437 Ga0070714_100050564
438 Ga0070713_100071476
439 Ga0070713_100266780
440 Ga0070711_100053329
441 Ga0070711_100092337
442 Ga0070705_100075182
443 Ga0070705_100193892
444 Ga0070708_100030543
445 Ga0070708_100069067
446 Ga0070708_100191678
447 Ga0070708_100193595
448 Ga0070708_100268644
449 Ga0070678_100001475
450 Ga0070678_100078581
451 Ga0070678_100175492
452 Ga0070662_100000059
453 Ga0070662_100070138
454 Ga0070662_100278358
455 Ga0070681_10128461
456 Ga0068867_100002045
457 Ga0068867_100010999
458 Ga0070685_10006563
459 Ga0070706_100000244
460 Ga0070706_100036795
461 Ga0070706_100225588
462 Ga0070707_100068818
463 Ga0070707_100142032
464 Ga0070698_100006278
465 Ga0070698_100016083
466 Ga0070698_100021408
467 Ga0070698_100022026
468 Ga0070699_100064313
469 Ga0070679_100022201
470 Ga0070679_100083697
471 Ga0070684_100002952
472 Ga0070684_100095376
473 Ga0070697_100023785
474 Ga0070697_100031592
475 Ga0070697_100043096
476 Ga0070697_100066742
477 Ga0070697_100095140
478 Ga0070697_100113215
479 Ga0068853_100148572
480 Ga0070672_100012588
481 Ga0070686_100015177
482 Ga0070695_100005575
483 Ga0070696_100015378
484 Ga0070693_100082027
485 Ga0070665_100065388
486 Ga0070665_100095018
487 Ga0070665_100182347
488 Ga0070664_100032594
489 Ga0070664_100057057
490 Ga0070664_100599382
491 Ga0068857_100082132
492 Ga0068856_100071116
493 Ga0068856_100352327
494 Ga0070702_100097125
495 Ga0068864_100330466
496 Ga0068866_10004880
497 Ga0068863_100191163
498 Ga0068858_100138211
499 Ga0068860_100592167
500 Ga0081455_10012015
501 Ga0081455_10036970
502 Ga0081540_1000506
503 Ga0081539_10030403
504 Ga0081539_10115621
505 Ga0070717_10047842
506 Ga0075432_10009066
507 Ga0070716_100029334
508 Ga0070712_100052740
509 Ga0070712_100083300
510 Ga0070712_100132236
511 Ga0097621_100061959
512 Ga0097621_100067441
513 Ga0097621_100134177
514 Ga0097621_100142771
515 Ga0068871_100079225
516 Ga0075428_100024965
517 Ga0075430_100003363
518 Ga0075434_100033736
519 Ga0075434_100243879
520 Ga0075434_100428212
521 Ga0068865_100000247
522 Ga0075436_100166810
523 Ga0075436_100266264
524 Ga0075435_100028117
525 Ga0075435_100043059
526 Ga0099795_10067524
527 Ga0099795_10122667
528 Ga0105245_10029007
529 Ga0105245_10041879
530 Ga0105245_10116470
531 Ga0114129_10050102
532 Ga0114129_10580763
533 Ga0105242_10014302
534 Ga0105249_10268408
535 Ga0105239_10161570
536 Ga0105239_10244435
537 Ga0157370_10416441
538 Ga0157369_10129426
539 Ga0157374_10002900
540 Ga0157374_10005781
541 Ga0157374_10031006
542 Ga0157374_10268842
543 Ga0157374_10332898
544 Ga0157378_10012664
545 Ga0157378_10058586
546 Ga0157378_10074351
547 Ga0157378_10102249
548 Ga0163162_10012284
549 Ga0157372_10225849
550 Ga0157375_10043386
551 Ga0157375_10046643
552 Ga0157375_10238887
553 Ga0157375_10340649
554 Ga0163163_10093498
555 Ga0157379_10426997
556 Ga0157376_10005803
557 Ga0157376_10111785
558 Ga0157376_10238862
559 Ga0163161_10004575
560 Ga0213876_10006488
561 Ga0207666_1000929
562 Ga0207697_10000329
563 Ga0207697_10001274
564 Ga0207653_10048940
565 Ga0207688_10002508
566 Ga0207680_10008036
567 Ga0207680_10043787
568 Ga0207680_10127007
569 Ga0207647_10032032
570 Ga0207699_10018614
571 Ga0207645_10000009
572 Ga0207645_10002260
573 Ga0207645_10013269
574 Ga0207645_10144866
575 Ga0207684_10000282
576 Ga0207684_10006943
577 Ga0207684_10016726
578 Ga0207684_10025661
579 Ga0207693_10043183
580 Ga0207693_10044597
581 Ga0207693_10093894
582 Ga0207693_10136804
583 Ga0207663_10014025
584 Ga0207660_10153826
585 Ga0207649_10002918
586 Ga0207652_10037466
587 Ga0207652_10050808
588 Ga0207646_10000130
589 Ga0207646_10006445
590 Ga0207646_10017464
591 Ga0207646_10124689
592 Ga0207646_10195719
593 Ga0207646_10272979
594 Ga0207646_10298543
595 Ga0207646_10354031
596 Ga0207681_10073639
597 Ga0207681_10105839
598 Ga0207650_10057473
599 Ga0207650_10062721
600 Ga0207650_10459167
601 Ga0207659_10047184
602 Ga0207687_10011533
603 Ga0207700_10006614
604 Ga0207644_10012887
605 Ga0207644_10037343
606 Ga0207644_10182029
607 Ga0207706_10000134
608 Ga0207706_10002257
609 Ga0207706_10028347
610 Ga0207706_10336908
611 Ga0207686_10002747
612 Ga0207686_10013244
613 Ga0207669_10009070
614 Ga0207669_10009191
615 Ga0207665_10014553
616 Ga0207665_10155313
617 Ga0207691_10000066
618 Ga0207691_10001790
619 Ga0207691_10002583
620 Ga0207691_10119712
621 Ga0207689_10006708
622 Ga0207661_10164667
623 Ga0207661_10405134
624 Ga0207679_10002206
625 Ga0207679_10019053
626 Ga0207679_10147114
627 Ga0207651_10026133
628 Ga0207651_10060508
629 Ga0207712_10372786
630 Ga0207668_10075948
631 Ga0207668_10083902
632 Ga0207668_10327960
633 Ga0207658_10014071
634 Ga0207658_10461464
635 Ga0207677_10012130
636 Ga0207677_10022018
637 Ga0207678_10025664
638 Ga0207708_10000336
639 Ga0207708_10196118
640 Ga0207641_10246959
641 Ga0207641_10417222
642 Ga0207648_10000049
643 Ga0207648_10019219
644 Ga0207675_100055889
645 Ga0207683_10000023
646 Ga0207683_10120993
647 Ga0209969_1000756
648 Ga0209981_1000063
649 Ga0210000_1000014
650 Ga0209968_1000036
651 Ga0209982_1000286
652 Ga0209970_1000140
653 Ga0210002_1000004
654 Ga0209983_1000028
655 Ga0209971_1000211
656 Ga0209966_1000028
657 Ga0209998_10000144
658 Ga0209974_10001002
659 Ga0207428_10005567
660 Ga0268266_10048753
661 Ga0268266_10350060
662 Ga0307408_100066563
663 Ga0307405_10003115
664 Ga0307410_10050151
665 Ga0307415_100018940
666 Ga0373961_0016121
667 Ga0373935_0083352
668 Ga0373927_0114026
669 Ga0373947_0005542
670 Ga0373947_0248186
671 Ga0373925_0139489
672 Ga0395899_0024668
673 Ga0395900_0002411
674 Ga0395900_0121069
675 Ga0395900_0469585
676 Ga0395898_0002152
677 Ga0395905_0022441
678 Ga0395901_0023650
679 Ga0395901_0766904
680 Ga0400483_089197
681 Ga0400483_134009
682 Ga0436365_0792801
683 Ga0436360_0368021
684 Ga0439432_020149
685 Ga0453683_0041648
686 Ga0453684_0039129
687 Ga0451576_0092717
688 Ga0451576_0200891
689 Ga0495592_0217920
690 Ga0495586_0101617
691 Ga0495645_0070487
692 Ga0495599_0006999
693 Ga0495636_0038999
694 Ga0495680_0146852
695 Ga0496101_0014601
696 Ga0496102_0130326
697 Ga0496103_0036858
698 Ga0496104_0146362
699 Ga0496104_0294701
700 Ga0496105_0296505
701 Ga0496106_0016007
702 Ga0496109_0079967
703 Ga0496109_0087392
704 Ga0496110_0432784
705 Ga0496112_0038489
706 Ga0496113_0385409
707 Ga0496113_0436391
708 Ga0496114_0007951
709 Ga0496114_0064098
710 Ga0496115_0013912
711 Ga0496115_0019164
712 Ga0501290_000013
713 Ga0501292_000386
714 Ga0501294_000953
715 Ga0501295_000322
716 Ga0501296_000067
717 Ga0501298_009248
718 Ga0501299_000009
719 Ga0501300_000176
720 Ga0501303_000303
721 Ga0501075_0013263
722 Ga0501199_006522
723 Ga0501202_000082
724 Ga0501207_000269
725 Ga0501208_002029
726 Ga0501209_001477
727 Ga0501214_000895
728 Ga0501216_000021
729 Ga0501217_000123
730 Ga0501227_012700
731 Ga0501228_000064
732 Ga0501233_000076
733 Ga0501235_000118
734 Ga0501236_003114
735 Ga0501238_009235
736 Ga0501243_000453
737 Ga0501246_000140
738 Ga0501248_001996
739 Ga0501249_000136
740 Ga0501250_001221
741 Ga0501251_002623
742 Ga0501253_001074
743 Ga0501256_001321
744 Ga0501258_000133
745 Ga0501260_000007
746 Ga0501261_001144
747 Ga0501219_000423
748 Ga0501221_000478
749 Ga0501225_0001238
750 Ga0501229_001069
751 Ga0501234_000374
752 Ga0501245_004018
753 Ga0501232_003051
754 Ga0501264_000849
755 Ga0501265_000750
756 Ga0501266_001435
757 Ga0501269_006244
758 Ga0501270_013799
759 Ga0501272_000572
760 Ga0501273_003412
761 Ga0501275_001196
762 Ga0501276_003581
763 Ga0501279_000060
764 Ga0501280_000675
765 Ga0501283_000248
766 nmdc:mga05p37_355202_c1
767 nmdc:mga05p37_39529_c1
768 nmdc:mga0n895_182262_c1
769 nmdc:mga0n895_544891_c1
770 nmdc:mga08x19_192116_c1
771 Ga0495601_0004828
772 Ga0495619_0129146

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12345

DUF3641

Protein of unknown function (DUF3641)

234

370

0.97

PF13353

Fer4_12

4Fe-4S single cluster domain

77

159

0.88

PF04055

Radical_SAM

Radical SAM superfamily

77

224

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.7269 28 226
7tom-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound 0.7129 26 241
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.6791 24 305
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.6768 29 237
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.6672 32 236
ID Description Score Start End Superfamily
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8211 30 226 3.20.20.70
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7897 30 226 3.20.20.70
af_Q59026_29_239_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7323 33 222 3.20.20.70
af_Q58214_34_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6939 32 235 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6919 28 226 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V6AP24-F1-model_v4 Radical SAM protein 0.9874 57 330
AF-A0A2V6AP24-F1-model_v4 Radical SAM protein 0.9837 57 330
AF-A0A2V6NRA2-F1-model_v4 Radical SAM protein 0.9787 84 330
AF-A0A2J0MWM4-F1-model_v4 Radical SAM protein 0.9782 58 285
AF-A0A2V5Z997-F1-model_v4 Radical SAM protein 0.977 9 330 GO:0003824
GO:0046872
GO:0051536

Map