F430508

General Info

Members Datasets Scaffolds Average Seq Length
386 208 386 387

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10138855|Ga0157375_101388552
Length 414
Sequence MPTYAFKGRNRLNELIAGERDAASQDELRSLLRREQIILTSATEKGREIAIPKLGRRKKVKAKELAVFTRQFSVMIDAGLPLVQCIDILGEQQQNAFFKDVLRQVRQNVEEGSTLFAALEKHPKVFDNLYTSMVEAGETGGVLDLILQRLATLIEKVVKLKRSIVSASIYPTAVILVAIGAVALIMIVVIPQFQQIFLGLLGPGELLPLPTRIVMGISSFLAGWGGLATLICLIGAAVGIHFYYKTPKGRWQIDSLMLKAPIIGSILRKVAVARFARILSTLLSSGVPILQSLDITAKTAGNVVIEDAVLKVRAGVERGENFVDPLKATDVFPHMVGQMIGVGEQTGALDAMLGKIADFYEEEVDSAIADLLALIEPALIAFLGVTIGSIVISMYLPLFSLIGKLASPGGGSSK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
135 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
136 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
186 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
187 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
197 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
198 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
199 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
207 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 3.63
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2466980 2162886012 Bacteria 2211
2 MBSR1b_contig_8595631 2162886012 Bacteria 2211
3 LJQas_1000002 3300000549 Bacteria 48568
4 JGI25406J46586_10000363 3300003203 Bacteria 20685
5 JGI25406J46586_10003455 3300003203 Bacteria 7425
6 JGI25406J46586_10011528 3300003203 Bacteria 3876
7 rootH2_10006821 3300003320 Bacteria 94080
8 Ga0065712_10102031 3300005290 Bacteria 2019
9 Ga0065715_10000425 3300005293 Bacteria 14903
10 Ga0065715_10090926 3300005293 Bacteria 6307
11 Ga0065715_10110425 3300005293 Bacteria 2621
12 Ga0065715_10111462 3300005293 Bacteria 2572
13 Ga0065715_10124681 3300005293 Bacteria 2148
14 Ga0065707_10003001 3300005295 Bacteria 4852
15 Ga0065707_10008026 3300005295 Bacteria 2820
16 Ga0070676_10020694 3300005328 Bacteria 3677
17 Ga0070676_10097674 3300005328 Bacteria 1809
18 Ga0070690_100000511 3300005330 Bacteria 19404
19 Ga0070690_100008369 3300005330 Bacteria 5955
20 Ga0070670_100016313 3300005331 Bacteria 6380
21 Ga0070670_100139703 3300005331 Bacteria 2095
22 Ga0070677_10004389 3300005333 Bacteria 4602
23 Ga0070677_10005406 3300005333 Bacteria 4208
24 Ga0070677_10040580 3300005333 Bacteria 1832
25 Ga0070677_10041489 3300005333 Bacteria 1817
26 Ga0068869_100151198 3300005334 Bacteria 1801
27 Ga0068869_100176168 3300005334 Bacteria 1674
28 Ga0070666_10000356 3300005335 Bacteria 28754
29 Ga0070666_10048341 3300005335 Bacteria 2858
30 Ga0070680_100007149 3300005336 Bacteria 8507
31 Ga0068868_100032703 3300005338 Bacteria 4003
32 Ga0070689_100018452 3300005340 Bacteria 5140
33 Ga0070689_100064430 3300005340 Bacteria 2853
34 Ga0070661_100058165 3300005344 Bacteria 2833
35 Ga0070692_10011842 3300005345 Bacteria 4019
36 Ga0070668_100076235 3300005347 Bacteria 2619
37 Ga0070668_100131848 3300005347 Unclassified 2006
38 Ga0070669_100038779 3300005353 Bacteria 3459
39 Ga0070675_100061289 3300005354 Bacteria 3106
40 Ga0070675_100070485 3300005354 Bacteria 2897
41 Ga0070671_100127434 3300005355 Bacteria 2143
42 Ga0070674_100002090 3300005356 Bacteria 10945
43 Ga0070673_100002305 3300005364 Bacteria 11595
44 Ga0070673_100024896 3300005364 Bacteria 4395
45 Ga0070673_100132892 3300005364 Bacteria 2091
46 Ga0070688_100102831 3300005365 Bacteria 1887
47 Ga0070688_100142695 3300005365 Bacteria 1629
48 Ga0070659_100007530 3300005366 Bacteria 7911
49 Ga0070659_100093006 3300005366 Bacteria 2419
50 Ga0070659_100220620 3300005366 Bacteria 1565
51 Ga0070667_100001010 3300005367 Bacteria 25770
52 Ga0070667_100004810 3300005367 Bacteria 11315
53 Ga0070667_100021166 3300005367 Bacteria 5403
54 Ga0070708_100049009 3300005445 Bacteria 3736
55 Ga0070708_100114761 3300005445 Bacteria 2479
56 Ga0070678_100039578 3300005456 Bacteria 3327
57 Ga0070662_100007403 3300005457 Bacteria 7117
58 Ga0070662_100020082 3300005457 Bacteria 4547
59 Ga0070662_100086016 3300005457 Bacteria 2351
60 Ga0070681_10175953 3300005458 Bacteria 2062
61 Ga0068867_100019387 3300005459 Bacteria 4848
62 Ga0068867_100027389 3300005459 Bacteria 4095
63 Ga0070685_10058527 3300005466 Bacteria 2247
64 Ga0070706_100000942 3300005467 Bacteria 31834
65 Ga0070706_100002886 3300005467 Bacteria 17128
66 Ga0070707_100000484 3300005468 Bacteria 39358
67 Ga0070707_100122523 3300005468 Bacteria 2524
68 Ga0070679_100033135 3300005530 Bacteria 5115
69 Ga0068853_100008557 3300005539 Bacteria 8223
70 Ga0068853_100009784 3300005539 Bacteria 7738
71 Ga0068853_100012966 3300005539 Bacteria 6795
72 Ga0068853_100072293 3300005539 Bacteria 3005
73 Ga0068853_100200391 3300005539 Bacteria 1816
74 Ga0070672_100013495 3300005543 Bacteria 5774
75 Ga0070672_100047396 3300005543 Bacteria 3335
76 Ga0070672_100069089 3300005543 Bacteria 2803
77 Ga0070696_100048869 3300005546 Bacteria 2937
78 Ga0070696_100083352 3300005546 Bacteria 2268
79 Ga0070693_100095002 3300005547 Bacteria 1805
80 Ga0070665_100164211 3300005548 Bacteria 2223
81 Ga0070704_100009379 3300005549 Bacteria 5910
82 Ga0070704_100073796 3300005549 Bacteria 2486
83 Ga0068855_100049561 3300005563 Bacteria 4953
84 Ga0070664_100007144 3300005564 Bacteria 9004
85 Ga0070664_100080860 3300005564 Bacteria 2799
86 Ga0070664_100085321 3300005564 Bacteria 2727
87 Ga0070664_100103219 3300005564 Bacteria 2482
88 Ga0068857_100187544 3300005577 Bacteria 1883
89 Ga0068854_100014778 3300005578 Bacteria 5155
90 Ga0068856_100021637 3300005614 Bacteria 6250
91 Ga0068859_100004127 3300005617 Bacteria 14824
92 Ga0068859_100005846 3300005617 Bacteria 12490
93 Ga0068859_100022413 3300005617 Bacteria 6332
94 Ga0068859_100029624 3300005617 Bacteria 5492
95 Ga0068859_100126160 3300005617 Bacteria 2628
96 Ga0068864_100150482 3300005618 Bacteria 2108
97 Ga0068866_10007609 3300005718 Bacteria 4540
98 Ga0068866_10089192 3300005718 Bacteria 1675
99 Ga0068870_10004555 3300005840 Bacteria 5971
100 Ga0068870_10012706 3300005840 Bacteria 3942
101 Ga0068870_10083172 3300005840 Bacteria 1774
102 Ga0068863_100034331 3300005841 Bacteria 4832
103 Ga0068863_100040149 3300005841 Bacteria 4450
104 Ga0068863_100041183 3300005841 Bacteria 4391
105 Ga0068858_100003043 3300005842 Bacteria 16801
106 Ga0068860_100002130 3300005843 Bacteria 20879
107 Ga0068860_100006442 3300005843 Bacteria 11786
108 Ga0068860_100159228 3300005843 Bacteria 2176
109 Ga0068860_100209419 3300005843 Bacteria 1891
110 Ga0068862_100017535 3300005844 Bacteria 5963
111 Ga0068862_100055597 3300005844 Bacteria 3390
112 Ga0081539_10000142 3300005985 Bacteria 165444
113 Ga0081539_10000215 3300005985 Bacteria 135054
114 Ga0081539_10000774 3300005985 Bacteria 62836
115 Ga0081539_10001077 3300005985 Bacteria 49686
116 Ga0081539_10003567 3300005985 Bacteria 18891
117 Ga0097621_100000001 3300006237 Bacteria 632268
118 Ga0097621_100051290 3300006237 Bacteria 3357
119 Ga0097621_100133575 3300006237 Bacteria 2114
120 Ga0068871_100000008 3300006358 Bacteria 115827
121 Ga0075428_100038993 3300006844 Bacteria 5228
122 Ga0075428_100090736 3300006844 Bacteria 3333
123 Ga0075429_100059338 3300006880 Bacteria 3332
124 Ga0068865_100014854 3300006881 Bacteria 4955
125 Ga0068865_100037016 3300006881 Unclassified 3293
126 Ga0068865_100042201 3300006881 Bacteria 3110
127 Ga0097620_100004127 3300006931 Bacteria 14824
128 Ga0097620_100005846 3300006931 Bacteria 12490
129 Ga0097620_100022413 3300006931 Bacteria 6332
130 Ga0097620_100029624 3300006931 Bacteria 5492
131 Ga0097620_100126169 3300006931 Bacteria 2628
132 Ga0105251_10015574 3300009011 Bacteria 4147
133 Ga0105240_10036923 3300009093 Bacteria 6281
134 Ga0105240_10100811 3300009093 Bacteria 3513
135 Ga0111539_10041921 3300009094 Bacteria 5500
136 Ga0111539_10132982 3300009094 Bacteria 2913
137 Ga0111539_10168940 3300009094 Bacteria 2556
138 Ga0105245_10257415 3300009098 Bacteria 1697
139 Ga0105247_10006473 3300009101 Bacteria 7248
140 Ga0105241_10016971 3300009174 Bacteria 5343
141 Ga0105241_10041635 3300009174 Bacteria 3472
142 Ga0105248_10007566 3300009177 Bacteria 11929
143 Ga0105248_10011237 3300009177 Bacteria 9875
144 Ga0105248_10014265 3300009177 Bacteria 8747
145 Ga0105237_10019779 3300009545 Bacteria 6952
146 Ga0105249_10006745 3300009553 Bacteria 10005
147 Ga0105249_10127938 3300009553 Bacteria 2421
148 Ga0105032_100013 3300009979 Bacteria 60280
149 Ga0157373_10045474 3300013100 Bacteria 3133
150 Ga0157370_10155908 3300013104 Bacteria 2124
151 Ga0157369_10124723 3300013105 Bacteria 2731
152 Ga0157374_10007120 3300013296 Bacteria 9527
153 Ga0157378_10004740 3300013297 Bacteria 11919
154 Ga0157378_10023610 3300013297 Bacteria 5408
155 Ga0163162_10222449 3300013306 Bacteria 2017
156 Ga0163162_10293185 3300013306 Bacteria 1758
157 Ga0157372_10010632 3300013307 Bacteria 9793
158 Ga0157372_10150737 3300013307 Bacteria 2684
159 Ga0157375_10012081 3300013308 Bacteria 7649
160 Ga0157375_10015710 3300013308 Bacteria 6783
161 Ga0157375_10017949 3300013308 Bacteria 6404
162 Ga0157375_10047091 3300013308 Bacteria 4208
163 Ga0157375_10059084 3300013308 Bacteria 3797
164 Ga0157375_10094694 3300013308 Bacteria 3056
165 Ga0157375_10103833 3300013308 Bacteria 2930
166 Ga0157375_10138855 3300013308 Bacteria 2556
167 Ga0163163_10018016 3300014325 Bacteria 6597
168 Ga0163163_10038641 3300014325 Bacteria 4653
169 Ga0163163_10049421 3300014325 Bacteria 4139
170 Ga0163163_10060166 3300014325 Bacteria 3760
171 Ga0157380_10003563 3300014326 Bacteria 10703
172 Ga0157380_10012102 3300014326 Bacteria 6245
173 Ga0157380_10012941 3300014326 Bacteria 6065
174 Ga0157380_10221639 3300014326 Bacteria 1692
175 Ga0157380_10230488 3300014326 Bacteria 1663
176 Ga0157379_10003522 3300014968 Bacteria 13256
177 Ga0157379_10013744 3300014968 Bacteria 7096
178 Ga0157376_10013865 3300014969 Bacteria 6025
179 Ga0157376_10038513 3300014969 Bacteria 3891
180 Ga0157376_10158037 3300014969 Bacteria 2052
181 Ga0163161_10001072 3300017792 Bacteria 20708
182 Ga0163161_10001108 3300017792 Bacteria 20363
183 Ga0163161_10024536 3300017792 Bacteria 4261
184 Ga0207697_10004263 3300025315 Bacteria 6862
185 Ga0207682_10007456 3300025893 Bacteria 4357
186 Ga0207710_10003101 3300025900 Bacteria 7457
187 Ga0207688_10000138 3300025901 Bacteria 30845
188 Ga0207680_10001213 3300025903 Bacteria 12209
189 Ga0207680_10038827 3300025903 Bacteria 2758
190 Ga0207680_10068326 3300025903 Bacteria 2192
191 Ga0207645_10007548 3300025907 Bacteria 7671
192 Ga0207643_10005601 3300025908 Bacteria 6712
193 Ga0207643_10016494 3300025908 Bacteria 4030
194 Ga0207705_10006296 3300025909 Bacteria 8811
195 Ga0207684_10170055 3300025910 Bacteria 1879
196 Ga0207684_10249635 3300025910 Bacteria 1531
197 Ga0207654_10017310 3300025911 Bacteria 3764
198 Ga0207654_10061879 3300025911 Bacteria 2191
199 Ga0207707_10016269 3300025912 Bacteria 6488
200 Ga0207707_10028210 3300025912 Bacteria 4906
201 Ga0207695_10028294 3300025913 Bacteria 6220
202 Ga0207671_10025212 3300025914 Bacteria 4467
203 Ga0207660_10126241 3300025917 Bacteria 1943
204 Ga0207660_10145241 3300025917 Bacteria 1817
205 Ga0207657_10125862 3300025919 Bacteria 2105
206 Ga0207657_10137771 3300025919 Bacteria 1996
207 Ga0207652_10046800 3300025921 Bacteria 3693
208 Ga0207646_10000857 3300025922 Bacteria 39355
209 Ga0207646_10223392 3300025922 Bacteria 1702
210 Ga0207681_10067602 3300025923 Bacteria 2478
211 Ga0207650_10010269 3300025925 Bacteria 6419
212 Ga0207650_10083570 3300025925 Bacteria 2425
213 Ga0207659_10004936 3300025926 Bacteria 8083
214 Ga0207659_10012274 3300025926 Bacteria 5444
215 Ga0207659_10081323 3300025926 Bacteria 2395
216 Ga0207659_10089318 3300025926 Bacteria 2298
217 Ga0207659_10180353 3300025926 Bacteria 1673
218 Ga0207687_10180229 3300025927 Bacteria 1636
219 Ga0207644_10016021 3300025931 Bacteria 5039
220 Ga0207690_10009294 3300025932 Bacteria 5841
221 Ga0207706_10003153 3300025933 Bacteria 15835
222 Ga0207706_10015090 3300025933 Bacteria 6993
223 Ga0207706_10058294 3300025933 Bacteria 3401
224 Ga0207686_10119666 3300025934 Bacteria 1790
225 Ga0207670_10012126 3300025936 Bacteria 5030
226 Ga0207670_10013879 3300025936 Bacteria 4767
227 Ga0207669_10000261 3300025937 Bacteria 23967
228 Ga0207704_10018604 3300025938 Unclassified 3631
229 Ga0207704_10030682 3300025938 Bacteria 3017
230 Ga0207691_10000613 3300025940 Bacteria 35487
231 Ga0207691_10027826 3300025940 Bacteria 5298
232 Ga0207691_10031847 3300025940 Bacteria 4921
233 Ga0207691_10053085 3300025940 Bacteria 3701
234 Ga0207711_10002096 3300025941 Bacteria 18010
235 Ga0207711_10003020 3300025941 Bacteria 14715
236 Ga0207711_10018075 3300025941 Bacteria 5862
237 Ga0207689_10022031 3300025942 Bacteria 5358
238 Ga0207689_10035643 3300025942 Bacteria 4132
239 Ga0207679_10010272 3300025945 Bacteria 6024
240 Ga0207679_10163973 3300025945 Bacteria 1822
241 Ga0207651_10001819 3300025960 Bacteria 9936
242 Ga0207651_10022932 3300025960 Bacteria 3829
243 Ga0207651_10042035 3300025960 Bacteria 3038
244 Ga0207651_10083171 3300025960 Bacteria 2314
245 Ga0207712_10135779 3300025961 Bacteria 1881
246 Ga0207668_10070245 3300025972 Bacteria 2496
247 Ga0207668_10087871 3300025972 Bacteria 2275
248 Ga0207668_10106905 3300025972 Bacteria 2091
249 Ga0207668_10423394 3300025972 Bacteria 1131
250 Ga0207640_10071426 3300025981 Bacteria 2338
251 Ga0207658_10001443 3300025986 Bacteria 18534
252 Ga0207658_10078060 3300025986 Bacteria 2529
253 Ga0207658_10132549 3300025986 Bacteria 2004
254 Ga0207658_10248652 3300025986 Bacteria 1510
255 Ga0207677_10102104 3300026023 Bacteria 2113
256 Ga0207703_10003416 3300026035 Bacteria 13331
257 Ga0207703_10018147 3300026035 Bacteria 5495
258 Ga0207639_10000028 3300026041 Bacteria 197736
259 Ga0207639_10009238 3300026041 Bacteria 6796
260 Ga0207639_10017290 3300026041 Bacteria 5112
261 Ga0207639_10023873 3300026041 Bacteria 4419
262 Ga0207702_10006194 3300026078 Bacteria 10349
263 Ga0207641_10018902 3300026088 Bacteria 5652
264 Ga0207641_10043010 3300026088 Bacteria 3791
265 Ga0207641_10112962 3300026088 Bacteria 2411
266 Ga0207648_10073417 3300026089 Bacteria 2981
267 Ga0207648_10162856 3300026089 Bacteria 1970
268 Ga0207648_10190619 3300026089 Bacteria 1817
269 Ga0207648_10337686 3300026089 Bacteria 1356
270 Ga0207676_10014190 3300026095 Bacteria 5723
271 Ga0207676_10031622 3300026095 Bacteria 3981
272 Ga0207676_10118059 3300026095 Bacteria 2232
273 Ga0207675_100014336 3300026118 Bacteria 7390
274 Ga0207683_10058082 3300026121 Bacteria 3397
275 Ga0207683_10126301 3300026121 Bacteria 2299
276 Ga0268265_10053861 3300028380 Bacteria 3049
277 Ga0268265_10364115 3300028380 Bacteria 1325
278 Ga0268264_10002068 3300028381 Bacteria 17912
279 Ga0268264_10095856 3300028381 Bacteria 2568
280 Ga0268264_10200575 3300028381 Bacteria 1825
281 Ga0316181_1178762 3300030744 Unclassified 4948
282 Ga0316182_1129063 3300030745 Bacteria 8205
283 Ga0265760_10000001 3300031090 Bacteria 217786
284 Ga0307513_10018912 3300031456 Bacteria 8214
285 Ga0307408_100016916 3300031548 Bacteria 4874
286 Ga0307408_100046773 3300031548 Bacteria 3096
287 Ga0307408_100061172 3300031548 Bacteria 2748
288 Ga0316579_10078449 3300031691 Bacteria 1570
289 Ga0316576_10006608 3300031727 Bacteria 7240
290 Ga0316576_10072416 3300031727 Bacteria 2544
291 Ga0316578_10010926 3300031728 Bacteria 4730
292 Ga0307405_10003702 3300031731 Bacteria 7094
293 Ga0316577_10059683 3300031733 Bacteria 2129
294 Ga0307413_10000152 3300031824 Bacteria 18766
295 Ga0307413_10044487 3300031824 Bacteria 2624
296 Ga0307410_10000489 3300031852 Bacteria 16061
297 Ga0307410_10005631 3300031852 Bacteria 6657
298 Ga0307410_10034681 3300031852 Bacteria 3271
299 Ga0307410_10151195 3300031852 Bacteria 1729
300 Ga0307410_10170920 3300031852 Bacteria 1638
301 Ga0307406_10000001 3300031901 Bacteria 638191
302 Ga0307406_10000396 3300031901 Bacteria 25166
303 Ga0307406_10012042 3300031901 Bacteria 4920
304 Ga0307406_10024563 3300031901 Bacteria 3601
305 Ga0307406_10160497 3300031901 Unclassified 1615
306 Ga0307407_10001375 3300031903 Bacteria 8770
307 Ga0307407_10003586 3300031903 Bacteria 6411
308 Ga0307412_10007501 3300031911 Bacteria 6192
309 Ga0307409_100005179 3300031995 Bacteria 7454
310 Ga0307409_100009325 3300031995 Bacteria 6022
311 Ga0307409_100029818 3300031995 Bacteria 3910
312 Ga0307409_100101650 3300031995 Bacteria 2386
313 Ga0307416_100018228 3300032002 Bacteria 4939
314 Ga0307416_100026194 3300032002 Bacteria 4292
315 Ga0307416_100070366 3300032002 Bacteria 2901
316 Ga0307416_100171063 3300032002 Bacteria 2022
317 Ga0307414_10155352 3300032004 Bacteria 1810
318 Ga0307411_10000428 3300032005 Bacteria 14309
319 Ga0307411_10002914 3300032005 Bacteria 7751
320 Ga0307411_10064770 3300032005 Bacteria 2448
321 Ga0307411_10088042 3300032005 Bacteria 2158
322 Ga0307415_100003961 3300032126 Bacteria 7618
323 Ga0316583_10016170 3300032133 Bacteria 2686
324 Ga0316580_10003201 3300032139 Bacteria 4630
325 Ga0373941_0016481 3300035115 Bacteria 2010
326 Ga0373943_0030178 3300035170 Bacteria 2565
327 Ga0316574_0002989 3300035398 Bacteria 8618
328 Ga0373937_0010711 3300036401 Bacteria 8021
329 Ga0373937_0064619 3300036401 Bacteria 3366
330 Ga0316582_0002936 3300036647 Bacteria 8200
331 Ga0316584_0007900 3300036712 Bacteria 7299
332 Ga0316584_0218613 3300036712 Bacteria 1401
333 Ga0373925_0025006 3300037068 Bacteria 4361
334 Ga0395905_0088405 3300037471 Bacteria 2904
335 Ga0451849_0221456 3300041505 Unclassified 1385
336 Ga0439432_014852 3300042006 Bacteria 2633
337 Ga0450918_002204 3300042531 Bacteria 3707
338 Ga0451576_0197092 3300045051 Bacteria 2104
339 Ga0495629_0017839 3300046459 Bacteria 5087
340 Ga0495580_0000277 3300046472 Bacteria 41482
341 Ga0495580_0088459 3300046472 Bacteria 2157
342 Ga0495628_0041149 3300046516 Bacteria 3690
343 Ga0495586_0019498 3300046535 Bacteria 3611
344 Ga0495668_0000680 3300046616 Bacteria 40954
345 Ga0495635_0027632 3300046663 Bacteria 3946
346 Ga0496100_0075161 3300048903 Bacteria 2265
347 Ga0496101_0040854 3300048904 Bacteria 3304
348 Ga0496102_0007939 3300048905 Bacteria 9071
349 Ga0496104_0028713 3300048907 Bacteria 5156
350 Ga0496104_0145251 3300048907 Bacteria 2278
351 Ga0496106_0005984 3300048909 Bacteria 8992
352 Ga0496107_0000350 3300048910 Bacteria 25076
353 Ga0496107_0166673 3300048910 Bacteria 1634
354 Ga0496108_0075716 3300048911 Bacteria 2844
355 Ga0496109_0006330 3300048912 Bacteria 9972
356 Ga0496109_0107526 3300048912 Bacteria 2591
357 Ga0496110_0011038 3300048913 Bacteria 7374
358 Ga0496114_0024798 3300048917 Bacteria 4897
359 Ga0496115_0000001 3300048918 Bacteria 367230
360 Ga0501296_000408 3300049519 Bacteria 4224
361 Ga0501298_003876 3300049521 Unclassified 2334
362 Ga0501300_007196 3300049523 Bacteria 1630
363 Ga0501038_0002334 3300049574 Bacteria 17675
364 Ga0501071_0136726 3300049587 Bacteria 1824
365 Ga0501072_0034982 3300049588 Unclassified 3937
366 Ga0501202_003452 3300049652 Unclassified 2707
367 Ga0501235_019104 3300049669 Unclassified 1520
368 Ga0501235_019474 3300049669 Bacteria 1506
369 Ga0501249_013224 3300049679 Bacteria 1752
370 Ga0501257_009498 3300049686 Bacteria 2198
371 Ga0501225_0008209 3300049705 Bacteria 3003
372 Ga0501245_003510 3300049708 Unclassified 2133
373 Ga0501267_001987 3300049764 Bacteria 1804
374 Ga0501283_001636 3300049779 Bacteria 2915
375 Ga0501212_008849 3300049851 Unclassified 1407
376 nmdc:mga05p37_614772_c1 3300050507 Bacteria 1224
377 nmdc:mga08y16_142985_c1 3300050511 Bacteria 2487
378 nmdc:mga08y16_23697_c1 3300050511 Bacteria 6481
379 nmdc:mga08y16_59322_c1 3300050511 Bacteria 3997
380 nmdc:mga0a205_168346_c1 3300050515 Bacteria 2087
381 Ga0495601_0072775 3300053077 Bacteria 2196
382 Ga0495595_0003406 3300053084 Bacteria 6315
383 Ga0495619_0012361 3300053085 Bacteria 5374
384 Ga0500655_000541 3300053133 Bacteria 7596
385 Ga0500577_0011642 3300053142 Bacteria 2632
386 Ga0500616_0003819 3300053153 Bacteria 11176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042531 Ga0450918_002204 Ga0450918_002204_21_1019 297
2 3300025972 Ga0207668_10423394 Ga0207668_104233941 326
3 3300036401 Ga0373937_0010711 Ga0373937_0010711_3270_4472 328
4 3300046459 Ga0495629_0017839 Ga0495629_0017839_2945_4147 328
5 3300046516 Ga0495628_0041149 Ga0495628_0041149_2197_3399 328
6 3300046663 Ga0495635_0027632 Ga0495635_0027632_427_1629 328
7 3300053084 Ga0495595_0003406 Ga0495595_0003406_3204_4406 328
8 3300053085 Ga0495619_0012361 Ga0495619_0012361_3988_5190 328
9 3300006237 Ga0097621_100133575 Ga0097621_1001335752 329
10 3300014326 Ga0157380_10012102 Ga0157380_100121022 333
11 3300005457 Ga0070662_100020082 Ga0070662_1000200822 340
12 3300005458 Ga0070681_10175953 Ga0070681_101759532 340
13 3300005539 Ga0068853_100012966 Ga0068853_1000129664 340
14 3300005564 Ga0070664_100085321 Ga0070664_1000853213 340
15 3300025917 Ga0207660_10126241 Ga0207660_101262412 340
16 3300025945 Ga0207679_10010272 Ga0207679_100102725 340
17 3300026041 Ga0207639_10023873 Ga0207639_100238732 340
18 3300049588 Ga0501072_0034982 Ga0501072_0034982_2460_3650 340
19 3300049669 Ga0501235_019474 Ga0501235_019474_259_1449 340
20 3300049679 Ga0501249_013224 Ga0501249_013224_516_1706 340
21 3300049686 Ga0501257_009498 Ga0501257_009498_172_1362 340
22 3300049764 Ga0501267_001987 Ga0501267_001987_331_1521 340
23 3300031090 Ga0265760_10000001 Ga0265760_1000000111 343
24 3300041505 Ga0451849_0221456 Ga0451849_0221456_173_1363 343
25 3300005355 Ga0070671_100127434 Ga0070671_1001274342 344
26 3300042006 Ga0439432_014852 Ga0439432_014852_447_1637 344
27 3300049851 Ga0501212_008849 Ga0501212_008849_13_1197 345
28 3300013297 Ga0157378_10023610 Ga0157378_100236103 346
29 3300025315 Ga0207697_10004263 Ga0207697_100042633 346
30 3300003203 JGI25406J46586_10003455 JGI25406J46586_100034555 347
31 3300005331 Ga0070670_100016313 Ga0070670_1000163134 347
32 3300005333 Ga0070677_10005406 Ga0070677_100054063 347
33 3300005366 Ga0070659_100007530 Ga0070659_1000075304 347
34 3300005367 Ga0070667_100021166 Ga0070667_1000211662 347
35 3300005985 Ga0081539_10000215 Ga0081539_10000215105 347
36 3300006881 Ga0068865_100014854 Ga0068865_1000148543 347
37 3300013308 Ga0157375_10094694 Ga0157375_100946942 347
38 3300014325 Ga0163163_10018016 Ga0163163_100180165 347
39 3300014326 Ga0157380_10012941 Ga0157380_100129412 347
40 3300025907 Ga0207645_10007548 Ga0207645_100075485 347
41 3300025908 Ga0207643_10005601 Ga0207643_100056013 347
42 3300025919 Ga0207657_10137771 Ga0207657_101377712 347
43 3300025923 Ga0207681_10067602 Ga0207681_100676022 347
44 3300025926 Ga0207659_10081323 Ga0207659_100813231 347
45 3300025932 Ga0207690_10009294 Ga0207690_100092944 347
46 3300025933 Ga0207706_10003153 Ga0207706_100031537 347
47 3300025938 Ga0207704_10030682 Ga0207704_100306822 347
48 3300025940 Ga0207691_10000613 Ga0207691_1000061328 347
49 3300025942 Ga0207689_10022031 Ga0207689_100220314 347
50 3300025972 Ga0207668_10070245 Ga0207668_100702452 347
51 3300025986 Ga0207658_10078060 Ga0207658_100780602 347
52 3300026118 Ga0207675_100014336 Ga0207675_1000143362 347
53 3300048907 Ga0496104_0145251 Ga0496104_0145251_187_1386 347
54 3300048912 Ga0496109_0006330 Ga0496109_0006330_8397_9596 347
55 3300048917 Ga0496114_0024798 Ga0496114_0024798_1559_2758 347
56 3300050511 nmdc:mga08y16_142985_c1 nmdc:mga08y16_142985_c1_746_1948 347
57 3300005333 Ga0070677_10004389 Ga0070677_100043892 348
58 3300005456 Ga0070678_100039578 Ga0070678_1000395782 348
59 3300014326 Ga0157380_10003563 Ga0157380_100035639 348
60 3300026121 Ga0207683_10058082 Ga0207683_100580822 348
61 3300005295 Ga0065707_10003001 Ga0065707_100030011 349
62 3300005354 Ga0070675_100061289 Ga0070675_1000612891 349
63 3300005365 Ga0070688_100102831 Ga0070688_1001028311 349
64 3300005539 Ga0068853_100200391 Ga0068853_1002003912 349
65 3300005577 Ga0068857_100187544 Ga0068857_1001875442 349
66 3300009553 Ga0105249_10127938 Ga0105249_101279382 349
67 3300014326 Ga0157380_10221639 Ga0157380_102216392 349
68 3300025914 Ga0207671_10025212 Ga0207671_100252124 349
69 3300026041 Ga0207639_10017290 Ga0207639_100172904 349
70 3300009094 Ga0111539_10041921 Ga0111539_100419214 350
71 3300050511 nmdc:mga08y16_23697_c1 nmdc:mga08y16_23697_c1_951_2141 350
72 3300053142 Ga0500577_0011642 Ga0500577_0011642_709_1908 350
73 3300005841 Ga0068863_100034331 Ga0068863_1000343311 352
74 3300013307 Ga0157372_10150737 Ga0157372_101507372 353
75 3300014969 Ga0157376_10158037 Ga0157376_101580372 353
76 3300031691 Ga0316579_10078449 Ga0316579_100784492 353
77 3300031727 Ga0316576_10006608 Ga0316576_100066081 353
78 3300031728 Ga0316578_10010926 Ga0316578_100109263 353
79 3300031733 Ga0316577_10059683 Ga0316577_100596832 353
80 3300032133 Ga0316583_10016170 Ga0316583_100161702 353
81 3300032139 Ga0316580_10003201 Ga0316580_100032014 353
82 3300035398 Ga0316574_0002989 Ga0316574_0002989_4906_6108 353
83 3300036647 Ga0316582_0002936 Ga0316582_0002936_4371_5573 353
84 3300036712 Ga0316584_0007900 Ga0316584_0007900_2430_3632 353
85 3300049587 Ga0501071_0136726 Ga0501071_0136726_71_1273 353
86 3300005331 Ga0070670_100139703 Ga0070670_1001397031 354
87 3300005344 Ga0070661_100058165 Ga0070661_1000581652 354
88 3300013306 Ga0163162_10222449 Ga0163162_102224491 354
89 3300025940 Ga0207691_10031847 Ga0207691_100318474 354
90 3300031548 Ga0307408_100061172 Ga0307408_1000611722 354
91 3300031903 Ga0307407_10003586 Ga0307407_100035865 354
92 3300031995 Ga0307409_100005179 Ga0307409_1000051797 354
93 3300005340 Ga0070689_100018452 Ga0070689_1000184522 355
94 3300005366 Ga0070659_100220620 Ga0070659_1002206202 355
95 3300005539 Ga0068853_100072293 Ga0068853_1000722933 355
96 3300009093 Ga0105240_10036923 Ga0105240_100369232 355
97 3300013308 Ga0157375_10103833 Ga0157375_101038332 355
98 3300025913 Ga0207695_10028294 Ga0207695_100282945 355
99 3300025936 Ga0207670_10013879 Ga0207670_100138793 355
100 3300026041 Ga0207639_10000028 Ga0207639_10000028177 355
101 3300031548 Ga0307408_100016916 Ga0307408_1000169165 355
102 3300031824 Ga0307413_10044487 Ga0307413_100444872 355
103 3300031852 Ga0307410_10005631 Ga0307410_100056312 355
104 3300031852 Ga0307410_10034681 Ga0307410_100346812 355
105 3300031901 Ga0307406_10024563 Ga0307406_100245633 355
106 3300031901 Ga0307406_10160497 Ga0307406_101604972 355
107 3300031911 Ga0307412_10007501 Ga0307412_100075015 355
108 3300031995 Ga0307409_100029818 Ga0307409_1000298183 355
109 3300032002 Ga0307416_100018228 Ga0307416_1000182282 355
110 3300032005 Ga0307411_10002914 Ga0307411_100029147 355
111 3300035115 Ga0373941_0016481 Ga0373941_0016481_646_1848 355
112 3300050507 nmdc:mga05p37_614772_c1 nmdc:mga05p37_614772_c1_29_1201 355
113 3300005347 Ga0070668_100076235 Ga0070668_1000762352 356
114 3300005467 Ga0070706_100000942 Ga0070706_10000094212 356
115 3300005468 Ga0070707_100122523 Ga0070707_1001225232 356
116 3300005549 Ga0070704_100009379 Ga0070704_1000093794 356
117 3300017792 Ga0163161_10001108 Ga0163161_1000110814 356
118 3300025910 Ga0207684_10249635 Ga0207684_102496351 356
119 3300025972 Ga0207668_10106905 Ga0207668_101069052 356
120 3300053077 Ga0495601_0072775 Ga0495601_0072775_408_1640 356
121 3300005295 Ga0065707_10008026 Ga0065707_100080263 357
122 3300005333 Ga0070677_10040580 Ga0070677_100405802 357
123 3300005334 Ga0068869_100151198 Ga0068869_1001511981 357
124 3300005356 Ga0070674_100002090 Ga0070674_1000020906 357
125 3300005467 Ga0070706_100002886 Ga0070706_1000028864 357
126 3300005546 Ga0070696_100048869 Ga0070696_1000488692 357
127 3300005618 Ga0068864_100150482 Ga0068864_1001504822 357
128 3300005840 Ga0068870_10004555 Ga0068870_100045552 357
129 3300005840 Ga0068870_10012706 Ga0068870_100127062 357
130 3300005985 Ga0081539_10003567 Ga0081539_100035677 357
131 3300006237 Ga0097621_100051290 Ga0097621_1000512903 357
132 3300009094 Ga0111539_10168940 Ga0111539_101689402 357
133 3300013308 Ga0157375_10047091 Ga0157375_100470913 357
134 3300025893 Ga0207682_10007456 Ga0207682_100074563 357
135 3300025901 Ga0207688_10000138 Ga0207688_1000013833 357
136 3300025903 Ga0207680_10068326 Ga0207680_100683262 357
137 3300025908 Ga0207643_10016494 Ga0207643_100164943 357
138 3300025925 Ga0207650_10083570 Ga0207650_100835701 357
139 3300025926 Ga0207659_10012274 Ga0207659_100122743 357
140 3300025933 Ga0207706_10058294 Ga0207706_100582942 357
141 3300025937 Ga0207669_10000261 Ga0207669_100002618 357
142 3300025942 Ga0207689_10035643 Ga0207689_100356432 357
143 3300025972 Ga0207668_10087871 Ga0207668_100878712 357
144 3300025986 Ga0207658_10248652 Ga0207658_102486522 357
145 3300026023 Ga0207677_10102104 Ga0207677_101021042 357
146 3300026089 Ga0207648_10162856 Ga0207648_101628562 357
147 3300026121 Ga0207683_10126301 Ga0207683_101263012 357
148 3300032002 Ga0307416_100070366 Ga0307416_1000703663 357
149 3300035170 Ga0373943_0030178 Ga0373943_0030178_1147_2349 357
150 3300036401 Ga0373937_0064619 Ga0373937_0064619_1650_2852 357
151 3300037068 Ga0373925_0025006 Ga0373925_0025006_2089_3291 357
152 3300046472 Ga0495580_0000277 Ga0495580_0000277_21472_22674 357
153 3300046472 Ga0495580_0088459 Ga0495580_0088459_299_1501 357
154 3300046535 Ga0495586_0019498 Ga0495586_0019498_1379_2581 357
155 3300050515 nmdc:mga0a205_168346_c1 nmdc:mga0a205_168346_c1_135_1337 357
156 3300005290 Ga0065712_10102031 Ga0065712_101020312 358
157 3300005293 Ga0065715_10110425 Ga0065715_101104252 358
158 3300005293 Ga0065715_10111462 Ga0065715_101114622 358
159 3300005330 Ga0070690_100008369 Ga0070690_1000083695 358
160 3300005335 Ga0070666_10048341 Ga0070666_100483412 358
161 3300005338 Ga0068868_100032703 Ga0068868_1000327034 358
162 3300005340 Ga0070689_100064430 Ga0070689_1000644302 358
163 3300005367 Ga0070667_100004810 Ga0070667_1000048106 358
164 3300005445 Ga0070708_100049009 Ga0070708_1000490092 358
165 3300005445 Ga0070708_100114761 Ga0070708_1001147612 358
166 3300005466 Ga0070685_10058527 Ga0070685_100585272 358
167 3300005617 Ga0068859_100029624 Ga0068859_1000296243 358
168 3300005841 Ga0068863_100040149 Ga0068863_1000401492 358
169 3300005843 Ga0068860_100006442 Ga0068860_1000064424 358
170 3300006881 Ga0068865_100037016 Ga0068865_1000370162 358
171 3300006931 Ga0097620_100029624 Ga0097620_1000296243 358
172 3300009011 Ga0105251_10015574 Ga0105251_100155741 358
173 3300009094 Ga0111539_10132982 Ga0111539_101329822 358
174 3300009098 Ga0105245_10257415 Ga0105245_102574152 358
175 3300013296 Ga0157374_10007120 Ga0157374_100071202 358
176 3300013308 Ga0157375_10012081 Ga0157375_100120811 358
177 3300014325 Ga0163163_10060166 Ga0163163_100601662 358
178 3300014968 Ga0157379_10013744 Ga0157379_100137442 358
179 3300014969 Ga0157376_10038513 Ga0157376_100385132 358
180 3300017792 Ga0163161_10001072 Ga0163161_100010727 358
181 3300025910 Ga0207684_10170055 Ga0207684_101700552 358
182 3300025922 Ga0207646_10223392 Ga0207646_102233922 358
183 3300025927 Ga0207687_10180229 Ga0207687_101802291 358
184 3300025931 Ga0207644_10016021 Ga0207644_100160212 358
185 3300025936 Ga0207670_10012126 Ga0207670_100121265 358
186 3300025938 Ga0207704_10018604 Ga0207704_100186041 358
187 3300025941 Ga0207711_10003020 Ga0207711_100030208 358
188 3300025945 Ga0207679_10163973 Ga0207679_101639731 358
189 3300026035 Ga0207703_10018147 Ga0207703_100181476 358
190 3300026088 Ga0207641_10043010 Ga0207641_100430102 358
191 3300026095 Ga0207676_10014190 Ga0207676_100141902 358
192 3300028380 Ga0268265_10364115 Ga0268265_103641151 358
193 3300031824 Ga0307413_10000152 Ga0307413_1000015212 358
194 3300031903 Ga0307407_10001375 Ga0307407_100013754 358
195 3300031995 Ga0307409_100009325 Ga0307409_1000093253 358
196 3300032004 Ga0307414_10155352 Ga0307414_101553522 358
197 3300032005 Ga0307411_10064770 Ga0307411_100647701 358
198 3300005328 Ga0070676_10020694 Ga0070676_100206942 359
199 3300005457 Ga0070662_100007403 Ga0070662_1000074034 359
200 3300005546 Ga0070696_100083352 Ga0070696_1000833521 359
201 3300005617 Ga0068859_100022413 Ga0068859_1000224134 359
202 3300005843 Ga0068860_100209419 Ga0068860_1002094192 359
203 3300005844 Ga0068862_100055597 Ga0068862_1000555971 359
204 3300006931 Ga0097620_100022413 Ga0097620_1000224133 359
205 3300013308 Ga0157375_10059084 Ga0157375_100590842 359
206 3300025917 Ga0207660_10145241 Ga0207660_101452412 359
207 3300025933 Ga0207706_10015090 Ga0207706_100150904 359
208 3300028381 Ga0268264_10200575 Ga0268264_102005751 359
209 3300000549 LJQas_1000002 LJQas_100000236 360
210 3300003203 JGI25406J46586_10000363 JGI25406J46586_100003632 360
211 3300005330 Ga0070690_100000511 Ga0070690_1000005113 360
212 3300005335 Ga0070666_10000356 Ga0070666_100003568 360
213 3300005336 Ga0070680_100007149 Ga0070680_1000071496 360
214 3300005365 Ga0070688_100142695 Ga0070688_1001426951 360
215 3300005367 Ga0070667_100001010 Ga0070667_10000101019 360
216 3300005459 Ga0068867_100019387 Ga0068867_1000193871 360
217 3300005468 Ga0070707_100000484 Ga0070707_10000048435 360
218 3300005543 Ga0070672_100013495 Ga0070672_1000134955 360
219 3300005547 Ga0070693_100095002 Ga0070693_1000950022 360
220 3300005564 Ga0070664_100103219 Ga0070664_1001032192 360
221 3300005614 Ga0068856_100021637 Ga0068856_1000216372 360
222 3300005617 Ga0068859_100004127 Ga0068859_10000412711 360
223 3300005718 Ga0068866_10007609 Ga0068866_100076093 360
224 3300005841 Ga0068863_100041183 Ga0068863_1000411832 360
225 3300005842 Ga0068858_100003043 Ga0068858_1000030434 360
226 3300005843 Ga0068860_100002130 Ga0068860_1000021308 360
227 3300005985 Ga0081539_10000142 Ga0081539_1000014262 360
228 3300006844 Ga0075428_100038993 Ga0075428_1000389932 360
229 3300006881 Ga0068865_100042201 Ga0068865_1000422012 360
230 3300006931 Ga0097620_100004127 Ga0097620_1000041272 360
231 3300009093 Ga0105240_10100811 Ga0105240_101008112 360
232 3300009174 Ga0105241_10041635 Ga0105241_100416352 360
233 3300009177 Ga0105248_10007566 Ga0105248_100075664 360
234 3300009177 Ga0105248_10011237 Ga0105248_100112376 360
235 3300009545 Ga0105237_10019779 Ga0105237_100197793 360
236 3300013297 Ga0157378_10004740 Ga0157378_1000474011 360
237 3300013308 Ga0157375_10017949 Ga0157375_100179492 360
238 3300014968 Ga0157379_10003522 Ga0157379_100035222 360
239 3300014969 Ga0157376_10013865 Ga0157376_100138652 360
240 3300025903 Ga0207680_10001213 Ga0207680_100012134 360
241 3300025911 Ga0207654_10061879 Ga0207654_100618791 360
242 3300025912 Ga0207707_10028210 Ga0207707_100282102 360
243 3300025922 Ga0207646_10000857 Ga0207646_1000085735 360
244 3300025934 Ga0207686_10119666 Ga0207686_101196662 360
245 3300025940 Ga0207691_10053085 Ga0207691_100530852 360
246 3300025941 Ga0207711_10002096 Ga0207711_1000209611 360
247 3300025941 Ga0207711_10018075 Ga0207711_100180754 360
248 3300025960 Ga0207651_10001819 Ga0207651_100018192 360
249 3300025986 Ga0207658_10001443 Ga0207658_100014437 360
250 3300026035 Ga0207703_10003416 Ga0207703_100034164 360
251 3300026078 Ga0207702_10006194 Ga0207702_100061945 360
252 3300026088 Ga0207641_10018902 Ga0207641_100189024 360
253 3300026089 Ga0207648_10190619 Ga0207648_101906192 360
254 3300028381 Ga0268264_10002068 Ga0268264_1000206814 360
255 3300031548 Ga0307408_100046773 Ga0307408_1000467732 360
256 3300031731 Ga0307405_10003702 Ga0307405_100037025 360
257 3300031852 Ga0307410_10000489 Ga0307410_100004899 360
258 3300031995 Ga0307409_100101650 Ga0307409_1001016503 360
259 3300032002 Ga0307416_100026194 Ga0307416_1000261943 360
260 3300032002 Ga0307416_100171063 Ga0307416_1001710632 360
261 3300032005 Ga0307411_10000428 Ga0307411_100004288 360
262 3300032005 Ga0307411_10088042 Ga0307411_100880422 360
263 3300032126 Ga0307415_100003961 Ga0307415_1000039614 360
264 3300046616 Ga0495668_0000680 Ga0495668_0000680_35248_36480 360
265 3300048904 Ga0496101_0040854 Ga0496101_0040854_1972_3174 360
266 3300048905 Ga0496102_0007939 Ga0496102_0007939_3876_5078 360
267 3300048907 Ga0496104_0028713 Ga0496104_0028713_689_1891 360
268 3300048909 Ga0496106_0005984 Ga0496106_0005984_1000_2202 360
269 3300048910 Ga0496107_0000350 Ga0496107_0000350_15961_17163 360
270 3300048911 Ga0496108_0075716 Ga0496108_0075716_496_1698 360
271 3300048912 Ga0496109_0107526 Ga0496109_0107526_809_2011 360
272 3300048913 Ga0496110_0011038 Ga0496110_0011038_3218_4408 360
273 3300049519 Ga0501296_000408 Ga0501296_000408_1145_2374 360
274 3300049521 Ga0501298_003876 Ga0501298_003876_142_1371 360
275 3300049523 Ga0501300_007196 Ga0501300_007196_102_1331 360
276 3300049652 Ga0501202_003452 Ga0501202_003452_1436_2665 360
277 3300049669 Ga0501235_019104 Ga0501235_019104_167_1396 360
278 3300049705 Ga0501225_0008209 Ga0501225_0008209_1172_2401 360
279 3300049708 Ga0501245_003510 Ga0501245_003510_843_2072 360
280 3300049779 Ga0501283_001636 Ga0501283_001636_1063_2292 360
281 3300005293 Ga0065715_10124681 Ga0065715_101246812 361
282 3300005364 Ga0070673_100132892 Ga0070673_1001328922 361
283 3300005549 Ga0070704_100073796 Ga0070704_1000737963 361
284 3300005564 Ga0070664_100080860 Ga0070664_1000808601 361
285 3300005840 Ga0068870_10083172 Ga0068870_100831722 361
286 3300025960 Ga0207651_10083171 Ga0207651_100831712 361
287 3300031852 Ga0307410_10170920 Ga0307410_101709201 361
288 3300003203 JGI25406J46586_10011528 JGI25406J46586_100115282 362
289 3300005293 Ga0065715_10090926 Ga0065715_100909265 362
290 3300005328 Ga0070676_10097674 Ga0070676_100976742 362
291 3300005333 Ga0070677_10041489 Ga0070677_100414892 362
292 3300005347 Ga0070668_100131848 Ga0070668_1001318482 362
293 3300005354 Ga0070675_100070485 Ga0070675_1000704852 362
294 3300005364 Ga0070673_100024896 Ga0070673_1000248962 362
295 3300005543 Ga0070672_100069089 Ga0070672_1000690892 362
296 3300005718 Ga0068866_10089192 Ga0068866_100891922 362
297 3300005985 Ga0081539_10001077 Ga0081539_1000107724 362
298 3300013306 Ga0163162_10293185 Ga0163162_102931851 362
299 3300017792 Ga0163161_10024536 Ga0163161_100245363 362
300 3300025925 Ga0207650_10010269 Ga0207650_100102696 362
301 3300025926 Ga0207659_10089318 Ga0207659_100893183 362
302 3300025940 Ga0207691_10027826 Ga0207691_100278261 362
303 3300025960 Ga0207651_10022932 Ga0207651_100229323 362
304 3300031901 Ga0307406_10012042 Ga0307406_100120424 362
305 3300005366 Ga0070659_100093006 Ga0070659_1000930062 363
306 3300005457 Ga0070662_100086016 Ga0070662_1000860162 363
307 3300005530 Ga0070679_100033135 Ga0070679_1000331352 363
308 3300005539 Ga0068853_100008557 Ga0068853_1000085572 363
309 3300005563 Ga0068855_100049561 Ga0068855_1000495613 363
310 3300005564 Ga0070664_100007144 Ga0070664_1000071445 363
311 3300005578 Ga0068854_100014778 Ga0068854_1000147784 363
312 3300005617 Ga0068859_100005846 Ga0068859_10000584611 363
313 3300005843 Ga0068860_100159228 Ga0068860_1001592282 363
314 3300005844 Ga0068862_100017535 Ga0068862_1000175354 363
315 3300005985 Ga0081539_10000774 Ga0081539_1000077413 363
316 3300006931 Ga0097620_100005846 Ga0097620_1000058464 363
317 3300009101 Ga0105247_10006473 Ga0105247_100064732 363
318 3300009174 Ga0105241_10016971 Ga0105241_100169716 363
319 3300013100 Ga0157373_10045474 Ga0157373_100454743 363
320 3300013104 Ga0157370_10155908 Ga0157370_101559083 363
321 3300013105 Ga0157369_10124723 Ga0157369_101247232 363
322 3300013307 Ga0157372_10010632 Ga0157372_100106328 363
323 3300014325 Ga0163163_10038641 Ga0163163_100386412 363
324 3300014325 Ga0163163_10049421 Ga0163163_100494214 363
325 3300025900 Ga0207710_10003101 Ga0207710_100031013 363
326 3300025912 Ga0207707_10016269 Ga0207707_100162694 363
327 3300025919 Ga0207657_10125862 Ga0207657_101258622 363
328 3300025921 Ga0207652_10046800 Ga0207652_100468002 363
329 3300025926 Ga0207659_10180353 Ga0207659_101803532 363
330 3300025961 Ga0207712_10135779 Ga0207712_101357791 363
331 3300025981 Ga0207640_10071426 Ga0207640_100714262 363
332 3300026088 Ga0207641_10112962 Ga0207641_101129622 363
333 3300026095 Ga0207676_10118059 Ga0207676_101180592 363
334 3300028380 Ga0268265_10053861 Ga0268265_100538612 363
335 3300028381 Ga0268264_10095856 Ga0268264_100958562 363
336 3300031852 Ga0307410_10151195 Ga0307410_101511952 363
337 3300037471 Ga0395905_0088405 Ga0395905_0088405_556_1791 363
338 3300053153 Ga0500616_0003819 Ga0500616_0003819_5132_6361 363
339 3300005345 Ga0070692_10011842 Ga0070692_100118422 364
340 3300031727 Ga0316576_10072416 Ga0316576_100724162 364
341 3300036712 Ga0316584_0218613 Ga0316584_0218613_85_1287 364
342 3300049574 Ga0501038_0002334 Ga0501038_0002334_16321_17550 364
343 3300005334 Ga0068869_100176168 Ga0068869_1001761682 365
344 3300005459 Ga0068867_100027389 Ga0068867_1000273893 365
345 3300005548 Ga0070665_100164211 Ga0070665_1001642112 365
346 3300005617 Ga0068859_100126160 Ga0068859_1001261602 365
347 3300006931 Ga0097620_100126169 Ga0097620_1001261693 365
348 3300009177 Ga0105248_10014265 Ga0105248_100142658 365
349 3300009553 Ga0105249_10006745 Ga0105249_100067452 365
350 3300013308 Ga0157375_10015710 Ga0157375_100157102 365
351 3300025986 Ga0207658_10132549 Ga0207658_101325492 365
352 3300026089 Ga0207648_10073417 Ga0207648_100734173 365
353 3300026095 Ga0207676_10031622 Ga0207676_100316223 365
354 3300006844 Ga0075428_100090736 Ga0075428_1000907362 367
355 3300006880 Ga0075429_100059338 Ga0075429_1000593382 367
356 3300014326 Ga0157380_10230488 Ga0157380_102304881 367
357 3300025926 Ga0207659_10004936 Ga0207659_100049366 367
358 3300050511 nmdc:mga08y16_59322_c1 nmdc:mga08y16_59322_c1_839_2050 367
359 3300005353 Ga0070669_100038779 Ga0070669_1000387792 368
360 3300005364 Ga0070673_100002305 Ga0070673_10000230511 368
361 3300005543 Ga0070672_100047396 Ga0070672_1000473962 368
362 3300025903 Ga0207680_10038827 Ga0207680_100388272 368
363 3300025960 Ga0207651_10042035 Ga0207651_100420352 368
364 3300031456 Ga0307513_10018912 Ga0307513_100189123 368
365 3300003320 rootH2_10006821 rootH2_1000682134 370
366 3300009979 Ga0105032_100013 Ga0105032_10001348 370
367 3300026089 Ga0207648_10337686 Ga0207648_103376861 372
368 3300030744 Ga0316181_1178762 Ga0316181_11787621 372
369 3300030745 Ga0316182_1129063 Ga0316182_11290631 372
370 3300048910 Ga0496107_0166673 Ga0496107_0166673_25_1257 376
371 3300005539 Ga0068853_100009784 Ga0068853_1000097844 378
372 3300013308 Ga0157375_10138855 Ga0157375_101388552 378
373 3300025909 Ga0207705_10006296 Ga0207705_100062965 378
374 3300025911 Ga0207654_10017310 Ga0207654_100173102 378
375 3300026041 Ga0207639_10009238 Ga0207639_100092383 378
376 3300006237 Ga0097621_100000001 Ga0097621_100000001447 380
377 3300006358 Ga0068871_100000008 Ga0068871_10000000877 380
378 3300045051 Ga0451576_0197092 Ga0451576_0197092_233_1462 382
379 3300031901 Ga0307406_10000001 Ga0307406_10000001372 383
380 3300031901 Ga0307406_10000396 Ga0307406_1000039628 383
381 3300048903 Ga0496100_0075161 Ga0496100_0075161_176_1405 383
382 3300048918 Ga0496115_0000001 Ga0496115_0000001_124812_126044 383
383 2162886012 MBSR1b_contig_2466980 MBSR1b_0533.00003990 384
384 2162886012 MBSR1b_contig_8595631 MBSR1b_0655.00003390 384
385 3300005293 Ga0065715_10000425 Ga0065715_1000042518 384
386 3300053133 Ga0500655_000541 Ga0500655_000541_6160_7392 384

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

275

397

0.99

PF00482

T2SSF

Type II secretion system (T2SS), protein F

68

191

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.9814 65 161
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.9761 65 161
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.9659 64 169
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9616 63 169
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.954 63 175
ID Description Score Start End Superfamily
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9814 65 161 1.20.81.30
af_P36646_1_51_3.10.20.10 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9492 2 47 3.10.20.10
af_P41441_261_365_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9432 274 376 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9347 262 371 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9189 262 371 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A7X4Y283-F1-model_v4 deleted 0.9595 270 383
AF-A0A496SHG4-F1-model_v4 Type II secretion system F family protein 0.9542 250 383 GO:0005886
AF-T0ZVW1-F1-model_v4 Type II secretion system F domain protein 0.9521 248 383 GO:0005886
GO:0015628
AF-A0A831K9D2-F1-model_v4 Type II secretion system protein GspF 0.9509 258 383 GO:0005886
AF-A0A7V2FYY2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9504 272 383 GO:0005886

Feature Viewer

pLDDT pTM Quality
84.14 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map