F430271

General Info

Members Datasets Scaffolds Average Seq Length
385 218 385 132

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0690808|Ga0466963_0690808_12_437
Length 141
Sequence MAELFGPDMPLTDIPIFSMLRTRLEWAQSRQRVLAENVANSDTPNFRPRDLVPPKFDSLSAGAPRVQLATTESGHIPGLGAAGGDAFRTEREGAYDVRPTGNAVNLEDEMIKVAANQMDYQSVTALYTRSLNLLKTAIGKA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
213 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
214 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
215 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.83
Nodule 0
Rhizoplane 2.86
Rhizosphere 86.75
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10046282 3300005327 Bacteria 3520
2 Ga0070658_10060468 3300005327 Bacteria 3085
3 Ga0070658_10435621 3300005327 Bacteria 1128
4 Ga0070683_100292809 3300005329 Bacteria 1548
5 Ga0070680_100003355 3300005336 Bacteria 11953
6 Ga0070680_100006680 3300005336 Bacteria 8780
7 Ga0070660_100169240 3300005339 Bacteria 1764
8 Ga0070661_100262722 3300005344 Bacteria 1335
9 Ga0070661_100475798 3300005344 Bacteria 997
10 Ga0070659_100027792 3300005366 Bacteria 4361
11 Ga0070709_10480569 3300005434 Bacteria 941
12 Ga0070714_100034541 3300005435 Bacteria 4234
13 Ga0070714_100071193 3300005435 Bacteria 3006
14 Ga0070714_101848402 3300005435 Bacteria 590
15 Ga0070713_102105227 3300005436 Bacteria 547
16 Ga0070710_10312673 3300005437 Bacteria 1029
17 Ga0070711_100447224 3300005439 Bacteria 1057
18 Ga0070681_10198469 3300005458 Bacteria 1925
19 Ga0070681_10659364 3300005458 Bacteria 961
20 Ga0070679_100092737 3300005530 Bacteria 3007
21 Ga0070679_100118223 3300005530 Bacteria 2635
22 Ga0070679_100318237 3300005530 Bacteria 1505
23 Ga0070679_100495010 3300005530 Bacteria 1166
24 Ga0068855_100022437 3300005563 Bacteria 7567
25 Ga0068855_100041711 3300005563 Bacteria 5438
26 Ga0068855_100164434 3300005563 Bacteria 2516
27 Ga0068855_101709151 3300005563 Bacteria 641
28 Ga0068857_100266682 3300005577 Bacteria 1573
29 Ga0068854_100356205 3300005578 Bacteria 1199
30 Ga0068856_100164913 3300005614 Bacteria 2227
31 Ga0068856_100435378 3300005614 Bacteria 1331
32 Ga0068856_100695769 3300005614 Bacteria 1037
33 Ga0068852_100035922 3300005616 Bacteria 4140
34 Ga0068852_102347459 3300005616 Bacteria 554
35 Ga0068861_101558172 3300005719 Bacteria 650
36 Ga0081455_10855372 3300005937 Bacteria 568
37 Ga0070717_11282377 3300006028 Bacteria 666
38 Ga0075368_10283665 3300006042 Bacteria 712
39 Ga0075363_100639899 3300006048 Bacteria 639
40 Ga0070715_10486282 3300006163 Bacteria 704
41 Ga0070716_101465940 3300006173 Bacteria 557
42 Ga0070712_100339516 3300006175 Bacteria 1226
43 Ga0075367_10364833 3300006178 Bacteria 912
44 Ga0075367_10574999 3300006178 Bacteria 716
45 Ga0075367_10689451 3300006178 Bacteria 650
46 Ga0075366_10466257 3300006195 Bacteria 780
47 Ga0075370_10207655 3300006353 Bacteria 1156
48 Ga0075434_100069935 3300006871 Bacteria 3500
49 Ga0075434_102348061 3300006871 Bacteria 536
50 Ga0075429_100180468 3300006880 Bacteria 1850
51 Ga0075435_101516061 3300007076 Bacteria 588
52 Ga0099795_10000385 3300007788 Bacteria 8012
53 Ga0105240_10028630 3300009093 Bacteria 7272
54 Ga0105240_10789368 3300009093 Bacteria 1029
55 Ga0111539_10124404 3300009094 Bacteria 3022
56 Ga0111539_12394552 3300009094 Bacteria 612
57 Ga0105247_11465643 3300009101 Bacteria 555
58 Ga0114129_10020079 3300009147 Bacteria 9509
59 Ga0114129_10469536 3300009147 Bacteria 1648
60 Ga0105237_10150210 3300009545 Bacteria 2326
61 Ga0105238_10031150 3300009551 Bacteria 5429
62 Ga0105238_10876035 3300009551 Bacteria 916
63 Ga0099796_10001383 3300010159 Bacteria 4849
64 Ga0099796_10323043 3300010159 Unclassified 659
65 Ga0157371_10052092 3300013102 Bacteria 2907
66 Ga0157371_10606482 3300013102 Bacteria 814
67 Ga0157370_10025572 3300013104 Bacteria 5843
68 Ga0157370_11774176 3300013104 Bacteria 554
69 Ga0157369_11000578 3300013105 Bacteria 856
70 Ga0157378_10175972 3300013297 Bacteria 2010
71 Ga0157372_10410096 3300013307 Bacteria 1579
72 Ga0157372_11532340 3300013307 Bacteria 768
73 Ga0163163_11870092 3300014325 Bacteria 660
74 Ga0206356_10120254 3300020070 Bacteria 745
75 Ga0206353_10244068 3300020082 Bacteria 628
76 Ga0206353_10478658 3300020082 Bacteria 868
77 Ga0213875_10083212 3300021388 Bacteria 1493
78 Ga0209758_1066322 3300025297 Bacteria 1160
79 Ga0207692_10138361 3300025898 Bacteria 1382
80 Ga0207699_10334936 3300025906 Bacteria 1065
81 Ga0207705_10057145 3300025909 Bacteria 2814
82 Ga0207705_10067364 3300025909 Bacteria 2591
83 Ga0207705_10282975 3300025909 Bacteria 1270
84 Ga0207707_10014456 3300025912 Bacteria 6875
85 Ga0207707_10090669 3300025912 Bacteria 2671
86 Ga0207695_10178278 3300025913 Bacteria 2047
87 Ga0207695_10381671 3300025913 Bacteria 1295
88 Ga0207693_10411496 3300025915 Bacteria 1057
89 Ga0207663_10074868 3300025916 Bacteria 2195
90 Ga0207663_10206033 3300025916 Bacteria 1422
91 Ga0207660_10021504 3300025917 Bacteria 4338
92 Ga0207660_10034282 3300025917 Bacteria 3517
93 Ga0207657_10322038 3300025919 Bacteria 1222
94 Ga0207649_10156041 3300025920 Bacteria 1577
95 Ga0207649_10481835 3300025920 Bacteria 941
96 Ga0207649_10502876 3300025920 Bacteria 922
97 Ga0207652_10005948 3300025921 Bacteria 9871
98 Ga0207652_10017331 3300025921 Bacteria 5894
99 Ga0207652_10194199 3300025921 Bacteria 1826
100 Ga0207694_10126108 3300025924 Bacteria 2048
101 Ga0207700_10044410 3300025928 Bacteria 3271
102 Ga0207700_12006012 3300025928 Bacteria 505
103 Ga0207664_10165620 3300025929 Bacteria 1888
104 Ga0207664_10183127 3300025929 Bacteria 1799
105 Ga0207664_10930494 3300025929 Bacteria 780
106 Ga0207665_10095941 3300025939 Bacteria 2062
107 Ga0207665_10531196 3300025939 Bacteria 912
108 Ga0207661_10063330 3300025944 Bacteria 2995
109 Ga0207661_10143521 3300025944 Bacteria 2057
110 Ga0207667_10008346 3300025949 Bacteria 12310
111 Ga0207667_10083972 3300025949 Bacteria 3297
112 Ga0207667_10201848 3300025949 Bacteria 2040
113 Ga0207667_10378277 3300025949 Bacteria 1443
114 Ga0207667_10492473 3300025949 Bacteria 1244
115 Ga0207640_10029854 3300025981 Bacteria 3351
116 Ga0207702_10374417 3300026078 Bacteria 1368
117 Ga0207702_10755942 3300026078 Bacteria 960
118 Ga0207674_10260133 3300026116 Bacteria 1683
119 Ga0207698_10770294 3300026142 Bacteria 962
120 Ga0207698_11081361 3300026142 Bacteria 814
121 Ga0209179_1000387 3300027512 Bacteria 4348
122 Ga0265318_10056989 3300028577 Bacteria 1460
123 Ga0265338_10006337 3300028800 Bacteria 15116
124 Ga0265338_10209629 3300028800 Bacteria 1463
125 Ga0265338_10257907 3300028800 Bacteria 1283
126 Ga0265330_10279935 3300031235 Bacteria 703
127 Ga0265320_10150495 3300031240 Bacteria 1051
128 Ga0265325_10005357 3300031241 Bacteria 7934
129 Ga0265325_10124624 3300031241 Bacteria 1239
130 Ga0265325_10145267 3300031241 Bacteria 1125
131 Ga0265325_10385357 3300031241 Bacteria 615
132 Ga0265325_10477034 3300031241 Bacteria 542
133 Ga0265340_10023229 3300031247 Bacteria 3163
134 Ga0265340_10138823 3300031247 Bacteria 1112
135 Ga0265340_10558439 3300031247 Bacteria 504
136 Ga0265339_10001451 3300031249 Bacteria 17559
137 Ga0265339_10042812 3300031249 Bacteria 2506
138 Ga0265339_10509254 3300031249 Bacteria 555
139 Ga0265331_10057932 3300031250 Bacteria 1836
140 Ga0307408_100286477 3300031548 Bacteria 1374
141 Ga0265313_10000366 3300031595 Bacteria 49088
142 Ga0265313_10013962 3300031595 Bacteria 4781
143 Ga0265313_10104797 3300031595 Bacteria 1250
144 Ga0307508_10706992 3300031616 Bacteria 618
145 Ga0316579_10003088 3300031691 Bacteria 6422
146 Ga0265314_10001247 3300031711 Bacteria 29026
147 Ga0265314_10011299 3300031711 Bacteria 7383
148 Ga0265314_10098088 3300031711 Bacteria 1891
149 Ga0265314_10332983 3300031711 Bacteria 841
150 Ga0265342_10001039 3300031712 Bacteria 27198
151 Ga0265342_10004932 3300031712 Bacteria 10304
152 Ga0265342_10167004 3300031712 Bacteria 1213
153 Ga0307410_10530420 3300031852 Bacteria 973
154 Ga0307410_12078649 3300031852 Bacteria 508
155 Ga0307406_10622367 3300031901 Bacteria 893
156 Ga0307406_11602345 3300031901 Unclassified 575
157 Ga0307409_100466835 3300031995 Bacteria 1222
158 Ga0307409_100496677 3300031995 Bacteria 1187
159 Ga0307411_10765848 3300032005 Bacteria 847
160 Ga0307415_100353936 3300032126 Bacteria 1237
161 Ga0373934_0020106 3300035086 Bacteria 2566
162 Ga0373934_0033729 3300035086 Bacteria 2010
163 Ga0373944_0246998 3300035089 Bacteria 658
164 Ga0373923_0145480 3300035111 Bacteria 1073
165 Ga0373923_0164067 3300035111 Bacteria 1015
166 Ga0373936_0000545 3300035113 Bacteria 12908
167 Ga0373936_0266548 3300035113 Bacteria 768
168 Ga0373953_0013515 3300035117 Bacteria 2917
169 Ga0373954_0007849 3300035118 Bacteria 4674
170 Ga0373954_0041363 3300035118 Bacteria 2149
171 Ga0373956_0005348 3300035119 Bacteria 5138
172 Ga0373956_0010173 3300035119 Bacteria 3845
173 Ga0373957_0034400 3300035120 Bacteria 1876
174 Ga0373957_0067431 3300035120 Bacteria 1395
175 Ga0373957_0148983 3300035120 Bacteria 960
176 Ga0373943_0000449 3300035170 Bacteria 17431
177 Ga0373943_0086952 3300035170 Bacteria 1613
178 Ga0373946_0140154 3300035171 Bacteria 1120
179 Ga0373946_0184392 3300035171 Bacteria 992
180 Ga0373955_0000177 3300035172 Bacteria 26296
181 Ga0373955_0008083 3300035172 Bacteria 4865
182 Ga0373961_0409249 3300035241 Bacteria 522
183 Ga0373924_0000051 3300035410 Bacteria 29889
184 Ga0373924_0039127 3300035410 Bacteria 1937
185 Ga0373935_0000018 3300035692 Bacteria 68811
186 Ga0373927_0089864 3300035695 Bacteria 1994
187 Ga0373933_0001351 3300035724 Bacteria 14455
188 Ga0373947_0000264 3300035725 Bacteria 29727
189 Ga0373947_0253355 3300035725 Bacteria 1165
190 Ga0373947_1244469 3300035725 Bacteria 507
191 Ga0373937_0000571 3300036401 Bacteria 32663
192 Ga0373937_0004518 3300036401 Bacteria 11814
193 Ga0373937_0025258 3300036401 Bacteria 5364
194 Ga0373937_0552329 3300036401 Bacteria 1094
195 Ga0373925_0000018 3300037068 Bacteria 174213
196 Ga0373925_0037613 3300037068 Bacteria 3574
197 Ga0395898_0506835 3300037466 Bacteria 1148
198 Ga0316581_0047919 3300037588 Bacteria 1308
199 Ga0436364_0100714 3300037853 Bacteria 617
200 Ga0436364_0585319 3300037853 Bacteria 1564
201 Ga0436364_0865851 3300037853 Bacteria 2163
202 Ga0395901_0196888 3300038443 Bacteria 2113
203 Ga0451837_1385630 3300041494 Bacteria 883
204 Ga0466963_0072096 3300044694 Bacteria 2326
205 Ga0466963_0178112 3300044694 Bacteria 1484
206 Ga0466963_0690808 3300044694 Bacteria 720
207 Ga0466971_0212747 3300044719 Bacteria 915
208 Ga0466958_0913852 3300045836 Bacteria 573
209 Ga0466967_0112948 3300045976 Bacteria 2498
210 Ga0495617_262598 3300046452 Unclassified 531
211 Ga0495592_0000001 3300046454 Bacteria 305819
212 Ga0495592_0063289 3300046454 Bacteria 2714
213 Ga0495592_0537100 3300046454 Bacteria 721
214 Ga0495629_0012920 3300046459 Bacteria 6040
215 Ga0495629_0093680 3300046459 Bacteria 2096
216 Ga0495638_0015516 3300046460 Bacteria 5114
217 Ga0495638_0054703 3300046460 Bacteria 2480
218 Ga0495638_0535736 3300046460 Bacteria 584
219 Ga0495641_0087922 3300046461 Bacteria 1390
220 Ga0495651_0004527 3300046462 Bacteria 10630
221 Ga0495651_0285050 3300046462 Bacteria 1114
222 Ga0495651_0339286 3300046462 Bacteria 996
223 Ga0495653_0000015 3300046463 Bacteria 213697
224 Ga0495653_0579785 3300046463 Bacteria 691
225 Ga0495582_0106445 3300046473 Bacteria 1573
226 Ga0495582_0500845 3300046473 Bacteria 702
227 Ga0495662_0029207 3300046476 Bacteria 2662
228 Ga0495664_0000001 3300046477 Bacteria 757730
229 Ga0495608_0000116 3300046511 Bacteria 56633
230 Ga0495608_0062859 3300046511 Bacteria 2438
231 Ga0495618_0000021 3300046514 Bacteria 129750
232 Ga0495628_0000005 3300046516 Bacteria 420969
233 Ga0495630_0001024 3300046517 Bacteria 19309
234 Ga0495630_0676537 3300046517 Bacteria 790
235 Ga0495652_0000001 3300046529 Bacteria 1045081
236 Ga0495652_1060814 3300046529 Bacteria 528
237 Ga0495640_0000006 3300046533 Bacteria 285419
238 Ga0495586_0319318 3300046535 Bacteria 891
239 Ga0495587_0000012 3300046536 Bacteria 197088
240 Ga0495645_0000004 3300046543 Bacteria 532661
241 Ga0495667_0000001 3300046559 Bacteria 834831
242 Ga0495667_0017507 3300046559 Bacteria 4840
243 Ga0495667_0148765 3300046559 Bacteria 1508
244 Ga0495667_0183719 3300046559 Bacteria 1341
245 Ga0495634_0000388 3300046642 Bacteria 42999
246 Ga0495635_0000007 3300046663 Bacteria 278786
247 Ga0495635_0022386 3300046663 Bacteria 4401
248 Ga0495635_0125063 3300046663 Bacteria 1754
249 Ga0495635_0177818 3300046663 Bacteria 1447
250 Ga0495657_0000250 3300046675 Bacteria 48717
251 Ga0495657_0041194 3300046675 Bacteria 3163
252 Ga0495599_0000002 3300046678 Bacteria 348168
253 Ga0495623_0000116 3300046679 Bacteria 48662
254 Ga0495623_0344900 3300046679 Bacteria 813
255 Ga0495646_0000049 3300046680 Bacteria 60856
256 Ga0495658_0005862 3300046683 Bacteria 6032
257 Ga0495658_0284738 3300046683 Bacteria 1043
258 Ga0495613_0089361 3300046689 Bacteria 2232
259 Ga0495613_0217940 3300046689 Bacteria 1340
260 Ga0495624_0152493 3300046690 Bacteria 1413
261 Ga0495600_0000013 3300046809 Bacteria 119404
262 Ga0495600_0194807 3300046809 Bacteria 1302
263 Ga0495600_0411878 3300046809 Bacteria 840
264 Ga0495604_0000007 3300047317 Bacteria 412174
265 Ga0495604_0003594 3300047317 Bacteria 12361
266 Ga0495674_0000001 3300047319 Bacteria 778665
267 Ga0495672_0141240 3300047320 Bacteria 1258
268 Ga0495676_0978362 3300047321 Bacteria 540
269 Ga0495680_0004250 3300047322 Bacteria 13751
270 Ga0495680_0026226 3300047322 Bacteria 4809
271 Ga0495680_0054431 3300047322 Bacteria 3107
272 Ga0495675_0000014 3300047444 Bacteria 137646
273 Ga0495675_0037936 3300047444 Bacteria 3068
274 Ga0495675_0297258 3300047444 Bacteria 960
275 Ga0495675_0653581 3300047444 Bacteria 592
276 Ga0495684_0000219 3300047471 Bacteria 44380
277 Ga0495684_0222922 3300047471 Bacteria 1382
278 Ga0495593_0000454 3300047673 Bacteria 23017
279 Ga0495593_0166964 3300047673 Bacteria 1110
280 Ga0495593_0183684 3300047673 Bacteria 1053
281 Ga0495602_0000004 3300048088 Bacteria 326932
282 Ga0495602_0064297 3300048088 Bacteria 3173
283 Ga0495602_0470765 3300048088 Bacteria 883
284 Ga0496100_0212965 3300048903 Bacteria 1414
285 Ga0496102_0645104 3300048905 Bacteria 982
286 Ga0496104_0000361 3300048907 Bacteria 40378
287 Ga0496104_0010237 3300048907 Bacteria 8374
288 Ga0496105_0060767 3300048908 Bacteria 3118
289 Ga0496105_0205620 3300048908 Bacteria 1606
290 Ga0496108_0261864 3300048911 Bacteria 1505
291 Ga0496109_0108346 3300048912 Bacteria 2582
292 Ga0496112_0362549 3300048915 Bacteria 1391
293 Ga0496114_0451140 3300048917 Bacteria 1139
294 Ga0496115_0149323 3300048918 Bacteria 1929
295 Ga0501031_0453312 3300049568 Bacteria 828
296 Ga0501032_0017773 3300049569 Bacteria 4991
297 Ga0501032_0091981 3300049569 Bacteria 2012
298 Ga0501033_0129795 3300049570 Bacteria 1826
299 Ga0501033_0424003 3300049570 Bacteria 926
300 Ga0501033_0578496 3300049570 Bacteria 772
301 Ga0501034_0068995 3300049571 Bacteria 3546
302 Ga0501034_0081042 3300049571 Bacteria 3249
303 Ga0501034_0326010 3300049571 Bacteria 1468
304 Ga0501034_0335658 3300049571 Bacteria 1442
305 Ga0501034_0965862 3300049571 Bacteria 737
306 Ga0501036_0047287 3300049572 Bacteria 3644
307 Ga0501037_0018243 3300049573 Bacteria 5170
308 Ga0501037_0344212 3300049573 Bacteria 1029
309 Ga0501038_0010995 3300049574 Bacteria 8264
310 Ga0501038_0206403 3300049574 Bacteria 1574
311 Ga0501039_0311072 3300049575 Bacteria 1238
312 Ga0501043_0126242 3300049579 Bacteria 2006
313 Ga0501043_0476298 3300049579 Bacteria 935
314 Ga0501047_0047801 3300049581 Bacteria 4133
315 Ga0501047_0088045 3300049581 Bacteria 2982
316 Ga0501047_0091740 3300049581 Bacteria 2916
317 Ga0501047_0112825 3300049581 Bacteria 2600
318 Ga0501047_0168758 3300049581 Bacteria 2058
319 Ga0501047_0461026 3300049581 Bacteria 1100
320 Ga0501047_0962253 3300049581 Bacteria 667
321 Ga0501047_1128073 3300049581 Bacteria 597
322 Ga0501067_0099199 3300049583 Bacteria 1618
323 Ga0501070_0018376 3300049586 Bacteria 5866
324 Ga0501070_0035360 3300049586 Bacteria 4175
325 Ga0501070_0040714 3300049586 Bacteria 3874
326 Ga0501070_0318657 3300049586 Bacteria 1265
327 Ga0501070_0767209 3300049586 Bacteria 759
328 Ga0501070_1239766 3300049586 Bacteria 571
329 Ga0501071_0372201 3300049587 Bacteria 1089
330 Ga0501071_0564402 3300049587 Bacteria 874
331 Ga0501072_1213534 3300049588 Unclassified 586
332 Ga0501074_0061475 3300049590 Bacteria 2706
333 Ga0501075_0391969 3300049591 Bacteria 1059
334 Ga0501080_1228668 3300049742 Bacteria 643
335 Ga0501035_0095865 3300049822 Bacteria 2607
336 Ga0501035_0444509 3300049822 Bacteria 1073
337 Ga0501035_0701268 3300049822 Bacteria 816
338 Ga0501044_0026144 3300049823 Bacteria 6182
339 Ga0501044_0338301 3300049823 Bacteria 1426
340 Ga0501044_0354231 3300049823 Bacteria 1387
341 nmdc:mga03n38_655631_c1 3300050490 Bacteria 602
342 nmdc:mga0yw44_287138_c1 3300050492 Bacteria 1100
343 nmdc:mga0yw44_671607_c1 3300050492 Bacteria 704
344 nmdc:mga0k408_287573_c1 3300050493 Bacteria 981
345 nmdc:mga06z11_409300_c1 3300050494 Bacteria 817
346 nmdc:mga05p37_37142_c1 3300050507 Bacteria 5974
347 nmdc:mga09592_111289_c1 3300050508 Bacteria 2349
348 nmdc:mga09592_1712265_c1 3300050508 Bacteria 507
349 nmdc:mga08y16_1509637_c1 3300050511 Bacteria 632
350 nmdc:mga0n895_255310_c1 3300050512 Bacteria 1779
351 nmdc:mga0n895_37825_c1 3300050512 Bacteria 4671
352 nmdc:mga0n895_545069_c1 3300050512 Bacteria 1166
353 nmdc:mga0rr50_100972_c1 3300050513 Bacteria 2267
354 nmdc:mga0rr50_1472687_c1 3300050513 Bacteria 576
355 Ga0495601_0000006 3300053077 Bacteria 373770
356 Ga0495601_0000255 3300053077 Bacteria 28587
357 Ga0495612_0000004 3300053078 Bacteria 286946
358 Ga0495595_0000006 3300053084 Bacteria 231295
359 Ga0495595_0003045 3300053084 Bacteria 6628
360 Ga0495595_0008241 3300053084 Bacteria 4280
361 Ga0495619_0000161 3300053085 Bacteria 49400
362 Ga0495619_0000240 3300053085 Bacteria 39732
363 Ga0495619_0244465 3300053085 Bacteria 1243
364 Ga0500643_006735 3300053087 Bacteria 4748
365 Ga0500643_043807 3300053087 Bacteria 1303
366 Ga0500644_0001049 3300053088 Bacteria 8235
367 Ga0500646_0038208 3300053090 Bacteria 1343
368 Ga0500651_0146297 3300053093 Bacteria 1421
369 Ga0500641_0176771 3300053096 Unclassified 917
370 Ga0500650_0142074 3300053098 Bacteria 1113
371 Ga0500572_085009 3300053111 Bacteria 996
372 Ga0500594_0056729 3300053118 Bacteria 1118
373 Ga0500595_000056 3300053119 Bacteria 83521
374 Ga0500642_0100340 3300053130 Bacteria 1346
375 Ga0500652_001412 3300053131 Bacteria 7464
376 Ga0500658_0355223 3300053134 Bacteria 672
377 Ga0500573_0192313 3300053140 Bacteria 1089
378 Ga0500573_0330939 3300053140 Bacteria 748
379 Ga0500577_0107259 3300053142 Bacteria 1149
380 Ga0500577_0140466 3300053142 Bacteria 1018
381 Ga0500588_0015632 3300053146 Bacteria 1948
382 Ga0500604_0048992 3300053151 Bacteria 1298
383 Ga0500616_0000006 3300053153 Bacteria 944738
384 Ga0500645_000384 3300053730 Bacteria 30994
385 Ga0501082_0206352 3300060353 Bacteria 1710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0039127 Ga0373924_0039127_1592_1927 107
2 3300035725 Ga0373947_1244469 Ga0373947_1244469_42_377 107
3 3300046460 Ga0495638_0535736 Ga0495638_0535736_221_574 115
4 3300035120 Ga0373957_0034400 Ga0373957_0034400_15_380 117
5 3300041494 Ga0451837_1385630 Ga0451837_1385630_73_492 117
6 3300046529 Ga0495652_1060814 Ga0495652_1060814_10_375 117
7 3300005937 Ga0081455_10855372 Ga0081455_108553721 118
8 3300006178 Ga0075367_10574999 Ga0075367_105749992 118
9 3300006178 Ga0075367_10689451 Ga0075367_106894512 118
10 3300006195 Ga0075366_10466257 Ga0075366_104662572 118
11 3300050490 nmdc:mga03n38_655631_c1 nmdc:mga03n38_655631_c1_184_552 118
12 3300050493 nmdc:mga0k408_287573_c1 nmdc:mga0k408_287573_c1_61_429 118
13 3300050494 nmdc:mga06z11_409300_c1 nmdc:mga06z11_409300_c1_134_502 118
14 3300046461 Ga0495641_0087922 Ga0495641_0087922_1006_1371 119
15 3300053098 Ga0500650_0142074 Ga0500650_0142074_23_391 120
16 3300053142 Ga0500577_0140466 Ga0500577_0140466_14_382 120
17 3300035111 Ga0373923_0164067 Ga0373923_0164067_156_536 122
18 3300047444 Ga0495675_0653581 Ga0495675_0653581_30_410 122
19 3300006871 Ga0075434_100069935 Ga0075434_1000699352 124
20 3300050512 nmdc:mga0n895_37825_c1 nmdc:mga0n895_37825_c1_3358_3765 124
21 3300006173 Ga0070716_101465940 Ga0070716_1014659401 127
22 3300006871 Ga0075434_102348061 Ga0075434_1023480611 127
23 3300025939 Ga0207665_10531196 Ga0207665_105311962 127
24 3300035118 Ga0373954_0041363 Ga0373954_0041363_614_1003 127
25 3300035170 Ga0373943_0086952 Ga0373943_0086952_1132_1521 127
26 3300035725 Ga0373947_0253355 Ga0373947_0253355_575_964 127
27 3300036401 Ga0373937_0552329 Ga0373937_0552329_96_485 127
28 3300037068 Ga0373925_0037613 Ga0373925_0037613_1131_1520 127
29 3300046454 Ga0495592_0537100 Ga0495592_0537100_16_405 127
30 3300046459 Ga0495629_0093680 Ga0495629_0093680_1392_1781 127
31 3300046462 Ga0495651_0339286 Ga0495651_0339286_535_924 127
32 3300046473 Ga0495582_0106445 Ga0495582_0106445_552_941 127
33 3300046517 Ga0495630_0676537 Ga0495630_0676537_29_418 127
34 3300046559 Ga0495667_0148765 Ga0495667_0148765_75_464 127
35 3300046663 Ga0495635_0177818 Ga0495635_0177818_154_543 127
36 3300046683 Ga0495658_0284738 Ga0495658_0284738_331_720 127
37 3300046689 Ga0495613_0089361 Ga0495613_0089361_380_769 127
38 3300047321 Ga0495676_0978362 Ga0495676_0978362_125_514 127
39 3300047444 Ga0495675_0297258 Ga0495675_0297258_352_741 127
40 3300047471 Ga0495684_0222922 Ga0495684_0222922_229_618 127
41 3300047673 Ga0495593_0166964 Ga0495593_0166964_318_707 127
42 3300048088 Ga0495602_0470765 Ga0495602_0470765_16_405 127
43 3300050512 nmdc:mga0n895_255310_c1 nmdc:mga0n895_255310_c1_81_470 127
44 3300050513 nmdc:mga0rr50_100972_c1 nmdc:mga0rr50_100972_c1_957_1346 127
45 3300005437 Ga0070710_10312673 Ga0070710_103126731 128
46 3300006042 Ga0075368_10283665 Ga0075368_102836652 128
47 3300007076 Ga0075435_101516061 Ga0075435_1015160612 128
48 3300021388 Ga0213875_10083212 Ga0213875_100832123 128
49 3300028800 Ga0265338_10006337 Ga0265338_1000633716 128
50 3300031241 Ga0265325_10005357 Ga0265325_100053575 128
51 3300031249 Ga0265339_10001451 Ga0265339_100014512 128
52 3300031595 Ga0265313_10000366 Ga0265313_1000036616 128
53 3300031712 Ga0265342_10167004 Ga0265342_101670042 128
54 3300037853 Ga0436364_0585319 Ga0436364_0585319_285_680 128
55 3300037853 Ga0436364_0865851 Ga0436364_0865851_765_1160 128
56 3300050513 nmdc:mga0rr50_1472687_c1 nmdc:mga0rr50_1472687_c1_135_527 128
57 3300005434 Ga0070709_10480569 Ga0070709_104805692 129
58 3300005435 Ga0070714_101848402 Ga0070714_1018484021 129
59 3300005439 Ga0070711_100447224 Ga0070711_1004472242 129
60 3300005719 Ga0068861_101558172 Ga0068861_1015581721 129
61 3300006028 Ga0070717_11282377 Ga0070717_112823771 129
62 3300006163 Ga0070715_10486282 Ga0070715_104862822 129
63 3300007788 Ga0099795_10000385 Ga0099795_1000038510 129
64 3300009101 Ga0105247_11465643 Ga0105247_114656431 129
65 3300010159 Ga0099796_10001383 Ga0099796_100013834 129
66 3300013297 Ga0157378_10175972 Ga0157378_101759722 129
67 3300025906 Ga0207699_10334936 Ga0207699_103349362 129
68 3300025916 Ga0207663_10074868 Ga0207663_100748682 129
69 3300025916 Ga0207663_10206033 Ga0207663_102060332 129
70 3300025928 Ga0207700_10044410 Ga0207700_100444103 129
71 3300025928 Ga0207700_12006012 Ga0207700_120060121 129
72 3300025929 Ga0207664_10930494 Ga0207664_109304942 129
73 3300025939 Ga0207665_10095941 Ga0207665_100959415 129
74 3300027512 Ga0209179_1000387 Ga0209179_10003872 129
75 3300035086 Ga0373934_0033729 Ga0373934_0033729_402_797 129
76 3300035089 Ga0373944_0246998 Ga0373944_0246998_44_439 129
77 3300035111 Ga0373923_0145480 Ga0373923_0145480_90_485 129
78 3300035113 Ga0373936_0000545 Ga0373936_0000545_1396_1791 129
79 3300035117 Ga0373953_0013515 Ga0373953_0013515_1250_1645 129
80 3300035119 Ga0373956_0010173 Ga0373956_0010173_1629_2024 129
81 3300035120 Ga0373957_0067431 Ga0373957_0067431_957_1352 129
82 3300035170 Ga0373943_0000449 Ga0373943_0000449_14089_14484 129
83 3300035171 Ga0373946_0140154 Ga0373946_0140154_450_845 129
84 3300035172 Ga0373955_0000177 Ga0373955_0000177_25125_25520 129
85 3300035410 Ga0373924_0000051 Ga0373924_0000051_24000_24395 129
86 3300035692 Ga0373935_0000018 Ga0373935_0000018_40771_41166 129
87 3300035695 Ga0373927_0089864 Ga0373927_0089864_520_915 129
88 3300035725 Ga0373947_0000264 Ga0373947_0000264_24376_24771 129
89 3300036401 Ga0373937_0000571 Ga0373937_0000571_5789_6184 129
90 3300037068 Ga0373925_0000018 Ga0373925_0000018_25523_25918 129
91 3300044694 Ga0466963_0072096 Ga0466963_0072096_1433_1828 129
92 3300045976 Ga0466967_0112948 Ga0466967_0112948_1120_1515 129
93 3300046454 Ga0495592_0000001 Ga0495592_0000001_182479_182874 129
94 3300046459 Ga0495629_0012920 Ga0495629_0012920_1894_2289 129
95 3300046462 Ga0495651_0004527 Ga0495651_0004527_4449_4844 129
96 3300046463 Ga0495653_0000015 Ga0495653_0000015_137514_137909 129
97 3300046473 Ga0495582_0500845 Ga0495582_0500845_111_506 129
98 3300046476 Ga0495662_0029207 Ga0495662_0029207_373_768 129
99 3300046477 Ga0495664_0000001 Ga0495664_0000001_133486_133881 129
100 3300046511 Ga0495608_0000116 Ga0495608_0000116_28073_28468 129
101 3300046514 Ga0495618_0000021 Ga0495618_0000021_102396_102791 129
102 3300046516 Ga0495628_0000005 Ga0495628_0000005_385487_385882 129
103 3300046517 Ga0495630_0001024 Ga0495630_0001024_5335_5730 129
104 3300046529 Ga0495652_0000001 Ga0495652_0000001_693284_693679 129
105 3300046533 Ga0495640_0000006 Ga0495640_0000006_140920_141315 129
106 3300046535 Ga0495586_0319318 Ga0495586_0319318_140_535 129
107 3300046536 Ga0495587_0000012 Ga0495587_0000012_34925_35320 129
108 3300046543 Ga0495645_0000004 Ga0495645_0000004_26992_27387 129
109 3300046559 Ga0495667_0000001 Ga0495667_0000001_533252_533647 129
110 3300046642 Ga0495634_0000388 Ga0495634_0000388_28485_28880 129
111 3300046663 Ga0495635_0000007 Ga0495635_0000007_158020_158415 129
112 3300046675 Ga0495657_0000250 Ga0495657_0000250_34949_35344 129
113 3300046678 Ga0495599_0000002 Ga0495599_0000002_225072_225467 129
114 3300046679 Ga0495623_0000116 Ga0495623_0000116_21890_22285 129
115 3300046680 Ga0495646_0000049 Ga0495646_0000049_25520_25915 129
116 3300046689 Ga0495613_0217940 Ga0495613_0217940_444_839 129
117 3300046690 Ga0495624_0152493 Ga0495624_0152493_483_878 129
118 3300046809 Ga0495600_0000013 Ga0495600_0000013_4136_4531 129
119 3300047317 Ga0495604_0000007 Ga0495604_0000007_60334_60729 129
120 3300047319 Ga0495674_0000001 Ga0495674_0000001_333423_333818 129
121 3300047322 Ga0495680_0004250 Ga0495680_0004250_11848_12243 129
122 3300047444 Ga0495675_0000014 Ga0495675_0000014_14873_15268 129
123 3300047471 Ga0495684_0000219 Ga0495684_0000219_27653_28048 129
124 3300047673 Ga0495593_0000454 Ga0495593_0000454_20918_21313 129
125 3300048088 Ga0495602_0000004 Ga0495602_0000004_34968_35363 129
126 3300048903 Ga0496100_0212965 Ga0496100_0212965_956_1351 129
127 3300048905 Ga0496102_0645104 Ga0496102_0645104_139_534 129
128 3300048907 Ga0496104_0000361 Ga0496104_0000361_24324_24719 129
129 3300048907 Ga0496104_0010237 Ga0496104_0010237_4635_5030 129
130 3300048908 Ga0496105_0060767 Ga0496105_0060767_789_1184 129
131 3300048908 Ga0496105_0205620 Ga0496105_0205620_919_1314 129
132 3300048911 Ga0496108_0261864 Ga0496108_0261864_282_677 129
133 3300048912 Ga0496109_0108346 Ga0496109_0108346_1239_1634 129
134 3300048915 Ga0496112_0362549 Ga0496112_0362549_506_901 129
135 3300048917 Ga0496114_0451140 Ga0496114_0451140_552_947 129
136 3300048918 Ga0496115_0149323 Ga0496115_0149323_175_570 129
137 3300049568 Ga0501031_0453312 Ga0501031_0453312_44_436 129
138 3300049569 Ga0501032_0017773 Ga0501032_0017773_1526_1918 129
139 3300049569 Ga0501032_0091981 Ga0501032_0091981_1008_1400 129
140 3300049570 Ga0501033_0129795 Ga0501033_0129795_1032_1424 129
141 3300049570 Ga0501033_0424003 Ga0501033_0424003_52_444 129
142 3300049571 Ga0501034_0335658 Ga0501034_0335658_611_1003 129
143 3300049572 Ga0501036_0047287 Ga0501036_0047287_1098_1490 129
144 3300049573 Ga0501037_0018243 Ga0501037_0018243_1082_1474 129
145 3300049573 Ga0501037_0344212 Ga0501037_0344212_170_562 129
146 3300049574 Ga0501038_0010995 Ga0501038_0010995_5671_6063 129
147 3300049574 Ga0501038_0206403 Ga0501038_0206403_393_785 129
148 3300049575 Ga0501039_0311072 Ga0501039_0311072_392_784 129
149 3300049579 Ga0501043_0126242 Ga0501043_0126242_440_832 129
150 3300049579 Ga0501043_0476298 Ga0501043_0476298_132_524 129
151 3300049581 Ga0501047_0088045 Ga0501047_0088045_1869_2261 129
152 3300049581 Ga0501047_0112825 Ga0501047_0112825_1991_2383 129
153 3300049586 Ga0501070_0035360 Ga0501070_0035360_3328_3720 129
154 3300049586 Ga0501070_0040714 Ga0501070_0040714_1153_1545 129
155 3300049586 Ga0501070_0767209 Ga0501070_0767209_332_724 129
156 3300049587 Ga0501071_0564402 Ga0501071_0564402_430_822 129
157 3300049588 Ga0501072_1213534 Ga0501072_1213534_174_566 129
158 3300049822 Ga0501035_0095865 Ga0501035_0095865_788_1180 129
159 3300049822 Ga0501035_0701268 Ga0501035_0701268_180_572 129
160 3300049823 Ga0501044_0338301 Ga0501044_0338301_618_1010 129
161 3300050512 nmdc:mga0n895_545069_c1 nmdc:mga0n895_545069_c1_12_407 129
162 3300053077 Ga0495601_0000006 Ga0495601_0000006_173473_173868 129
163 3300053078 Ga0495612_0000004 Ga0495612_0000004_140792_141187 129
164 3300053084 Ga0495595_0000006 Ga0495595_0000006_68238_68633 129
165 3300053085 Ga0495619_0000240 Ga0495619_0000240_4411_4806 129
166 3300006048 Ga0075363_100639899 Ga0075363_1006398991 130
167 3300006178 Ga0075367_10364833 Ga0075367_103648331 130
168 3300006353 Ga0075370_10207655 Ga0075370_102076552 130
169 3300006880 Ga0075429_100180468 Ga0075429_1001804682 130
170 3300009094 Ga0111539_10124404 Ga0111539_101244042 130
171 3300009094 Ga0111539_12394552 Ga0111539_123945521 130
172 3300009147 Ga0114129_10020079 Ga0114129_100200797 130
173 3300010159 Ga0099796_10323043 Ga0099796_103230431 130
174 3300014325 Ga0163163_11870092 Ga0163163_118700921 130
175 3300025297 Ga0209758_1066322 Ga0209758_10663222 130
176 3300031548 Ga0307408_100286477 Ga0307408_1002864773 130
177 3300031616 Ga0307508_10706992 Ga0307508_107069922 130
178 3300031852 Ga0307410_10530420 Ga0307410_105304201 130
179 3300031901 Ga0307406_10622367 Ga0307406_106223672 130
180 3300031901 Ga0307406_11602345 Ga0307406_116023451 130
181 3300031995 Ga0307409_100466835 Ga0307409_1004668352 130
182 3300031995 Ga0307409_100496677 Ga0307409_1004966771 130
183 3300032005 Ga0307411_10765848 Ga0307411_107658482 130
184 3300032126 Ga0307415_100353936 Ga0307415_1003539362 130
185 3300035241 Ga0373961_0409249 Ga0373961_0409249_80_481 130
186 3300046452 Ga0495617_262598 Ga0495617_262598_66_464 130
187 3300046460 Ga0495638_0015516 Ga0495638_0015516_4395_4793 130
188 3300046460 Ga0495638_0054703 Ga0495638_0054703_115_513 130
189 3300047320 Ga0495672_0141240 Ga0495672_0141240_406_804 130
190 3300049571 Ga0501034_0081042 Ga0501034_0081042_1480_1887 130
191 3300049583 Ga0501067_0099199 Ga0501067_0099199_418_816 130
192 3300049822 Ga0501035_0444509 Ga0501035_0444509_132_539 130
193 3300050492 nmdc:mga0yw44_287138_c1 nmdc:mga0yw44_287138_c1_30_434 130
194 3300050492 nmdc:mga0yw44_671607_c1 nmdc:mga0yw44_671607_c1_173_571 130
195 3300050507 nmdc:mga05p37_37142_c1 nmdc:mga05p37_37142_c1_1185_1580 130
196 3300050508 nmdc:mga09592_111289_c1 nmdc:mga09592_111289_c1_606_1001 130
197 3300050511 nmdc:mga08y16_1509637_c1 nmdc:mga08y16_1509637_c1_197_595 130
198 3300053090 Ga0500646_0038208 Ga0500646_0038208_367_765 130
199 3300053096 Ga0500641_0176771 Ga0500641_0176771_421_819 130
200 3300053134 Ga0500658_0355223 Ga0500658_0355223_50_448 130
201 3300053146 Ga0500588_0015632 Ga0500588_0015632_1324_1722 130
202 3300053151 Ga0500604_0048992 Ga0500604_0048992_814_1212 130
203 3300005329 Ga0070683_100292809 Ga0070683_1002928092 131
204 3300005435 Ga0070714_100034541 Ga0070714_1000345415 131
205 3300005436 Ga0070713_102105227 Ga0070713_1021052271 131
206 3300005614 Ga0068856_100695769 Ga0068856_1006957692 131
207 3300006175 Ga0070712_100339516 Ga0070712_1003395161 131
208 3300009147 Ga0114129_10469536 Ga0114129_104695364 131
209 3300009545 Ga0105237_10150210 Ga0105237_101502105 131
210 3300009551 Ga0105238_10876035 Ga0105238_108760352 131
211 3300025898 Ga0207692_10138361 Ga0207692_101383611 131
212 3300025920 Ga0207649_10502876 Ga0207649_105028762 131
213 3300025924 Ga0207694_10126108 Ga0207694_101261081 131
214 3300025929 Ga0207664_10165620 Ga0207664_101656205 131
215 3300025944 Ga0207661_10063330 Ga0207661_100633302 131
216 3300028577 Ga0265318_10056989 Ga0265318_100569892 131
217 3300031235 Ga0265330_10279935 Ga0265330_102799351 131
218 3300031240 Ga0265320_10150495 Ga0265320_101504952 131
219 3300031241 Ga0265325_10124624 Ga0265325_101246242 131
220 3300031241 Ga0265325_10477034 Ga0265325_104770341 131
221 3300031247 Ga0265340_10138823 Ga0265340_101388232 131
222 3300031249 Ga0265339_10509254 Ga0265339_105092541 131
223 3300031250 Ga0265331_10057932 Ga0265331_100579322 131
224 3300031711 Ga0265314_10001247 Ga0265314_1000124712 131
225 3300031711 Ga0265314_10011299 Ga0265314_100112994 131
226 3300031711 Ga0265314_10332983 Ga0265314_103329832 131
227 3300031852 Ga0307410_12078649 Ga0307410_120786491 131
228 3300035113 Ga0373936_0266548 Ga0373936_0266548_217_624 131
229 3300035171 Ga0373946_0184392 Ga0373946_0184392_116_523 131
230 3300037853 Ga0436364_0100714 Ga0436364_0100714_99_506 131
231 3300049570 Ga0501033_0578496 Ga0501033_0578496_97_504 131
232 3300049571 Ga0501034_0326010 Ga0501034_0326010_427_834 131
233 3300049581 Ga0501047_0461026 Ga0501047_0461026_338_745 131
234 3300049581 Ga0501047_0962253 Ga0501047_0962253_31_432 131
235 3300049581 Ga0501047_1128073 Ga0501047_1128073_58_465 131
236 3300049586 Ga0501070_1239766 Ga0501070_1239766_109_516 131
237 3300049591 Ga0501075_0391969 Ga0501075_0391969_240_641 131
238 3300053087 Ga0500643_006735 Ga0500643_006735_279_686 131
239 3300053087 Ga0500643_043807 Ga0500643_043807_828_1235 131
240 3300053088 Ga0500644_0001049 Ga0500644_0001049_2348_2755 131
241 3300053093 Ga0500651_0146297 Ga0500651_0146297_676_1083 131
242 3300053111 Ga0500572_085009 Ga0500572_085009_102_509 131
243 3300053118 Ga0500594_0056729 Ga0500594_0056729_97_504 131
244 3300053119 Ga0500595_000056 Ga0500595_000056_69014_69421 131
245 3300053130 Ga0500642_0100340 Ga0500642_0100340_243_650 131
246 3300053131 Ga0500652_001412 Ga0500652_001412_779_1186 131
247 3300053140 Ga0500573_0192313 Ga0500573_0192313_586_993 131
248 3300053140 Ga0500573_0330939 Ga0500573_0330939_89_496 131
249 3300053142 Ga0500577_0107259 Ga0500577_0107259_706_1113 131
250 3300053153 Ga0500616_0000006 Ga0500616_0000006_329134_329541 131
251 3300053730 Ga0500645_000384 Ga0500645_000384_30306_30713 131
252 3300005327 Ga0070658_10060468 Ga0070658_100604685 132
253 3300005336 Ga0070680_100003355 Ga0070680_10000335513 132
254 3300005339 Ga0070660_100169240 Ga0070660_1001692402 132
255 3300005344 Ga0070661_100262722 Ga0070661_1002627221 132
256 3300005458 Ga0070681_10659364 Ga0070681_106593641 132
257 3300005530 Ga0070679_100092737 Ga0070679_1000927374 132
258 3300005530 Ga0070679_100118223 Ga0070679_1001182232 132
259 3300005563 Ga0068855_100041711 Ga0068855_1000417113 132
260 3300005578 Ga0068854_100356205 Ga0068854_1003562053 132
261 3300005614 Ga0068856_100164913 Ga0068856_1001649131 132
262 3300005616 Ga0068852_102347459 Ga0068852_1023474591 132
263 3300009093 Ga0105240_10028630 Ga0105240_100286306 132
264 3300013102 Ga0157371_10052092 Ga0157371_100520924 132
265 3300013104 Ga0157370_10025572 Ga0157370_100255727 132
266 3300013104 Ga0157370_11774176 Ga0157370_117741762 132
267 3300020070 Ga0206356_10120254 Ga0206356_101202541 132
268 3300025909 Ga0207705_10067364 Ga0207705_100673645 132
269 3300025912 Ga0207707_10014456 Ga0207707_100144564 132
270 3300025913 Ga0207695_10178278 Ga0207695_101782783 132
271 3300025917 Ga0207660_10034282 Ga0207660_100342822 132
272 3300025919 Ga0207657_10322038 Ga0207657_103220381 132
273 3300025920 Ga0207649_10481835 Ga0207649_104818352 132
274 3300025921 Ga0207652_10005948 Ga0207652_1000594813 132
275 3300025921 Ga0207652_10194199 Ga0207652_101941992 132
276 3300025949 Ga0207667_10008346 Ga0207667_1000834613 132
277 3300025949 Ga0207667_10378277 Ga0207667_103782771 132
278 3300025981 Ga0207640_10029854 Ga0207640_100298546 132
279 3300028800 Ga0265338_10209629 Ga0265338_102096292 132
280 3300028800 Ga0265338_10257907 Ga0265338_102579072 132
281 3300031241 Ga0265325_10145267 Ga0265325_101452672 132
282 3300031241 Ga0265325_10385357 Ga0265325_103853571 132
283 3300031247 Ga0265340_10023229 Ga0265340_100232291 132
284 3300031247 Ga0265340_10558439 Ga0265340_105584391 132
285 3300031249 Ga0265339_10042812 Ga0265339_100428123 132
286 3300031595 Ga0265313_10013962 Ga0265313_100139622 132
287 3300031691 Ga0316579_10003088 Ga0316579_100030881 132
288 3300031712 Ga0265342_10004932 Ga0265342_100049324 132
289 3300035086 Ga0373934_0020106 Ga0373934_0020106_237_647 132
290 3300035118 Ga0373954_0007849 Ga0373954_0007849_3057_3467 132
291 3300035119 Ga0373956_0005348 Ga0373956_0005348_1925_2335 132
292 3300035120 Ga0373957_0148983 Ga0373957_0148983_487_897 132
293 3300035172 Ga0373955_0008083 Ga0373955_0008083_4118_4528 132
294 3300035724 Ga0373933_0001351 Ga0373933_0001351_502_912 132
295 3300036401 Ga0373937_0004518 Ga0373937_0004518_706_1116 132
296 3300036401 Ga0373937_0025258 Ga0373937_0025258_750_1160 132
297 3300037466 Ga0395898_0506835 Ga0395898_0506835_524_922 132
298 3300037588 Ga0316581_0047919 Ga0316581_0047919_737_1147 132
299 3300038443 Ga0395901_0196888 Ga0395901_0196888_1384_1782 132
300 3300044694 Ga0466963_0690808 Ga0466963_0690808_12_437 132
301 3300044719 Ga0466971_0212747 Ga0466971_0212747_288_689 132
302 3300045836 Ga0466958_0913852 Ga0466958_0913852_64_465 132
303 3300046454 Ga0495592_0063289 Ga0495592_0063289_95_505 132
304 3300046462 Ga0495651_0285050 Ga0495651_0285050_58_468 132
305 3300046463 Ga0495653_0579785 Ga0495653_0579785_264_674 132
306 3300046511 Ga0495608_0062859 Ga0495608_0062859_148_558 132
307 3300046559 Ga0495667_0017507 Ga0495667_0017507_119_529 132
308 3300046559 Ga0495667_0183719 Ga0495667_0183719_246_656 132
309 3300046663 Ga0495635_0022386 Ga0495635_0022386_2202_2612 132
310 3300046663 Ga0495635_0125063 Ga0495635_0125063_517_927 132
311 3300046675 Ga0495657_0041194 Ga0495657_0041194_837_1247 132
312 3300046679 Ga0495623_0344900 Ga0495623_0344900_231_641 132
313 3300046683 Ga0495658_0005862 Ga0495658_0005862_4964_5374 132
314 3300046809 Ga0495600_0194807 Ga0495600_0194807_614_1024 132
315 3300046809 Ga0495600_0411878 Ga0495600_0411878_315_725 132
316 3300047317 Ga0495604_0003594 Ga0495604_0003594_7572_7982 132
317 3300047322 Ga0495680_0026226 Ga0495680_0026226_3808_4218 132
318 3300047322 Ga0495680_0054431 Ga0495680_0054431_2414_2824 132
319 3300047444 Ga0495675_0037936 Ga0495675_0037936_728_1138 132
320 3300047673 Ga0495593_0183684 Ga0495593_0183684_397_807 132
321 3300048088 Ga0495602_0064297 Ga0495602_0064297_776_1186 132
322 3300049571 Ga0501034_0068995 Ga0501034_0068995_770_1180 132
323 3300049571 Ga0501034_0965862 Ga0501034_0965862_166_564 132
324 3300049581 Ga0501047_0091740 Ga0501047_0091740_387_797 132
325 3300049581 Ga0501047_0168758 Ga0501047_0168758_1015_1413 132
326 3300049586 Ga0501070_0018376 Ga0501070_0018376_2007_2417 132
327 3300049587 Ga0501071_0372201 Ga0501071_0372201_594_1004 132
328 3300049823 Ga0501044_0026144 Ga0501044_0026144_346_756 132
329 3300049823 Ga0501044_0354231 Ga0501044_0354231_396_794 132
330 3300050508 nmdc:mga09592_1712265_c1 nmdc:mga09592_1712265_c1_64_468 132
331 3300053077 Ga0495601_0000255 Ga0495601_0000255_24757_25167 132
332 3300053084 Ga0495595_0003045 Ga0495595_0003045_1361_1771 132
333 3300053084 Ga0495595_0008241 Ga0495595_0008241_3499_3909 132
334 3300053085 Ga0495619_0000161 Ga0495619_0000161_4308_4718 132
335 3300053085 Ga0495619_0244465 Ga0495619_0244465_715_1125 132
336 3300060353 Ga0501082_0206352 Ga0501082_0206352_156_554 132
337 3300005327 Ga0070658_10046282 Ga0070658_100462824 133
338 3300005327 Ga0070658_10435621 Ga0070658_104356213 133
339 3300005336 Ga0070680_100006680 Ga0070680_1000066804 133
340 3300005344 Ga0070661_100475798 Ga0070661_1004757981 133
341 3300005366 Ga0070659_100027792 Ga0070659_1000277926 133
342 3300005435 Ga0070714_100071193 Ga0070714_1000711932 133
343 3300005458 Ga0070681_10198469 Ga0070681_101984693 133
344 3300005530 Ga0070679_100318237 Ga0070679_1003182371 133
345 3300005530 Ga0070679_100495010 Ga0070679_1004950102 133
346 3300005563 Ga0068855_100022437 Ga0068855_1000224374 133
347 3300005563 Ga0068855_100164434 Ga0068855_1001644342 133
348 3300005563 Ga0068855_101709151 Ga0068855_1017091512 133
349 3300005577 Ga0068857_100266682 Ga0068857_1002666822 133
350 3300005614 Ga0068856_100435378 Ga0068856_1004353782 133
351 3300005616 Ga0068852_100035922 Ga0068852_1000359227 133
352 3300009093 Ga0105240_10789368 Ga0105240_107893682 133
353 3300009551 Ga0105238_10031150 Ga0105238_100311502 133
354 3300013102 Ga0157371_10606482 Ga0157371_106064821 133
355 3300013105 Ga0157369_11000578 Ga0157369_110005782 133
356 3300013307 Ga0157372_10410096 Ga0157372_104100962 133
357 3300013307 Ga0157372_11532340 Ga0157372_115323402 133
358 3300020082 Ga0206353_10244068 Ga0206353_102440681 133
359 3300020082 Ga0206353_10478658 Ga0206353_104786582 133
360 3300025909 Ga0207705_10057145 Ga0207705_100571453 133
361 3300025909 Ga0207705_10282975 Ga0207705_102829752 133
362 3300025912 Ga0207707_10090669 Ga0207707_100906697 133
363 3300025913 Ga0207695_10381671 Ga0207695_103816712 133
364 3300025915 Ga0207693_10411496 Ga0207693_104114962 133
365 3300025917 Ga0207660_10021504 Ga0207660_100215044 133
366 3300025920 Ga0207649_10156041 Ga0207649_101560411 133
367 3300025921 Ga0207652_10017331 Ga0207652_100173316 133
368 3300025929 Ga0207664_10183127 Ga0207664_101831272 133
369 3300025944 Ga0207661_10143521 Ga0207661_101435211 133
370 3300025949 Ga0207667_10083972 Ga0207667_100839726 133
371 3300025949 Ga0207667_10201848 Ga0207667_102018483 133
372 3300025949 Ga0207667_10492473 Ga0207667_104924731 133
373 3300026078 Ga0207702_10374417 Ga0207702_103744172 133
374 3300026078 Ga0207702_10755942 Ga0207702_107559422 133
375 3300026116 Ga0207674_10260133 Ga0207674_102601334 133
376 3300026142 Ga0207698_10770294 Ga0207698_107702942 133
377 3300026142 Ga0207698_11081361 Ga0207698_110813612 133
378 3300031595 Ga0265313_10104797 Ga0265313_101047972 133
379 3300031711 Ga0265314_10098088 Ga0265314_100980882 133
380 3300031712 Ga0265342_10001039 Ga0265342_1000103920 133
381 3300044694 Ga0466963_0178112 Ga0466963_0178112_347_748 133
382 3300049581 Ga0501047_0047801 Ga0501047_0047801_3560_3961 133
383 3300049586 Ga0501070_0318657 Ga0501070_0318657_143_544 133
384 3300049590 Ga0501074_0061475 Ga0501074_0061475_1623_2024 133
385 3300049742 Ga0501080_1228668 Ga0501080_1228668_13_414 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

19

47

0.88

Feature Viewer

pLDDT pTM Quality
63.45 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map