F430481

General Info

Members Datasets Scaffolds Average Seq Length
386 194 772 135

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10251387|Ga0099794_102513871
Length 151
Sequence MEARPATPSGTQEARFLLDTNICIYIRRKKPEEVLRRFRMLKQGEAALSVITFGEFVYGAEKSAQRAAALELLQELARVLPVMGLPETAAEAYGTMRAELERKGQMIGNNDLWIAAHAKAAGLTRVTNNEREFRRVRGLKVENWADWKCSD

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
59 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
125 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
126 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
127 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
128 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 2508501050 Microvirga lupini Lut6 Isolate Nodule
190 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
191 2773857925 Microvirga vignae BR3299 Isolate Unclassified
192 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
193 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
194 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 1.04
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 1.04
Rhizoplane 1.81
Rhizosphere 89.64
Stem 0
Stem Tuber 0
Unclassified 19.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10251387 3300007265 Unclassified 911
2 rootL2_10076280 3300003322 Bacteria 1757
3 rootL2_10140294 3300003322 Bacteria 1217
4 rootL2_10155187 3300003322 Bacteria 6187
5 rootH1_10276601 3300003323 Bacteria 1335
6 JGI25404J52841_10022645 3300003659 Bacteria 1357
7 Ga0070709_10274094 3300005434 Bacteria 1223
8 Ga0070709_10528255 3300005434 Bacteria 900
9 Ga0070714_100000134 3300005435 Bacteria 58475
10 Ga0070714_100007669 3300005435 Bacteria 8403
11 Ga0070714_100028456 3300005435 Bacteria 4637
12 Ga0070714_100068061 3300005435 Bacteria 3072
13 Ga0070714_100508376 3300005435 Bacteria 1149
14 Ga0070713_100002646 3300005436 Bacteria 11664
15 Ga0070713_100006426 3300005436 Bacteria 8147
16 Ga0070713_100083352 3300005436 Bacteria 2733
17 Ga0070713_100916148 3300005436 Unclassified 843
18 Ga0070713_100985701 3300005436 Bacteria 813
19 Ga0070713_101080216 3300005436 Bacteria 775
20 Ga0070713_101159646 3300005436 Bacteria 747
21 Ga0070710_10095761 3300005437 Bacteria 1758
22 Ga0070710_10139358 3300005437 Bacteria 1486
23 Ga0070710_10176713 3300005437 Bacteria 1334
24 Ga0070711_100010689 3300005439 Bacteria 5687
25 Ga0070711_100116753 3300005439 Bacteria 1967
26 Ga0070711_100128636 3300005439 Bacteria 1883
27 Ga0070711_100859282 3300005439 Unclassified 772
28 Ga0070711_101007643 3300005439 Bacteria 715
29 Ga0070711_101094558 3300005439 Unclassified 686
30 Ga0070705_100089500 3300005440 Bacteria 1914
31 Ga0070708_100022091 3300005445 Bacteria 5393
32 Ga0070708_100025278 3300005445 Bacteria 5076
33 Ga0070708_100034917 3300005445 Bacteria 4378
34 Ga0070708_100052307 3300005445 Bacteria 3622
35 Ga0070708_100059080 3300005445 Bacteria 3418
36 Ga0070708_100568047 3300005445 Bacteria 1070
37 Ga0070708_101126415 3300005445 Bacteria 735
38 Ga0070708_101633137 3300005445 Bacteria 600
39 Ga0070681_10005749 3300005458 Bacteria 11990
40 Ga0070681_10033683 3300005458 Bacteria 5143
41 Ga0070681_10364698 3300005458 Bacteria 1355
42 Ga0070706_100196329 3300005467 Bacteria 1885
43 Ga0070706_100232740 3300005467 Bacteria 1720
44 Ga0070706_100294617 3300005467 Bacteria 1514
45 Ga0070706_100325905 3300005467 Unclassified 1432
46 Ga0070707_100025200 3300005468 Bacteria 5641
47 Ga0070707_100050948 3300005468 Bacteria 3968
48 Ga0070707_100108792 3300005468 Plasmid 2688
49 Ga0070707_100513170 3300005468 Bacteria 1160
50 Ga0070698_100027376 3300005471 Bacteria 5930
51 Ga0070698_100149031 3300005471 Bacteria 2288
52 Ga0070698_100624713 3300005471 Unclassified 1018
53 Ga0070699_100000596 3300005518 Bacteria 34077
54 Ga0070699_100006008 3300005518 Bacteria 10615
55 Ga0070679_100052041 3300005530 Plasmid 4080
56 Ga0070684_100373023 3300005535 Bacteria 1314
57 Ga0070697_100009183 3300005536 Bacteria 7725
58 Ga0070697_100009890 3300005536 Bacteria 7437
59 Ga0070697_100106065 3300005536 Bacteria 2338
60 Ga0070697_100372954 3300005536 Unclassified 1235
61 Ga0070697_100906832 3300005536 Unclassified 782
62 Ga0070695_100141260 3300005545 Unclassified 1670
63 Ga0068855_100045929 3300005563 Bacteria 5164
64 Ga0068856_100916465 3300005614 Bacteria 895
65 Ga0068863_100010693 3300005841 Bacteria 8912
66 Ga0081455_10002513 3300005937 Bacteria 21769
67 Ga0081455_10002868 3300005937 Bacteria 20303
68 Ga0081455_10004005 3300005937 Bacteria 16713
69 Ga0081540_1000350 3300005983 Bacteria 46634
70 Ga0081540_1002356 3300005983 Bacteria 15443
71 Ga0081540_1025310 3300005983 Bacteria 3418
72 Ga0081540_1153665 3300005983 Unclassified 904
73 Ga0081539_10159219 3300005985 Bacteria 1078
74 Ga0081539_10218090 3300005985 Bacteria 870
75 Ga0070717_10006547 3300006028 Bacteria 8577
76 Ga0070717_10026243 3300006028 Bacteria 4646
77 Ga0070717_10087962 3300006028 Bacteria 2617
78 Ga0070717_10157638 3300006028 Bacteria 1967
79 Ga0070717_10214504 3300006028 Bacteria 1690
80 Ga0070717_10271605 3300006028 Bacteria 1502
81 Ga0070717_10380328 3300006028 Bacteria 1266
82 Ga0070717_10481558 3300006028 Bacteria 1120
83 Ga0070717_10787166 3300006028 Bacteria 865
84 Ga0070716_100125082 3300006173 Bacteria 1616
85 Ga0070716_100233459 3300006173 Unclassified 1243
86 Ga0070716_101173222 3300006173 Bacteria 616
87 Ga0070716_101634591 3300006173 Unclassified 530
88 Ga0070712_100036689 3300006175 Unclassified 3337
89 Ga0070712_100388555 3300006175 Bacteria 1150
90 Ga0070712_101647456 3300006175 Unclassified 561
91 Ga0075366_10016735 3300006195 Bacteria 4216
92 Ga0097621_101027529 3300006237 Bacteria 772
93 Ga0068871_100323477 3300006358 Viruses 1359
94 Ga0075431_100623237 3300006847 Bacteria 1061
95 Ga0075431_100732074 3300006847 Unclassified 965
96 Ga0075433_10106828 3300006852 Bacteria 2481
97 Ga0075433_10528227 3300006852 Bacteria 1038
98 Ga0075434_100000708 3300006871 Bacteria 26066
99 Ga0075434_100030044 3300006871 Bacteria 5349
100 Ga0075436_100309306 3300006914 Bacteria 1134
101 Ga0075435_100094050 3300007076 Bacteria 2477
102 Ga0075435_100209494 3300007076 Bacteria 1653
103 Ga0099794_10002031 3300007265 Bacteria 7320
104 Ga0099794_10014955 3300007265 Bacteria 3413
105 Ga0099794_10028693 3300007265 Bacteria 2589
106 Ga0099794_10111198 3300007265 Bacteria 1373
107 Ga0099794_10332999 3300007265 Unclassified 788
108 Ga0099795_10015920 3300007788 Bacteria 2368
109 Ga0105240_10002119 3300009093 Bacteria 32449
110 Ga0105240_10021167 3300009093 Bacteria 8657
111 Ga0105240_10083632 3300009093 Bacteria 3916
112 Ga0105245_10232816 3300009098 Bacteria 1782
113 Ga0105245_11166478 3300009098 Unclassified 818
114 Ga0105248_10146738 3300009177 Bacteria 2662
115 Ga0105248_11707839 3300009177 Bacteria 714
116 Ga0099796_10026193 3300010159 Bacteria 1849
117 Ga0105246_10370934 3300011119 Unclassified 1179
118 Ga0105246_11299525 3300011119 Bacteria 674
119 Ga0157370_10270338 3300013104 Bacteria 1570
120 Ga0157369_10716888 3300013105 Bacteria 1030
121 Ga0157374_10277354 3300013296 Bacteria 1654
122 Ga0157378_10872071 3300013297 Bacteria 929
123 Ga0163162_10000777 3300013306 Bacteria 29697
124 Ga0163162_12224383 3300013306 Unclassified 630
125 Ga0157372_10003793 3300013307 Bacteria 16230
126 Ga0157372_10039867 3300013307 Bacteria 5186
127 Ga0157372_10081029 3300013307 Bacteria 3674
128 Ga0157372_10177715 3300013307 Bacteria 2464
129 Ga0157372_10860080 3300013307 Unclassified 1053
130 Ga0157372_11559187 3300013307 Unclassified 761
131 Ga0157372_11646187 3300013307 Bacteria 739
132 Ga0157375_10293435 3300013308 Bacteria 1789
133 Ga0163163_10932836 3300014325 Bacteria 931
134 Ga0157380_10315240 3300014326 Bacteria 1447
135 Ga0157379_10137044 3300014968 Bacteria 2205
136 Ga0157379_10318581 3300014968 Bacteria 1420
137 Ga0157376_10138440 3300014969 Bacteria 2181
138 Ga0213874_10067476 3300021377 Unclassified 1134
139 Ga0213875_10200309 3300021388 Bacteria 939
140 Ga0213875_10397095 3300021388 Unclassified 657
141 Ga0213871_10084589 3300021441 Unclassified 913
142 Ga0224570_102798 3300022730 Bacteria 1139
143 Ga0224572_1061724 3300024225 Bacteria 693
144 Ga0209233_1027168 3300025261 Bacteria 1390
145 Ga0207692_10710751 3300025898 Bacteria 653
146 Ga0207692_10855896 3300025898 Unclassified 597
147 Ga0207688_10198487 3300025901 Bacteria 1202
148 Ga0207685_10151859 3300025905 Bacteria 1049
149 Ga0207685_10230300 3300025905 Unclassified 886
150 Ga0207699_10460852 3300025906 Bacteria 913
151 Ga0207684_10006567 3300025910 Bacteria 10589
152 Ga0207684_10024885 3300025910 Bacteria 5101
153 Ga0207684_10033744 3300025910 Bacteria 4353
154 Ga0207684_11519612 3300025910 Bacteria 544
155 Ga0207707_10096278 3300025912 Unclassified 2587
156 Ga0207707_10138810 3300025912 Bacteria 2125
157 Ga0207707_10276115 3300025912 Bacteria 1456
158 Ga0207695_10009385 3300025913 Bacteria 12101
159 Ga0207695_10015455 3300025913 Bacteria 8986
160 Ga0207695_10179306 3300025913 Bacteria 2040
161 Ga0207693_10162822 3300025915 Bacteria 1755
162 Ga0207693_10472667 3300025915 Unclassified 979
163 Ga0207663_10007012 3300025916 Bacteria 5814
164 Ga0207663_10096579 3300025916 Bacteria 1974
165 Ga0207663_10788844 3300025916 Unclassified 756
166 Ga0207663_11694224 3300025916 Bacteria 509
167 Ga0207652_11599094 3300025921 Unclassified 556
168 Ga0207646_10008168 3300025922 Bacteria 10525
169 Ga0207646_10023610 3300025922 Bacteria 5647
170 Ga0207646_10242303 3300025922 Bacteria 1629
171 Ga0207646_10458760 3300025922 Bacteria 1149
172 Ga0207646_10674250 3300025922 Unclassified 925
173 Ga0207646_11017958 3300025922 Bacteria 731
174 Ga0207646_11636334 3300025922 Bacteria 555
175 Ga0207694_10364127 3300025924 Bacteria 1198
176 Ga0207687_10444979 3300025927 Bacteria 1074
177 Ga0207700_10001630 3300025928 Bacteria 12742
178 Ga0207700_10054361 3300025928 Bacteria 3005
179 Ga0207700_10304331 3300025928 Bacteria 1377
180 Ga0207700_10760904 3300025928 Unclassified 866
181 Ga0207664_10000143 3300025929 Bacteria 58667
182 Ga0207664_10028613 3300025929 Bacteria 4237
183 Ga0207664_10094168 3300025929 Bacteria 2461
184 Ga0207664_10381378 3300025929 Bacteria 1251
185 Ga0207664_10560590 3300025929 Bacteria 1025
186 Ga0207664_10565278 3300025929 Unclassified 1021
187 Ga0207664_10825383 3300025929 Bacteria 834
188 Ga0207665_10060636 3300025939 Bacteria 2562
189 Ga0207665_10078796 3300025939 Bacteria 2264
190 Ga0207665_10172777 3300025939 Bacteria 1561
191 Ga0207665_10193306 3300025939 Bacteria 1479
192 Ga0207665_10820874 3300025939 Bacteria 735
193 Ga0207711_10081255 3300025941 Bacteria 2832
194 Ga0207711_10681817 3300025941 Bacteria 959
195 Ga0207667_10498491 3300025949 Bacteria 1235
196 Ga0207703_10018749 3300026035 Bacteria 5405
197 Ga0207702_10325417 3300026078 Bacteria 1465
198 Ga0207702_10850788 3300026078 Bacteria 903
199 Ga0207641_10017647 3300026088 Bacteria 5845
200 Ga0209179_1004888 3300027512 Bacteria 2058
201 Ga0209588_1000234 3300027671 Bacteria 14858
202 Ga0209588_1003868 3300027671 Unclassified 4183
203 Ga0209588_1029905 3300027671 Bacteria 1739
204 Ga0209588_1056069 3300027671 Bacteria 1274
205 Ga0265334_10000473 3300028573 Bacteria 20743
206 Ga0265338_10028144 3300028800 Bacteria 5615
207 Ga0265338_10686786 3300028800 Unclassified 707
208 Ga0265324_10024928 3300029957 Bacteria 2123
209 Ga0265762_1006393 3300030760 Unclassified 2107
210 Ga0265762_1068122 3300030760 Bacteria 742
211 Ga0265765_1004582 3300030879 Unclassified 1426
212 Ga0265760_10067345 3300031090 Bacteria 1095
213 Ga0265332_10128880 3300031238 Bacteria 1062
214 Ga0265325_10002184 3300031241 Bacteria 13308
215 Ga0265325_10395247 3300031241 Unclassified 606
216 Ga0265340_10004406 3300031247 Bacteria 7877
217 Ga0265340_10053338 3300031247 Bacteria 1953
218 Ga0265340_10105255 3300031247 Bacteria 1308
219 Ga0265339_10018406 3300031249 Bacteria 4118
220 Ga0265339_10025515 3300031249 Bacteria 3392
221 Ga0265339_10071470 3300031249 Bacteria 1849
222 Ga0265339_10181220 3300031249 Bacteria 1049
223 Ga0265331_10020633 3300031250 Unclassified 3380
224 Ga0265327_10080827 3300031251 Bacteria 1606
225 Ga0265316_10039128 3300031344 Bacteria 3811
226 Ga0265316_10085865 3300031344 Bacteria 2407
227 Ga0307408_100252219 3300031548 Bacteria 1456
228 Ga0265313_10003830 3300031595 Bacteria 11875
229 Ga0265314_10026675 3300031711 Bacteria 4337
230 Ga0265314_10154608 3300031711 Bacteria 1402
231 Ga0265314_10193221 3300031711 Bacteria 1209
232 Ga0316576_10629888 3300031727 Bacteria 781
233 Ga0307416_101118940 3300032002 Bacteria 892
234 Ga0373926_0091568 3300035083 Bacteria 1131
235 Ga0373934_0080992 3300035086 Bacteria 1304
236 Ga0373934_0228754 3300035086 Unclassified 768
237 Ga0373923_0067802 3300035111 Bacteria 1527
238 Ga0373923_0094636 3300035111 Unclassified 1311
239 Ga0373936_0123310 3300035113 Unclassified 1109
240 Ga0373939_0002944 3300035114 Bacteria 4002
241 Ga0373953_0022835 3300035117 Bacteria 2363
242 Ga0373954_0024043 3300035118 Unclassified 2775
243 Ga0373954_0039578 3300035118 Bacteria 2195
244 Ga0373956_0003071 3300035119 Bacteria 6760
245 Ga0373956_0160516 3300035119 Unclassified 1059
246 Ga0373956_0267968 3300035119 Unclassified 812
247 Ga0373957_0005442 3300035120 Unclassified 3945
248 Ga0373943_0063393 3300035170 Unclassified 1853
249 Ga0373943_0101058 3300035170 Bacteria 1508
250 Ga0373955_0016056 3300035172 Unclassified 3679
251 Ga0373955_0040967 3300035172 Bacteria 2480
252 Ga0373955_0062204 3300035172 Bacteria 2064
253 Ga0373962_0083632 3300035242 Bacteria 973
254 Ga0373924_0351732 3300035410 Unclassified 657
255 Ga0373935_0022643 3300035692 Bacteria 3855
256 Ga0373935_0124026 3300035692 Bacteria 1729
257 Ga0373935_0406146 3300035692 Bacteria 979
258 Ga0373927_0021405 3300035695 Bacteria 4238
259 Ga0373927_0100573 3300035695 Bacteria 1880
260 Ga0373927_0301197 3300035695 Bacteria 1055
261 Ga0373933_0007369 3300035724 Bacteria 6000
262 Ga0373933_0104847 3300035724 Bacteria 1758
263 Ga0373947_0053575 3300035725 Bacteria 2433
264 Ga0373947_0115988 3300035725 Bacteria 1698
265 Ga0373947_0208474 3300035725 Bacteria 1281
266 Ga0373947_0367728 3300035725 Bacteria 967
267 Ga0373947_0509129 3300035725 Unclassified 818
268 Ga0373937_0020015 3300036401 Bacteria 5994
269 Ga0373937_0033501 3300036401 Bacteria 4666
270 Ga0373937_0052068 3300036401 Unclassified 3753
271 Ga0373937_0092299 3300036401 Bacteria 2806
272 Ga0373937_0683379 3300036401 Bacteria 973
273 Ga0373937_0781061 3300036401 Bacteria 903
274 Ga0373925_0016290 3300037068 Bacteria 5382
275 Ga0373925_0063798 3300037068 Bacteria 2772
276 Ga0373925_0305412 3300037068 Bacteria 1285
277 Ga0373925_0509080 3300037068 Unclassified 989
278 Ga0373925_0808416 3300037068 Unclassified 773
279 Ga0395900_1580665 3300037418 Bacteria 567
280 Ga0436364_0500651 3300037853 Bacteria 2391
281 Ga0436364_0625961 3300037853 Bacteria 1177
282 Ga0436364_0667248 3300037853 Bacteria 870
283 Ga0436364_0904718 3300037853 Bacteria 2809
284 Ga0395901_1311904 3300038443 Bacteria 685
285 Ga0400484_10072 3300038725 Bacteria 4899
286 Ga0400490_43740 3300038726 Bacteria 1148
287 Ga0400485_02846 3300038735 Bacteria 12102
288 Ga0400486_24916 3300038742 Bacteria 8083
289 Ga0400487_01646 3300039110 Bacteria 1628
290 Ga0436365_0110397 3300039437 Bacteria 4695
291 Ga0436365_0829632 3300039437 Bacteria 2517
292 Ga0436360_0959752 3300039438 Bacteria 849
293 Ga0436360_1202722 3300039438 Bacteria 603
294 Ga0436360_1287903 3300039438 Bacteria 2578
295 Ga0436361_0296515 3300039447 Bacteria 1250
296 Ga0436361_0819721 3300039447 Bacteria 1289
297 Ga0436361_0910510 3300039447 Bacteria 805
298 Ga0436361_0912490 3300039447 Unclassified 917
299 Ga0436363_1190378 3300039450 Unclassified 1954
300 Ga0436362_0641086 3300039453 Unclassified 661
301 Ga0436362_1232185 3300039453 Bacteria 1015
302 Ga0451839_1103742 3300041496 Bacteria 1203
303 Ga0439431_0055357 3300041997 Bacteria 1036
304 Ga0453683_0591560 3300044673 Unclassified 723
305 Ga0466963_1041265 3300044694 Unclassified 576
306 Ga0453684_0051508 3300044712 Bacteria 5395
307 Ga0453684_0350496 3300044712 Bacteria 1665
308 Ga0453684_0952048 3300044712 Bacteria 916
309 Ga0453684_2355484 3300044712 Bacteria 528
310 Ga0466968_0113140 3300044735 Bacteria 1222
311 Ga0466968_0175156 3300044735 Bacteria 995
312 Ga0466959_0098286 3300045049 Bacteria 2097
313 Ga0466958_0136245 3300045836 Unclassified 1544
314 Ga0466958_0406256 3300045836 Bacteria 879
315 Ga0466967_0102540 3300045976 Bacteria 2618
316 Ga0466967_0294946 3300045976 Bacteria 1559
317 Ga0495592_0423671 3300046454 Unclassified 839
318 Ga0495651_0203886 3300046462 Bacteria 1382
319 Ga0495653_0128282 3300046463 Bacteria 1798
320 Ga0495580_0001479 3300046472 Bacteria 20611
321 Ga0495580_0038978 3300046472 Bacteria 3400
322 Ga0495582_0110085 3300046473 Bacteria 1547
323 Ga0495639_0194557 3300046475 Bacteria 991
324 Ga0495594_0272937 3300046499 Bacteria 963
325 Ga0495594_0318660 3300046499 Bacteria 886
326 Ga0495628_0393089 3300046516 Unclassified 1014
327 Ga0495628_0949176 3300046516 Bacteria 594
328 Ga0495630_0323528 3300046517 Bacteria 1179
329 Ga0495665_0637841 3300046531 Unclassified 531
330 Ga0495587_0165554 3300046536 Bacteria 1257
331 Ga0495645_0010778 3300046543 Bacteria 6421
332 Ga0495667_0360588 3300046559 Unclassified 918
333 Ga0495635_0216073 3300046663 Bacteria 1298
334 Ga0495647_0383191 3300046681 Bacteria 644
335 Ga0495658_0275759 3300046683 Bacteria 1060
336 Ga0495613_0656135 3300046689 Bacteria 694
337 Ga0495613_0755070 3300046689 Unclassified 637
338 Ga0495624_0426507 3300046690 Unclassified 795
339 Ga0495581_0424634 3300047315 Unclassified 775
340 Ga0495674_0221406 3300047319 Bacteria 1564
341 Ga0495676_0288602 3300047321 Bacteria 1109
342 Ga0495675_0087562 3300047444 Bacteria 1957
343 Ga0495675_0271723 3300047444 Unclassified 1013
344 Ga0495684_0091626 3300047471 Bacteria 2303
345 Ga0495593_0143976 3300047673 Bacteria 1207
346 Ga0495593_0297294 3300047673 Unclassified 807
347 Ga0495602_0736385 3300048088 Unclassified 666
348 Ga0495614_0604693 3300048089 Unclassified 527
349 Ga0496100_0560641 3300048903 Bacteria 884
350 Ga0496104_0237365 3300048907 Bacteria 1735
351 Ga0496104_0493814 3300048907 Bacteria 1135
352 Ga0496105_0465967 3300048908 Bacteria 996
353 Ga0496106_0238069 3300048909 Bacteria 1454
354 Ga0496115_0246422 3300048918 Bacteria 1472
355 Ga0496115_0396597 3300048918 Bacteria 1120
356 Ga0501070_0521285 3300049586 Bacteria 953
357 Ga0501075_1369851 3300049591 Bacteria 536
358 Ga0501079_0447246 3300049741 Unclassified 1015
359 nmdc:mga00v17_868466_c1 3300050491 Bacteria 572
360 nmdc:mga0k408_231426_c1 3300050493 Bacteria 1103
361 nmdc:mga0k408_914455_c1 3300050493 Unclassified 509
362 nmdc:mga0qj67_925550_c1 3300050509 Unclassified 686
363 nmdc:mga0n895_3628_c1 3300050512 Bacteria 12475
364 nmdc:mga0n895_5365_c1 3300050512 Bacteria 10692
365 nmdc:mga0rr50_28375_c1 3300050513 Bacteria 3934
366 nmdc:mga0rr50_552161_c1 3300050513 Unclassified 981
367 nmdc:mga0rr50_802283_c1 3300050513 Unclassified 803
368 nmdc:mga08x19_127389_c1 3300050514 Bacteria 1710
369 nmdc:mga08x19_156581_c1 3300050514 Bacteria 1545
370 nmdc:mga0a205_112767_c1 3300050515 Bacteria 2618
371 nmdc:mga0a205_177175_c1 3300050515 Bacteria 2027
372 Ga0495601_0065589 3300053077 Bacteria 2311
373 Ga0495601_0229779 3300053077 Bacteria 1212
374 Ga0495601_0257059 3300053077 Bacteria 1140
375 Ga0495619_0015226 3300053085 Bacteria 4863
376 Ga0495619_0024544 3300053085 Bacteria 3867
377 Ga0495619_0438052 3300053085 Unclassified 901
378 Ga0500651_0117957 3300053093 Bacteria 1614
379 Ga0500588_0059336 3300053146 Bacteria 1220
380 Ga0501084_0655443 3300054114 Bacteria 886
381 2508733617 2508501050 Bacteria 9633614
382 2509079664 2508501114 Bacteria 7082538
383 2774874225 2773857925 Bacteria 6472445
384 2835314346 2835312727 Bacteria 7413381
385 2894238639 2894232714 Bacteria 8834183
386 3005717477 3005710791 Bacteria 7622528
387 Ga0099794_10251387
388 rootL2_10076280
389 rootL2_10140294
390 rootL2_10155187
391 rootH1_10276601
392 JGI25404J52841_10022645
393 Ga0070709_10274094
394 Ga0070709_10528255
395 Ga0070714_100000134
396 Ga0070714_100007669
397 Ga0070714_100028456
398 Ga0070714_100068061
399 Ga0070714_100508376
400 Ga0070713_100002646
401 Ga0070713_100006426
402 Ga0070713_100083352
403 Ga0070713_100916148
404 Ga0070713_100985701
405 Ga0070713_101080216
406 Ga0070713_101159646
407 Ga0070710_10095761
408 Ga0070710_10139358
409 Ga0070710_10176713
410 Ga0070711_100010689
411 Ga0070711_100116753
412 Ga0070711_100128636
413 Ga0070711_100859282
414 Ga0070711_101007643
415 Ga0070711_101094558
416 Ga0070705_100089500
417 Ga0070708_100022091
418 Ga0070708_100025278
419 Ga0070708_100034917
420 Ga0070708_100052307
421 Ga0070708_100059080
422 Ga0070708_100568047
423 Ga0070708_101126415
424 Ga0070708_101633137
425 Ga0070681_10005749
426 Ga0070681_10033683
427 Ga0070681_10364698
428 Ga0070706_100196329
429 Ga0070706_100232740
430 Ga0070706_100294617
431 Ga0070706_100325905
432 Ga0070707_100025200
433 Ga0070707_100050948
434 Ga0070707_100108792
435 Ga0070707_100513170
436 Ga0070698_100027376
437 Ga0070698_100149031
438 Ga0070698_100624713
439 Ga0070699_100000596
440 Ga0070699_100006008
441 Ga0070679_100052041
442 Ga0070684_100373023
443 Ga0070697_100009183
444 Ga0070697_100009890
445 Ga0070697_100106065
446 Ga0070697_100372954
447 Ga0070697_100906832
448 Ga0070695_100141260
449 Ga0068855_100045929
450 Ga0068856_100916465
451 Ga0068863_100010693
452 Ga0081455_10002513
453 Ga0081455_10002868
454 Ga0081455_10004005
455 Ga0081540_1000350
456 Ga0081540_1002356
457 Ga0081540_1025310
458 Ga0081540_1153665
459 Ga0081539_10159219
460 Ga0081539_10218090
461 Ga0070717_10006547
462 Ga0070717_10026243
463 Ga0070717_10087962
464 Ga0070717_10157638
465 Ga0070717_10214504
466 Ga0070717_10271605
467 Ga0070717_10380328
468 Ga0070717_10481558
469 Ga0070717_10787166
470 Ga0070716_100125082
471 Ga0070716_100233459
472 Ga0070716_101173222
473 Ga0070716_101634591
474 Ga0070712_100036689
475 Ga0070712_100388555
476 Ga0070712_101647456
477 Ga0075366_10016735
478 Ga0097621_101027529
479 Ga0068871_100323477
480 Ga0075431_100623237
481 Ga0075431_100732074
482 Ga0075433_10106828
483 Ga0075433_10528227
484 Ga0075434_100000708
485 Ga0075434_100030044
486 Ga0075436_100309306
487 Ga0075435_100094050
488 Ga0075435_100209494
489 Ga0099794_10002031
490 Ga0099794_10014955
491 Ga0099794_10028693
492 Ga0099794_10111198
493 Ga0099794_10332999
494 Ga0099795_10015920
495 Ga0105240_10002119
496 Ga0105240_10021167
497 Ga0105240_10083632
498 Ga0105245_10232816
499 Ga0105245_11166478
500 Ga0105248_10146738
501 Ga0105248_11707839
502 Ga0099796_10026193
503 Ga0105246_10370934
504 Ga0105246_11299525
505 Ga0157370_10270338
506 Ga0157369_10716888
507 Ga0157374_10277354
508 Ga0157378_10872071
509 Ga0163162_10000777
510 Ga0163162_12224383
511 Ga0157372_10003793
512 Ga0157372_10039867
513 Ga0157372_10081029
514 Ga0157372_10177715
515 Ga0157372_10860080
516 Ga0157372_11559187
517 Ga0157372_11646187
518 Ga0157375_10293435
519 Ga0163163_10932836
520 Ga0157380_10315240
521 Ga0157379_10137044
522 Ga0157379_10318581
523 Ga0157376_10138440
524 Ga0213874_10067476
525 Ga0213875_10200309
526 Ga0213875_10397095
527 Ga0213871_10084589
528 Ga0224570_102798
529 Ga0224572_1061724
530 Ga0209233_1027168
531 Ga0207692_10710751
532 Ga0207692_10855896
533 Ga0207688_10198487
534 Ga0207685_10151859
535 Ga0207685_10230300
536 Ga0207699_10460852
537 Ga0207684_10006567
538 Ga0207684_10024885
539 Ga0207684_10033744
540 Ga0207684_11519612
541 Ga0207707_10096278
542 Ga0207707_10138810
543 Ga0207707_10276115
544 Ga0207695_10009385
545 Ga0207695_10015455
546 Ga0207695_10179306
547 Ga0207693_10162822
548 Ga0207693_10472667
549 Ga0207663_10007012
550 Ga0207663_10096579
551 Ga0207663_10788844
552 Ga0207663_11694224
553 Ga0207652_11599094
554 Ga0207646_10008168
555 Ga0207646_10023610
556 Ga0207646_10242303
557 Ga0207646_10458760
558 Ga0207646_10674250
559 Ga0207646_11017958
560 Ga0207646_11636334
561 Ga0207694_10364127
562 Ga0207687_10444979
563 Ga0207700_10001630
564 Ga0207700_10054361
565 Ga0207700_10304331
566 Ga0207700_10760904
567 Ga0207664_10000143
568 Ga0207664_10028613
569 Ga0207664_10094168
570 Ga0207664_10381378
571 Ga0207664_10560590
572 Ga0207664_10565278
573 Ga0207664_10825383
574 Ga0207665_10060636
575 Ga0207665_10078796
576 Ga0207665_10172777
577 Ga0207665_10193306
578 Ga0207665_10820874
579 Ga0207711_10081255
580 Ga0207711_10681817
581 Ga0207667_10498491
582 Ga0207703_10018749
583 Ga0207702_10325417
584 Ga0207702_10850788
585 Ga0207641_10017647
586 Ga0209179_1004888
587 Ga0209588_1000234
588 Ga0209588_1003868
589 Ga0209588_1029905
590 Ga0209588_1056069
591 Ga0265334_10000473
592 Ga0265338_10028144
593 Ga0265338_10686786
594 Ga0265324_10024928
595 Ga0265762_1006393
596 Ga0265762_1068122
597 Ga0265765_1004582
598 Ga0265760_10067345
599 Ga0265332_10128880
600 Ga0265325_10002184
601 Ga0265325_10395247
602 Ga0265340_10004406
603 Ga0265340_10053338
604 Ga0265340_10105255
605 Ga0265339_10018406
606 Ga0265339_10025515
607 Ga0265339_10071470
608 Ga0265339_10181220
609 Ga0265331_10020633
610 Ga0265327_10080827
611 Ga0265316_10039128
612 Ga0265316_10085865
613 Ga0307408_100252219
614 Ga0265313_10003830
615 Ga0265314_10026675
616 Ga0265314_10154608
617 Ga0265314_10193221
618 Ga0316576_10629888
619 Ga0307416_101118940
620 Ga0373926_0091568
621 Ga0373934_0080992
622 Ga0373934_0228754
623 Ga0373923_0067802
624 Ga0373923_0094636
625 Ga0373936_0123310
626 Ga0373939_0002944
627 Ga0373953_0022835
628 Ga0373954_0024043
629 Ga0373954_0039578
630 Ga0373956_0003071
631 Ga0373956_0160516
632 Ga0373956_0267968
633 Ga0373957_0005442
634 Ga0373943_0063393
635 Ga0373943_0101058
636 Ga0373955_0016056
637 Ga0373955_0040967
638 Ga0373955_0062204
639 Ga0373962_0083632
640 Ga0373924_0351732
641 Ga0373935_0022643
642 Ga0373935_0124026
643 Ga0373935_0406146
644 Ga0373927_0021405
645 Ga0373927_0100573
646 Ga0373927_0301197
647 Ga0373933_0007369
648 Ga0373933_0104847
649 Ga0373947_0053575
650 Ga0373947_0115988
651 Ga0373947_0208474
652 Ga0373947_0367728
653 Ga0373947_0509129
654 Ga0373937_0020015
655 Ga0373937_0033501
656 Ga0373937_0052068
657 Ga0373937_0092299
658 Ga0373937_0683379
659 Ga0373937_0781061
660 Ga0373925_0016290
661 Ga0373925_0063798
662 Ga0373925_0305412
663 Ga0373925_0509080
664 Ga0373925_0808416
665 Ga0395900_1580665
666 Ga0436364_0500651
667 Ga0436364_0625961
668 Ga0436364_0667248
669 Ga0436364_0904718
670 Ga0395901_1311904
671 Ga0400484_10072
672 Ga0400490_43740
673 Ga0400485_02846
674 Ga0400486_24916
675 Ga0400487_01646
676 Ga0436365_0110397
677 Ga0436365_0829632
678 Ga0436360_0959752
679 Ga0436360_1202722
680 Ga0436360_1287903
681 Ga0436361_0296515
682 Ga0436361_0819721
683 Ga0436361_0910510
684 Ga0436361_0912490
685 Ga0436363_1190378
686 Ga0436362_0641086
687 Ga0436362_1232185
688 Ga0451839_1103742
689 Ga0439431_0055357
690 Ga0453683_0591560
691 Ga0466963_1041265
692 Ga0453684_0051508
693 Ga0453684_0350496
694 Ga0453684_0952048
695 Ga0453684_2355484
696 Ga0466968_0113140
697 Ga0466968_0175156
698 Ga0466959_0098286
699 Ga0466958_0136245
700 Ga0466958_0406256
701 Ga0466967_0102540
702 Ga0466967_0294946
703 Ga0495592_0423671
704 Ga0495651_0203886
705 Ga0495653_0128282
706 Ga0495580_0001479
707 Ga0495580_0038978
708 Ga0495582_0110085
709 Ga0495639_0194557
710 Ga0495594_0272937
711 Ga0495594_0318660
712 Ga0495628_0393089
713 Ga0495628_0949176
714 Ga0495630_0323528
715 Ga0495665_0637841
716 Ga0495587_0165554
717 Ga0495645_0010778
718 Ga0495667_0360588
719 Ga0495635_0216073
720 Ga0495647_0383191
721 Ga0495658_0275759
722 Ga0495613_0656135
723 Ga0495613_0755070
724 Ga0495624_0426507
725 Ga0495581_0424634
726 Ga0495674_0221406
727 Ga0495676_0288602
728 Ga0495675_0087562
729 Ga0495675_0271723
730 Ga0495684_0091626
731 Ga0495593_0143976
732 Ga0495593_0297294
733 Ga0495602_0736385
734 Ga0495614_0604693
735 Ga0496100_0560641
736 Ga0496104_0237365
737 Ga0496104_0493814
738 Ga0496105_0465967
739 Ga0496106_0238069
740 Ga0496115_0246422
741 Ga0496115_0396597
742 Ga0501070_0521285
743 Ga0501075_1369851
744 Ga0501079_0447246
745 nmdc:mga00v17_868466_c1
746 nmdc:mga0k408_231426_c1
747 nmdc:mga0k408_914455_c1
748 nmdc:mga0qj67_925550_c1
749 nmdc:mga0n895_3628_c1
750 nmdc:mga0n895_5365_c1
751 nmdc:mga0rr50_28375_c1
752 nmdc:mga0rr50_552161_c1
753 nmdc:mga0rr50_802283_c1
754 nmdc:mga08x19_127389_c1
755 nmdc:mga08x19_156581_c1
756 nmdc:mga0a205_112767_c1
757 nmdc:mga0a205_177175_c1
758 Ga0495601_0065589
759 Ga0495601_0229779
760 Ga0495601_0257059
761 Ga0495619_0015226
762 Ga0495619_0024544
763 Ga0495619_0438052
764 Ga0500651_0117957
765 Ga0500588_0059336
766 Ga0501084_0655443
767 2508733617
768 2509079664
769 2774874225
770 2835314346
771 2894238639
772 3005717477

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

16

139

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.9193 1 131
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.9136 2 131
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.9109 1 131
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.9079 2 131
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.9059 1 131
ID Description Score Start End Superfamily
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9018 1 131 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8877 1 131 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.885 2 131 3.40.50.1010
af_O01898_53_179_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8754 76 104 1.10.287.70
af_O07783_4_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8728 4 130 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A6S6TML9-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9961 2 132 GO:0000287
GO:0004540
GO:0090729
AF-A0A3S2GHS1-F1-model_v4 deleted 0.9957 2 133
AF-I3U762-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9954 2 132 GO:0000287
GO:0004540
GO:0090729
AF-I3TX34-F1-model_v4 PilT protein domain protein 0.9948 35 133 GO:0004518
GO:0046872
AF-A0A259RWL1-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9945 2 133 GO:0000287
GO:0004540
GO:0090729

Map