F430400

General Info

Members Datasets Scaffolds Average Seq Length
386 143 772 168

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10004180|Ga0070658_100041806
Length 174
Sequence MARSALASKRKIGRGPIAGAALVPAASVVVAILLSALPIVAETGWFPDFGFLILIAWRLLRGDVWPSWWAAPLGLVNDLIAGFPVGLSVSVWTASMLALDLLDRRTIWRDYWIEWALASLLILVEETAQWQVSAWMAAPVPFSFMFPPLLISIAAFPVAAWLVGRLDHWRLGRQ

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.37
Rhizosphere 96.37
Stem 0
Stem Tuber 0.26
Unclassified 13.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10004180 3300005327 Bacteria 11812
2 MBSR1b_contig_341097 2162886012 Bacteria 1643
3 MBSR1b_contig_7744953 2162886012 Bacteria 1665
4 JGI24736J21556_1000764 3300001904 Bacteria 5892
5 JGI24741J21665_1001903 3300001915 Bacteria 5646
6 JGI24740J21852_10075026 3300001979 Bacteria 897
7 JGI24739J22299_10004539 3300001989 Bacteria 5308
8 JGI24743J22301_10104969 3300001991 Unclassified 611
9 Ga0070658_10004728 3300005327 Bacteria 11071
10 Ga0070658_10005205 3300005327 Bacteria 10582
11 Ga0070658_10021207 3300005327 Bacteria 5204
12 Ga0070658_10052118 3300005327 Bacteria 3318
13 Ga0070658_10074360 3300005327 Bacteria 2786
14 Ga0070658_10137652 3300005327 Bacteria 2038
15 Ga0070658_10202093 3300005327 Bacteria 1677
16 Ga0070658_10619051 3300005327 Bacteria 939
17 Ga0070658_10726369 3300005327 Archaea 862
18 Ga0070676_10190016 3300005328 Bacteria 1340
19 Ga0070683_100205843 3300005329 Bacteria 1869
20 Ga0070670_100001804 3300005331 Bacteria 17450
21 Ga0070670_100113125 3300005331 Bacteria 2340
22 Ga0070677_10012072 3300005333 Bacteria 2992
23 Ga0070677_10052453 3300005333 Bacteria 1655
24 Ga0070666_10124735 3300005335 Bacteria 1787
25 Ga0070680_100064429 3300005336 Bacteria 3004
26 Ga0070680_100111566 3300005336 Bacteria 2277
27 Ga0070680_100111900 3300005336 Bacteria 2273
28 Ga0070680_100938234 3300005336 Bacteria 747
29 Ga0070660_100000663 3300005339 Bacteria 22744
30 Ga0070660_100005122 3300005339 Bacteria 9053
31 Ga0070660_100006152 3300005339 Bacteria 8303
32 Ga0070660_100033740 3300005339 Bacteria 3860
33 Ga0070660_100325382 3300005339 Bacteria 1263
34 Ga0070660_100383908 3300005339 Unclassified 1160
35 Ga0070660_100550378 3300005339 Bacteria 963
36 Ga0070661_100007447 3300005344 Bacteria 7547
37 Ga0070661_100017511 3300005344 Bacteria 5085
38 Ga0070661_100017997 3300005344 Bacteria 5019
39 Ga0070661_100397520 3300005344 Unclassified 1089
40 Ga0070661_100458498 3300005344 Bacteria 1015
41 Ga0070692_10002376 3300005345 Bacteria 7277
42 Ga0070692_10012570 3300005345 Bacteria 3923
43 Ga0070692_10267751 3300005345 Bacteria 1030
44 Ga0070692_10268686 3300005345 Unclassified 1029
45 Ga0070692_10435215 3300005345 Bacteria 836
46 Ga0070669_100023314 3300005353 Bacteria 4432
47 Ga0070669_100029654 3300005353 Bacteria 3945
48 Ga0070669_100084556 3300005353 Bacteria 2368
49 Ga0070669_100255642 3300005353 Unclassified 1396
50 Ga0070675_100002951 3300005354 Bacteria 12837
51 Ga0070671_100000624 3300005355 Bacteria 25245
52 Ga0070671_100099521 3300005355 Bacteria 2439
53 Ga0070671_100127697 3300005355 Bacteria 2141
54 Ga0070673_100009944 3300005364 Bacteria 6411
55 Ga0070673_100734509 3300005364 Unclassified 908
56 Ga0070673_100742939 3300005364 Bacteria 903
57 Ga0070659_100019849 3300005366 Bacteria 5101
58 Ga0070659_100034132 3300005366 Bacteria 3956
59 Ga0070659_100153143 3300005366 Bacteria 1882
60 Ga0070659_100189350 3300005366 Bacteria 1690
61 Ga0070659_100287957 3300005366 Bacteria 1368
62 Ga0070659_100298818 3300005366 Bacteria 1342
63 Ga0070667_100080100 3300005367 Bacteria 2793
64 Ga0070667_101412859 3300005367 Unclassified 653
65 Ga0070714_100392012 3300005435 Bacteria 1311
66 Ga0070663_100005201 3300005455 Bacteria 7704
67 Ga0070663_100008864 3300005455 Bacteria 6209
68 Ga0070663_100112511 3300005455 Bacteria 2047
69 Ga0070663_100114356 3300005455 Bacteria 2032
70 Ga0070663_100830557 3300005455 Bacteria 794
71 Ga0070663_101127995 3300005455 Bacteria 686
72 Ga0070678_100021378 3300005456 Bacteria 4266
73 Ga0070678_100396852 3300005456 Bacteria 1197
74 Ga0070662_100016505 3300005457 Bacteria 4959
75 Ga0070662_100041412 3300005457 Bacteria 3286
76 Ga0070662_100094436 3300005457 Bacteria 2252
77 Ga0070662_100110021 3300005457 Bacteria 2097
78 Ga0070662_100287358 3300005457 Unclassified 1332
79 Ga0070681_10292175 3300005458 Bacteria 1540
80 Ga0070681_10296456 3300005458 Bacteria 1527
81 Ga0070679_100076805 3300005530 Bacteria 3328
82 Ga0070679_100102674 3300005530 Bacteria 2846
83 Ga0070679_100123339 3300005530 Bacteria 2574
84 Ga0070679_100215707 3300005530 Bacteria 1881
85 Ga0070679_100302847 3300005530 Unclassified 1549
86 Ga0070679_100431996 3300005530 Bacteria 1262
87 Ga0070679_101433180 3300005530 Unclassified 637
88 Ga0070684_100490687 3300005535 Unclassified 1137
89 Ga0068853_100032267 3300005539 Bacteria 4435
90 Ga0068853_100060184 3300005539 Bacteria 3281
91 Ga0070672_100011838 3300005543 Bacteria 6094
92 Ga0070672_100120908 3300005543 Bacteria 2143
93 Ga0070693_100014798 3300005547 Bacteria 4007
94 Ga0070693_100026621 3300005547 Bacteria 3124
95 Ga0070665_100020552 3300005548 Bacteria 6634
96 Ga0070665_100133619 3300005548 Bacteria 2483
97 Ga0068855_100004077 3300005563 Bacteria 17825
98 Ga0068855_100032800 3300005563 Bacteria 6200
99 Ga0068855_100575602 3300005563 Bacteria 1217
100 Ga0068855_101230826 3300005563 Unclassified 777
101 Ga0070664_100003489 3300005564 Bacteria 12701
102 Ga0070664_100053221 3300005564 Bacteria 3431
103 Ga0070664_100066269 3300005564 Bacteria 3083
104 Ga0070664_100265224 3300005564 Bacteria 1546
105 Ga0070664_100386154 3300005564 Bacteria 1279
106 Ga0070664_100503799 3300005564 Unclassified 1116
107 Ga0068857_100442026 3300005577 Bacteria 1215
108 Ga0068854_100018045 3300005578 Bacteria 4730
109 Ga0068854_100100404 3300005578 Bacteria 2169
110 Ga0068854_100834893 3300005578 Bacteria 805
111 Ga0068854_101388335 3300005578 Bacteria 635
112 Ga0068856_100006279 3300005614 Bacteria 11665
113 Ga0068856_100204211 3300005614 Bacteria 1991
114 Ga0068856_100818773 3300005614 Unclassified 951
115 Ga0068852_100004861 3300005616 Bacteria 9544
116 Ga0068852_100015401 3300005616 Bacteria 5929
117 Ga0068852_100053937 3300005616 Bacteria 3463
118 Ga0068864_100029850 3300005618 Bacteria 4621
119 Ga0068851_10069408 3300005834 Bacteria 1820
120 Ga0068863_100195730 3300005841 Bacteria 1943
121 Ga0068862_100050979 3300005844 Bacteria 3539
122 Ga0097620_100284883 3300006931 Bacteria 1745
123 Ga0105240_10105255 3300009093 Unclassified 3425
124 Ga0105240_10397483 3300009093 Bacteria 1553
125 Ga0105243_10145035 3300009148 Bacteria 2030
126 Ga0105241_10048345 3300009174 Bacteria 3237
127 Ga0105248_10020866 3300009177 Bacteria 7259
128 Ga0105248_10043180 3300009177 Bacteria 5055
129 Ga0105238_10074694 3300009551 Bacteria 3382
130 Ga0157373_10025084 3300013100 Bacteria 4316
131 Ga0157373_10058201 3300013100 Bacteria 2741
132 Ga0157373_10074148 3300013100 Bacteria 2401
133 Ga0157373_10102158 3300013100 Bacteria 2017
134 Ga0157373_10104730 3300013100 Bacteria 1989
135 Ga0157373_10188593 3300013100 Bacteria 1453
136 Ga0157373_10339378 3300013100 Unclassified 1071
137 Ga0157373_10450642 3300013100 Bacteria 926
138 Ga0157373_10612312 3300013100 Unclassified 793
139 Ga0157373_10644990 3300013100 Unclassified 773
140 Ga0157371_10001746 3300013102 Bacteria 22024
141 Ga0157371_10009760 3300013102 Bacteria 7531
142 Ga0157371_10021246 3300013102 Bacteria 4767
143 Ga0157371_10091249 3300013102 Bacteria 2158
144 Ga0157371_10170422 3300013102 Unclassified 1555
145 Ga0157371_10310128 3300013102 Bacteria 1143
146 Ga0157370_10016941 3300013104 Bacteria 7366
147 Ga0157370_10055403 3300013104 Bacteria 3778
148 Ga0157370_10260692 3300013104 Bacteria 1602
149 Ga0157370_10896345 3300013104 Bacteria 805
150 Ga0157369_10000635 3300013105 Bacteria 45411
151 Ga0157369_10009337 3300013105 Bacteria 11218
152 Ga0157369_10105633 3300013105 Unclassified 2998
153 Ga0157369_10284995 3300013105 Bacteria 1720
154 Ga0157369_10713991 3300013105 Bacteria 1032
155 Ga0157369_11061661 3300013105 Bacteria 828
156 Ga0157369_11061662 3300013105 Bacteria 828
157 Ga0157369_11915130 3300013105 Unclassified 602
158 Ga0163162_11270127 3300013306 Bacteria 836
159 Ga0157372_11142030 3300013307 Unclassified 901
160 Ga0157375_10035922 3300013308 Bacteria 4734
161 Ga0157375_10036330 3300013308 Bacteria 4712
162 Ga0163163_10596658 3300014325 Unclassified 1168
163 Ga0163161_10794861 3300017792 Unclassified 795
164 Ga0207682_10019258 3300025893 Bacteria 2671
165 Ga0207682_10176809 3300025893 Bacteria 973
166 Ga0207688_10430510 3300025901 Unclassified 821
167 Ga0207680_10093536 3300025903 Bacteria 1918
168 Ga0207647_10031316 3300025904 Bacteria 3423
169 Ga0207647_10065601 3300025904 Bacteria 2203
170 Ga0207705_10000070 3300025909 Bacteria 130733
171 Ga0207705_10001142 3300025909 Bacteria 21619
172 Ga0207705_10004509 3300025909 Bacteria 10525
173 Ga0207705_10004558 3300025909 Bacteria 10461
174 Ga0207705_10015334 3300025909 Bacteria 5498
175 Ga0207705_10024597 3300025909 Bacteria 4296
176 Ga0207705_10372854 3300025909 Bacteria 1102
177 Ga0207705_10527515 3300025909 Bacteria 918
178 Ga0207705_10635155 3300025909 Bacteria 830
179 Ga0207707_10114456 3300025912 Bacteria 2357
180 Ga0207707_10346476 3300025912 Bacteria 1280
181 Ga0207695_10046801 3300025913 Bacteria 4582
182 Ga0207695_10089498 3300025913 Bacteria 3095
183 Ga0207660_10106834 3300025917 Bacteria 2099
184 Ga0207660_10132495 3300025917 Bacteria 1898
185 Ga0207660_10255643 3300025917 Bacteria 1383
186 Ga0207660_10668708 3300025917 Bacteria 847
187 Ga0207657_10000020 3300025919 Bacteria 157826
188 Ga0207657_10001366 3300025919 Bacteria 26016
189 Ga0207657_10004033 3300025919 Bacteria 15600
190 Ga0207657_10006559 3300025919 Bacteria 12050
191 Ga0207657_10006721 3300025919 Bacteria 11879
192 Ga0207657_10224773 3300025919 Bacteria 1503
193 Ga0207657_10269515 3300025919 Unclassified 1353
194 Ga0207649_10001591 3300025920 Bacteria 13201
195 Ga0207649_10031047 3300025920 Bacteria 3171
196 Ga0207649_10056363 3300025920 Bacteria 2454
197 Ga0207652_10048284 3300025921 Bacteria 3638
198 Ga0207652_10090775 3300025921 Bacteria 2685
199 Ga0207652_10154531 3300025921 Bacteria 2055
200 Ga0207652_10199063 3300025921 Unclassified 1803
201 Ga0207652_10249595 3300025921 Bacteria 1600
202 Ga0207681_10113659 3300025923 Bacteria 1974
203 Ga0207650_10157750 3300025925 Bacteria 1795
204 Ga0207650_10488388 3300025925 Unclassified 1028
205 Ga0207659_10009651 3300025926 Bacteria 6038
206 Ga0207659_11038407 3300025926 Unclassified 705
207 Ga0207664_10376770 3300025929 Bacteria 1259
208 Ga0207644_10000596 3300025931 Bacteria 23007
209 Ga0207644_10248973 3300025931 Unclassified 1417
210 Ga0207690_10034180 3300025932 Bacteria 3274
211 Ga0207690_10095699 3300025932 Bacteria 2110
212 Ga0207690_10123725 3300025932 Bacteria 1883
213 Ga0207690_10354663 3300025932 Bacteria 1161
214 Ga0207690_10448850 3300025932 Bacteria 1036
215 Ga0207706_10025481 3300025933 Bacteria 5298
216 Ga0207706_10050204 3300025933 Bacteria 3687
217 Ga0207706_10082933 3300025933 Bacteria 2818
218 Ga0207706_10142307 3300025933 Bacteria 2110
219 Ga0207706_10145257 3300025933 Bacteria 2086
220 Ga0207706_10323800 3300025933 Unclassified 1341
221 Ga0207691_10019460 3300025940 Bacteria 6422
222 Ga0207691_10047073 3300025940 Bacteria 3960
223 Ga0207691_10900622 3300025940 Unclassified 741
224 Ga0207711_10051965 3300025941 Bacteria 3511
225 Ga0207661_10125431 3300025944 Bacteria 2192
226 Ga0207679_10010811 3300025945 Bacteria 5885
227 Ga0207679_10048913 3300025945 Bacteria 3081
228 Ga0207679_10073332 3300025945 Bacteria 2589
229 Ga0207679_10238771 3300025945 Bacteria 1539
230 Ga0207679_10368881 3300025945 Bacteria 1256
231 Ga0207679_11054373 3300025945 Unclassified 745
232 Ga0207667_10002757 3300025949 Bacteria 21723
233 Ga0207667_10005183 3300025949 Bacteria 15916
234 Ga0207667_10070412 3300025949 Bacteria 3640
235 Ga0207667_10130030 3300025949 Bacteria 2593
236 Ga0207651_10029114 3300025960 Bacteria 3495
237 Ga0207651_10165896 3300025960 Bacteria 1736
238 Ga0207651_10618866 3300025960 Unclassified 948
239 Ga0207668_10108616 3300025972 Bacteria 2077
240 Ga0207668_10638890 3300025972 Bacteria 931
241 Ga0207640_10012568 3300025981 Bacteria 4827
242 Ga0207640_10025973 3300025981 Unclassified 3552
243 Ga0207658_10031937 3300025986 Bacteria 3743
244 Ga0207658_11137900 3300025986 Unclassified 713
245 Ga0207678_10007633 3300026067 Bacteria 9557
246 Ga0207678_10017126 3300026067 Bacteria 6363
247 Ga0207678_10026147 3300026067 Bacteria 5093
248 Ga0207678_10055264 3300026067 Bacteria 3420
249 Ga0207678_10558643 3300026067 Unclassified 1001
250 Ga0207702_10008339 3300026078 Bacteria 8749
251 Ga0207702_10010680 3300026078 Bacteria 7673
252 Ga0207702_10168218 3300026078 Bacteria 2007
253 Ga0207702_10237208 3300026078 Bacteria 1707
254 Ga0207641_10172231 3300026088 Bacteria 1977
255 Ga0207648_10370834 3300026089 Bacteria 1293
256 Ga0207676_10013702 3300026095 Bacteria 5822
257 Ga0207674_10575323 3300026116 Bacteria 1088
258 Ga0207683_10085286 3300026121 Bacteria 2807
259 Ga0207683_10926434 3300026121 Bacteria 809
260 Ga0207698_10005006 3300026142 Bacteria 8129
261 Ga0207698_10010916 3300026142 Bacteria 5866
262 Ga0207698_10019368 3300026142 Bacteria 4657
263 Ga0207698_10498029 3300026142 Bacteria 1185
264 Ga0268266_10018093 3300028379 Bacteria 6006
265 Ga0268265_10614943 3300028380 Bacteria 1040
266 Ga0307408_100164511 3300031548 Bacteria 1765
267 Ga0307405_10094910 3300031731 Bacteria 1985
268 Ga0307405_10514092 3300031731 Bacteria 962
269 Ga0307413_10038146 3300031824 Bacteria 2782
270 Ga0307413_10429089 3300031824 Bacteria 1043
271 Ga0307413_10507008 3300031824 Bacteria 970
272 Ga0307410_10069311 3300031852 Bacteria 2439
273 Ga0307410_10186606 3300031852 Bacteria 1574
274 Ga0307406_10140705 3300031901 Bacteria 1708
275 Ga0307406_10143049 3300031901 Bacteria 1696
276 Ga0307407_10118125 3300031903 Bacteria 1676
277 Ga0307407_10186333 3300031903 Bacteria 1379
278 Ga0307407_10652981 3300031903 Bacteria 788
279 Ga0307412_10391785 3300031911 Bacteria 1128
280 Ga0307412_10453328 3300031911 Bacteria 1057
281 Ga0307409_100216626 3300031995 Bacteria 1725
282 Ga0307409_100258176 3300031995 Bacteria 1597
283 Ga0307409_100268849 3300031995 Bacteria 1569
284 Ga0307409_101522418 3300031995 Unclassified 696
285 Ga0307416_100248367 3300032002 Bacteria 1730
286 Ga0307416_100434439 3300032002 Bacteria 1361
287 Ga0307414_10206908 3300032004 Bacteria 1601
288 Ga0307414_10273533 3300032004 Bacteria 1416
289 Ga0307414_10724387 3300032004 Unclassified 902
290 Ga0307411_10319151 3300032005 Bacteria 1254
291 Ga0307411_10455416 3300032005 Bacteria 1071
292 Ga0307415_100241106 3300032126 Unclassified 1462
293 Ga0307415_100282524 3300032126 Bacteria 1366
294 Ga0307415_100409534 3300032126 Bacteria 1160
295 Ga0395899_0001422 3300037312 Bacteria 20514
296 Ga0395899_0027327 3300037312 Bacteria 4302
297 Ga0395899_0047452 3300037312 Bacteria 3197
298 Ga0395899_0064340 3300037312 Bacteria 2696
299 Ga0395899_0118847 3300037312 Unclassified 1895
300 Ga0395899_0133316 3300037312 Bacteria 1772
301 Ga0395899_0142328 3300037312 Bacteria 1705
302 Ga0395899_0671067 3300037312 Unclassified 653
303 Ga0395900_0001183 3300037418 Bacteria 32377
304 Ga0395900_0019761 3300037418 Bacteria 6865
305 Ga0395900_0124594 3300037418 Bacteria 2642
306 Ga0395900_0134761 3300037418 Bacteria 2530
307 Ga0395900_0145779 3300037418 Bacteria 2421
308 Ga0395900_0180389 3300037418 Bacteria 2146
309 Ga0395900_0336446 3300037418 Bacteria 1486
310 Ga0395900_0458216 3300037418 Bacteria 1230
311 Ga0395898_0007452 3300037466 Bacteria 11615
312 Ga0395898_0015801 3300037466 Bacteria 7736
313 Ga0395898_0038059 3300037466 Bacteria 4770
314 Ga0395898_0043960 3300037466 Bacteria 4400
315 Ga0395898_0068765 3300037466 Unclassified 3427
316 Ga0395898_0107670 3300037466 Bacteria 2673
317 Ga0395898_0122066 3300037466 Bacteria 2496
318 Ga0395898_0162764 3300037466 Bacteria 2134
319 Ga0395905_0025549 3300037471 Bacteria 5569
320 Ga0395905_0123592 3300037471 Bacteria 2434
321 Ga0395905_0135351 3300037471 Bacteria 2318
322 Ga0395905_0157807 3300037471 Bacteria 2133
323 Ga0395905_0214967 3300037471 Bacteria 1800
324 Ga0395905_0234443 3300037471 Bacteria 1716
325 Ga0395905_1202468 3300037471 Unclassified 661
326 Ga0395901_0000108 3300038443 Bacteria 113046
327 Ga0395901_0052067 3300038443 Bacteria 4255
328 Ga0395901_0055179 3300038443 Bacteria 4131
329 Ga0395901_0085304 3300038443 Bacteria 3301
330 Ga0395901_0091394 3300038443 Bacteria 3186
331 Ga0395901_0254589 3300038443 Bacteria 1828
332 Ga0395901_0299621 3300038443 Bacteria 1667
333 Ga0395901_0788009 3300038443 Bacteria 940
334 Ga0395901_0799298 3300038443 Unclassified 932
335 Ga0450891_011608 3300042129 Bacteria 816
336 Ga0466969_0005345 3300044656 Bacteria 6833
337 Ga0466972_0082811 3300044658 Bacteria 1527
338 Ga0466966_0000001 3300044684 Bacteria 410376
339 Ga0466966_0006537 3300044684 Bacteria 7714
340 Ga0466966_0129151 3300044684 Bacteria 1548
341 Ga0466966_0378291 3300044684 Bacteria 851
342 Ga0466961_0021775 3300044693 Bacteria 4124
343 Ga0466961_0136384 3300044693 Unclassified 1537
344 Ga0466963_0014277 3300044694 Bacteria 4895
345 Ga0466963_0048591 3300044694 Bacteria 2804
346 Ga0466963_0158512 3300044694 Bacteria 1574
347 Ga0466964_0494732 3300044706 Bacteria 656
348 Ga0466971_0035070 3300044719 Bacteria 2249
349 Ga0466970_0054851 3300044765 Bacteria 2128
350 Ga0466970_0095281 3300044765 Bacteria 1618
351 Ga0466957_0013451 3300044842 Bacteria 4746
352 Ga0466957_0056847 3300044842 Bacteria 2393
353 Ga0466957_0135170 3300044842 Bacteria 1584
354 Ga0466957_0327043 3300044842 Bacteria 1035
355 Ga0466959_0011957 3300045049 Bacteria 6258
356 Ga0466959_0509039 3300045049 Unclassified 813
357 Ga0466958_0004982 3300045836 Bacteria 7087
358 Ga0466958_0131187 3300045836 Bacteria 1574
359 Ga0466958_0422644 3300045836 Unclassified 862
360 Ga0466967_0093343 3300045976 Bacteria 2738
361 Ga0466967_0188076 3300045976 Bacteria 1950
362 Ga0466967_0230444 3300045976 Bacteria 1763
363 Ga0466967_0959018 3300045976 Bacteria 851
364 Ga0495669_0014723 3300046684 Bacteria 3345
365 Ga0495669_0016433 3300046684 Bacteria 3169
366 Ga0495669_0032384 3300046684 Bacteria 2298
367 Ga0495636_0620189 3300047318 Unclassified 530
368 Ga0495685_117559 3300047447 Bacteria 873
369 Ga0496100_0131503 3300048903 Bacteria 1763
370 Ga0496101_0135294 3300048904 Bacteria 1875
371 Ga0496103_0213116 3300048906 Bacteria 1242
372 Ga0496107_0013746 3300048910 Bacteria 5661
373 Ga0496108_0059858 3300048911 Bacteria 3203
374 Ga0496109_0045020 3300048912 Bacteria 4004
375 Ga0496109_0299100 3300048912 Bacteria 1517
376 Ga0496110_0004504 3300048913 Bacteria 10808
377 Ga0496111_0047919 3300048914 Bacteria 3078
378 Ga0496112_0011471 3300048915 Bacteria 8094
379 Ga0496112_0418057 3300048915 Bacteria 1280
380 Ga0496113_0016934 3300048916 Bacteria 5046
381 Ga0496113_0195230 3300048916 Bacteria 1608
382 Ga0501047_0900625 3300049581 Unclassified 698
383 Ga0501069_0255380 3300049585 Unclassified 1023
384 Ga0501080_0068594 3300049742 Bacteria 3299
385 Ga0466962_0006702 3300061719 Bacteria 5521
386 2885428281 2885427238 Bacteria 2291351
387 Ga0070658_10004180
388 MBSR1b_contig_341097
389 MBSR1b_contig_7744953
390 JGI24736J21556_1000764
391 JGI24741J21665_1001903
392 JGI24740J21852_10075026
393 JGI24739J22299_10004539
394 JGI24743J22301_10104969
395 Ga0070658_10004728
396 Ga0070658_10005205
397 Ga0070658_10021207
398 Ga0070658_10052118
399 Ga0070658_10074360
400 Ga0070658_10137652
401 Ga0070658_10202093
402 Ga0070658_10619051
403 Ga0070658_10726369
404 Ga0070676_10190016
405 Ga0070683_100205843
406 Ga0070670_100001804
407 Ga0070670_100113125
408 Ga0070677_10012072
409 Ga0070677_10052453
410 Ga0070666_10124735
411 Ga0070680_100064429
412 Ga0070680_100111566
413 Ga0070680_100111900
414 Ga0070680_100938234
415 Ga0070660_100000663
416 Ga0070660_100005122
417 Ga0070660_100006152
418 Ga0070660_100033740
419 Ga0070660_100325382
420 Ga0070660_100383908
421 Ga0070660_100550378
422 Ga0070661_100007447
423 Ga0070661_100017511
424 Ga0070661_100017997
425 Ga0070661_100397520
426 Ga0070661_100458498
427 Ga0070692_10002376
428 Ga0070692_10012570
429 Ga0070692_10267751
430 Ga0070692_10268686
431 Ga0070692_10435215
432 Ga0070669_100023314
433 Ga0070669_100029654
434 Ga0070669_100084556
435 Ga0070669_100255642
436 Ga0070675_100002951
437 Ga0070671_100000624
438 Ga0070671_100099521
439 Ga0070671_100127697
440 Ga0070673_100009944
441 Ga0070673_100734509
442 Ga0070673_100742939
443 Ga0070659_100019849
444 Ga0070659_100034132
445 Ga0070659_100153143
446 Ga0070659_100189350
447 Ga0070659_100287957
448 Ga0070659_100298818
449 Ga0070667_100080100
450 Ga0070667_101412859
451 Ga0070714_100392012
452 Ga0070663_100005201
453 Ga0070663_100008864
454 Ga0070663_100112511
455 Ga0070663_100114356
456 Ga0070663_100830557
457 Ga0070663_101127995
458 Ga0070678_100021378
459 Ga0070678_100396852
460 Ga0070662_100016505
461 Ga0070662_100041412
462 Ga0070662_100094436
463 Ga0070662_100110021
464 Ga0070662_100287358
465 Ga0070681_10292175
466 Ga0070681_10296456
467 Ga0070679_100076805
468 Ga0070679_100102674
469 Ga0070679_100123339
470 Ga0070679_100215707
471 Ga0070679_100302847
472 Ga0070679_100431996
473 Ga0070679_101433180
474 Ga0070684_100490687
475 Ga0068853_100032267
476 Ga0068853_100060184
477 Ga0070672_100011838
478 Ga0070672_100120908
479 Ga0070693_100014798
480 Ga0070693_100026621
481 Ga0070665_100020552
482 Ga0070665_100133619
483 Ga0068855_100004077
484 Ga0068855_100032800
485 Ga0068855_100575602
486 Ga0068855_101230826
487 Ga0070664_100003489
488 Ga0070664_100053221
489 Ga0070664_100066269
490 Ga0070664_100265224
491 Ga0070664_100386154
492 Ga0070664_100503799
493 Ga0068857_100442026
494 Ga0068854_100018045
495 Ga0068854_100100404
496 Ga0068854_100834893
497 Ga0068854_101388335
498 Ga0068856_100006279
499 Ga0068856_100204211
500 Ga0068856_100818773
501 Ga0068852_100004861
502 Ga0068852_100015401
503 Ga0068852_100053937
504 Ga0068864_100029850
505 Ga0068851_10069408
506 Ga0068863_100195730
507 Ga0068862_100050979
508 Ga0097620_100284883
509 Ga0105240_10105255
510 Ga0105240_10397483
511 Ga0105243_10145035
512 Ga0105241_10048345
513 Ga0105248_10020866
514 Ga0105248_10043180
515 Ga0105238_10074694
516 Ga0157373_10025084
517 Ga0157373_10058201
518 Ga0157373_10074148
519 Ga0157373_10102158
520 Ga0157373_10104730
521 Ga0157373_10188593
522 Ga0157373_10339378
523 Ga0157373_10450642
524 Ga0157373_10612312
525 Ga0157373_10644990
526 Ga0157371_10001746
527 Ga0157371_10009760
528 Ga0157371_10021246
529 Ga0157371_10091249
530 Ga0157371_10170422
531 Ga0157371_10310128
532 Ga0157370_10016941
533 Ga0157370_10055403
534 Ga0157370_10260692
535 Ga0157370_10896345
536 Ga0157369_10000635
537 Ga0157369_10009337
538 Ga0157369_10105633
539 Ga0157369_10284995
540 Ga0157369_10713991
541 Ga0157369_11061661
542 Ga0157369_11061662
543 Ga0157369_11915130
544 Ga0163162_11270127
545 Ga0157372_11142030
546 Ga0157375_10035922
547 Ga0157375_10036330
548 Ga0163163_10596658
549 Ga0163161_10794861
550 Ga0207682_10019258
551 Ga0207682_10176809
552 Ga0207688_10430510
553 Ga0207680_10093536
554 Ga0207647_10031316
555 Ga0207647_10065601
556 Ga0207705_10000070
557 Ga0207705_10001142
558 Ga0207705_10004509
559 Ga0207705_10004558
560 Ga0207705_10015334
561 Ga0207705_10024597
562 Ga0207705_10372854
563 Ga0207705_10527515
564 Ga0207705_10635155
565 Ga0207707_10114456
566 Ga0207707_10346476
567 Ga0207695_10046801
568 Ga0207695_10089498
569 Ga0207660_10106834
570 Ga0207660_10132495
571 Ga0207660_10255643
572 Ga0207660_10668708
573 Ga0207657_10000020
574 Ga0207657_10001366
575 Ga0207657_10004033
576 Ga0207657_10006559
577 Ga0207657_10006721
578 Ga0207657_10224773
579 Ga0207657_10269515
580 Ga0207649_10001591
581 Ga0207649_10031047
582 Ga0207649_10056363
583 Ga0207652_10048284
584 Ga0207652_10090775
585 Ga0207652_10154531
586 Ga0207652_10199063
587 Ga0207652_10249595
588 Ga0207681_10113659
589 Ga0207650_10157750
590 Ga0207650_10488388
591 Ga0207659_10009651
592 Ga0207659_11038407
593 Ga0207664_10376770
594 Ga0207644_10000596
595 Ga0207644_10248973
596 Ga0207690_10034180
597 Ga0207690_10095699
598 Ga0207690_10123725
599 Ga0207690_10354663
600 Ga0207690_10448850
601 Ga0207706_10025481
602 Ga0207706_10050204
603 Ga0207706_10082933
604 Ga0207706_10142307
605 Ga0207706_10145257
606 Ga0207706_10323800
607 Ga0207691_10019460
608 Ga0207691_10047073
609 Ga0207691_10900622
610 Ga0207711_10051965
611 Ga0207661_10125431
612 Ga0207679_10010811
613 Ga0207679_10048913
614 Ga0207679_10073332
615 Ga0207679_10238771
616 Ga0207679_10368881
617 Ga0207679_11054373
618 Ga0207667_10002757
619 Ga0207667_10005183
620 Ga0207667_10070412
621 Ga0207667_10130030
622 Ga0207651_10029114
623 Ga0207651_10165896
624 Ga0207651_10618866
625 Ga0207668_10108616
626 Ga0207668_10638890
627 Ga0207640_10012568
628 Ga0207640_10025973
629 Ga0207658_10031937
630 Ga0207658_11137900
631 Ga0207678_10007633
632 Ga0207678_10017126
633 Ga0207678_10026147
634 Ga0207678_10055264
635 Ga0207678_10558643
636 Ga0207702_10008339
637 Ga0207702_10010680
638 Ga0207702_10168218
639 Ga0207702_10237208
640 Ga0207641_10172231
641 Ga0207648_10370834
642 Ga0207676_10013702
643 Ga0207674_10575323
644 Ga0207683_10085286
645 Ga0207683_10926434
646 Ga0207698_10005006
647 Ga0207698_10010916
648 Ga0207698_10019368
649 Ga0207698_10498029
650 Ga0268266_10018093
651 Ga0268265_10614943
652 Ga0307408_100164511
653 Ga0307405_10094910
654 Ga0307405_10514092
655 Ga0307413_10038146
656 Ga0307413_10429089
657 Ga0307413_10507008
658 Ga0307410_10069311
659 Ga0307410_10186606
660 Ga0307406_10140705
661 Ga0307406_10143049
662 Ga0307407_10118125
663 Ga0307407_10186333
664 Ga0307407_10652981
665 Ga0307412_10391785
666 Ga0307412_10453328
667 Ga0307409_100216626
668 Ga0307409_100258176
669 Ga0307409_100268849
670 Ga0307409_101522418
671 Ga0307416_100248367
672 Ga0307416_100434439
673 Ga0307414_10206908
674 Ga0307414_10273533
675 Ga0307414_10724387
676 Ga0307411_10319151
677 Ga0307411_10455416
678 Ga0307415_100241106
679 Ga0307415_100282524
680 Ga0307415_100409534
681 Ga0395899_0001422
682 Ga0395899_0027327
683 Ga0395899_0047452
684 Ga0395899_0064340
685 Ga0395899_0118847
686 Ga0395899_0133316
687 Ga0395899_0142328
688 Ga0395899_0671067
689 Ga0395900_0001183
690 Ga0395900_0019761
691 Ga0395900_0124594
692 Ga0395900_0134761
693 Ga0395900_0145779
694 Ga0395900_0180389
695 Ga0395900_0336446
696 Ga0395900_0458216
697 Ga0395898_0007452
698 Ga0395898_0015801
699 Ga0395898_0038059
700 Ga0395898_0043960
701 Ga0395898_0068765
702 Ga0395898_0107670
703 Ga0395898_0122066
704 Ga0395898_0162764
705 Ga0395905_0025549
706 Ga0395905_0123592
707 Ga0395905_0135351
708 Ga0395905_0157807
709 Ga0395905_0214967
710 Ga0395905_0234443
711 Ga0395905_1202468
712 Ga0395901_0000108
713 Ga0395901_0052067
714 Ga0395901_0055179
715 Ga0395901_0085304
716 Ga0395901_0091394
717 Ga0395901_0254589
718 Ga0395901_0299621
719 Ga0395901_0788009
720 Ga0395901_0799298
721 Ga0450891_011608
722 Ga0466969_0005345
723 Ga0466972_0082811
724 Ga0466966_0000001
725 Ga0466966_0006537
726 Ga0466966_0129151
727 Ga0466966_0378291
728 Ga0466961_0021775
729 Ga0466961_0136384
730 Ga0466963_0014277
731 Ga0466963_0048591
732 Ga0466963_0158512
733 Ga0466964_0494732
734 Ga0466971_0035070
735 Ga0466970_0054851
736 Ga0466970_0095281
737 Ga0466957_0013451
738 Ga0466957_0056847
739 Ga0466957_0135170
740 Ga0466957_0327043
741 Ga0466959_0011957
742 Ga0466959_0509039
743 Ga0466958_0004982
744 Ga0466958_0131187
745 Ga0466958_0422644
746 Ga0466967_0093343
747 Ga0466967_0188076
748 Ga0466967_0230444
749 Ga0466967_0959018
750 Ga0495669_0014723
751 Ga0495669_0016433
752 Ga0495669_0032384
753 Ga0495636_0620189
754 Ga0495685_117559
755 Ga0496100_0131503
756 Ga0496101_0135294
757 Ga0496103_0213116
758 Ga0496107_0013746
759 Ga0496108_0059858
760 Ga0496109_0045020
761 Ga0496109_0299100
762 Ga0496110_0004504
763 Ga0496111_0047919
764 Ga0496112_0011471
765 Ga0496112_0418057
766 Ga0496113_0016934
767 Ga0496113_0195230
768 Ga0501047_0900625
769 Ga0501069_0255380
770 Ga0501080_0068594
771 Ga0466962_0006702
772 2885428281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.6037 19 170
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.5693 19 170
3p5n-assembly1.cif.gz_B structure and mechanism of the s component of a bacterial ecf transporter 0.5596 21 173
3p5n-assembly1.cif.gz_B structure and mechanism of the s component of a bacterial ecf transporter 0.521 21 173
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.4056 19 167
ID Description Score Start End Superfamily
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8414 19 165 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8119 19 165 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7513 20 168 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6844 20 168 1.10.1760.20
3p5nB00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5596 21 173 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A5D0X3J4-F1-model_v4 Rod shape-determining protein MreD 0.9621 20 172 GO:0005886
GO:0008360
AF-G6EJ85-F1-model_v4 Rod shape-determining protein MreD 0.9609 20 171 GO:0016020
AF-A0A2P7QHK2-F1-model_v4 Rod shape-determining protein MreD 0.9599 20 173 GO:0005886
GO:0008360
AF-A0A437M9F4-F1-model_v4 Rod shape-determining protein MreD 0.9599 20 173 GO:0016020
AF-A0A537MEZ1-F1-model_v4 Rod shape-determining protein MreD 0.9564 20 173 GO:0005886
GO:0008360

Map