F430240

General Info

Members Datasets Scaffolds Average Seq Length
385 147 385 385

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10018394|Ga0307412_100183942
Length 387
Sequence LSFRPLFARSLAAAPGRLHMAAHSHQLWPDASFEGHQQAWLDAASLADRKWDKVMDEVWPEAQANVAFELGVPADRVVFSSNTHDFLIRLFAAAPRRAHGPLRILTSDGEFHSARRQFARWEEEGQALVTRVAAEPFDSFSDRFVEAAQTSEQDLILVSQVLFASGRIFAGIAELSALADPDGPWVVIDGYHAFMAVERPLPEEARDRAFYLGGGYKYAMAGEGMAFLHCPPGFGPRPPLTGWFAEFGDLTAPPGSSVGYTADAMRFMGATFDPSALYRFNAIQRMLREEGLMTAAIAVHVAGLQQRLLDGLSGSALGAAELLNPLGGGPHARFLAFRSPRAAAWNGWLMERGCVTDVRGDVLRIGLGLYHDEADVDAFIALARGLD

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
115 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.79
Rhizosphere 91.95
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003633 3300001979 Bacteria 6725
2 Ga0070658_10001056 3300005327 Bacteria 23556
3 Ga0070658_10001507 3300005327 Bacteria 19770
4 Ga0070658_10012118 3300005327 Bacteria 6923
5 Ga0070658_10018432 3300005327 Bacteria 5587
6 Ga0070676_10013671 3300005328 Bacteria 4449
7 Ga0070676_10043143 3300005328 Bacteria 2620
8 Ga0070683_100001823 3300005329 Bacteria 16621
9 Ga0070690_100006550 3300005330 Bacteria 6612
10 Ga0070670_100006227 3300005331 Bacteria 10094
11 Ga0070670_100007638 3300005331 Bacteria 9189
12 Ga0070670_100010140 3300005331 Bacteria 8037
13 Ga0070670_100028155 3300005331 Bacteria 4835
14 Ga0070666_10000310 3300005335 Bacteria 31154
15 Ga0070666_10003456 3300005335 Bacteria 9571
16 Ga0070666_10023954 3300005335 Bacteria 3975
17 Ga0070666_10073651 3300005335 Bacteria 2326
18 Ga0070680_100029717 3300005336 Bacteria 4388
19 Ga0068868_100005004 3300005338 Bacteria 9310
20 Ga0070660_100000393 3300005339 Bacteria 29017
21 Ga0070660_100005078 3300005339 Bacteria 9095
22 Ga0070660_100005430 3300005339 Bacteria 8827
23 Ga0070660_100023577 3300005339 Bacteria 4559
24 Ga0070660_100058791 3300005339 Bacteria 2981
25 Ga0070660_100180002 3300005339 Bacteria 1710
26 Ga0070687_100015493 3300005343 Bacteria 3450
27 Ga0070661_100002568 3300005344 Bacteria 12449
28 Ga0070661_100059039 3300005344 Bacteria 2812
29 Ga0070661_100094630 3300005344 Bacteria 2214
30 Ga0070661_100101244 3300005344 Bacteria 2143
31 Ga0070692_10000436 3300005345 Bacteria 12687
32 Ga0070692_10000491 3300005345 Bacteria 12172
33 Ga0070675_100009729 3300005354 Bacteria 7491
34 Ga0070675_100042132 3300005354 Bacteria 3729
35 Ga0070675_100118168 3300005354 Bacteria 2251
36 Ga0070671_100007768 3300005355 Bacteria 8567
37 Ga0070671_100013990 3300005355 Bacteria 6479
38 Ga0070671_100030093 3300005355 Bacteria 4480
39 Ga0070671_100123294 3300005355 Bacteria 2181
40 Ga0070674_100010882 3300005356 Bacteria 5518
41 Ga0070674_100048059 3300005356 Bacteria 2927
42 Ga0070673_100084169 3300005364 Bacteria 2586
43 Ga0070659_100008864 3300005366 Bacteria 7371
44 Ga0070659_100019287 3300005366 Bacteria 5165
45 Ga0070667_100029775 3300005367 Bacteria 4551
46 Ga0070667_100048054 3300005367 Bacteria 3591
47 Ga0070714_100170033 3300005435 Bacteria 1977
48 Ga0070713_100007649 3300005436 Bacteria 7604
49 Ga0070713_100019382 3300005436 Bacteria 5192
50 Ga0070663_100000271 3300005455 Bacteria 26098
51 Ga0070663_100034333 3300005455 Bacteria 3513
52 Ga0070663_100053566 3300005455 Bacteria 2881
53 Ga0070678_100000769 3300005456 Bacteria 16071
54 Ga0070678_100001896 3300005456 Bacteria 11265
55 Ga0070678_100045545 3300005456 Bacteria 3139
56 Ga0070678_100120372 3300005456 Bacteria 2069
57 Ga0070662_100000405 3300005457 Bacteria 25630
58 Ga0070662_100001018 3300005457 Bacteria 17157
59 Ga0070662_100010228 3300005457 Bacteria 6151
60 Ga0070662_100033756 3300005457 Bacteria 3605
61 Ga0070662_100091059 3300005457 Bacteria 2290
62 Ga0070681_10015737 3300005458 Bacteria 7540
63 Ga0070681_10234766 3300005458 Bacteria 1748
64 Ga0068867_100037833 3300005459 Bacteria 3509
65 Ga0068867_100313174 3300005459 Bacteria 1298
66 Ga0070679_100000346 3300005530 Bacteria 39334
67 Ga0070679_100093016 3300005530 Bacteria 3003
68 Ga0070679_100137231 3300005530 Bacteria 2427
69 Ga0070679_100234357 3300005530 Bacteria 1795
70 Ga0068853_100025243 3300005539 Bacteria 4987
71 Ga0068853_100409040 3300005539 Bacteria 1271
72 Ga0070672_100014410 3300005543 Bacteria 5603
73 Ga0070672_100025345 3300005543 Bacteria 4397
74 Ga0070665_100019688 3300005548 Bacteria 6775
75 Ga0070665_100026549 3300005548 Bacteria 5831
76 Ga0070665_100055579 3300005548 Bacteria 3970
77 Ga0068855_100001751 3300005563 Bacteria 27092
78 Ga0068855_100016546 3300005563 Bacteria 8871
79 Ga0068855_100037414 3300005563 Bacteria 5771
80 Ga0070664_100003746 3300005564 Bacteria 12266
81 Ga0070664_100006281 3300005564 Bacteria 9589
82 Ga0070664_100016156 3300005564 Bacteria 6117
83 Ga0070664_100019989 3300005564 Bacteria 5512
84 Ga0070664_100145073 3300005564 Bacteria 2093
85 Ga0068854_100014136 3300005578 Bacteria 5256
86 Ga0068854_100214048 3300005578 Bacteria 1521
87 Ga0068856_100026281 3300005614 Bacteria 5676
88 Ga0068856_100081166 3300005614 Bacteria 3217
89 Ga0068852_100049356 3300005616 Bacteria 3600
90 Ga0068852_100067067 3300005616 Bacteria 3136
91 Ga0068859_100014107 3300005617 Bacteria 8014
92 Ga0068859_100020826 3300005617 Bacteria 6582
93 Ga0068866_10017595 3300005718 Bacteria 3217
94 Ga0068851_10006181 3300005834 Bacteria 5466
95 Ga0068851_10030777 3300005834 Bacteria 2663
96 Ga0068863_100000607 3300005841 Bacteria 36378
97 Ga0068863_100079457 3300005841 Bacteria 3106
98 Ga0068858_100006875 3300005842 Bacteria 11055
99 Ga0068858_100012047 3300005842 Bacteria 8151
100 Ga0068860_100061450 3300005843 Bacteria 3570
101 Ga0068860_100068957 3300005843 Bacteria 3361
102 Ga0081539_10010862 3300005985 Bacteria 7314
103 Ga0070717_10045903 3300006028 Bacteria 3573
104 Ga0097621_100043380 3300006237 Bacteria 3625
105 Ga0097621_100238236 3300006237 Bacteria 1590
106 Ga0068871_100041836 3300006358 Bacteria 3676
107 Ga0068871_100068259 3300006358 Bacteria 2919
108 Ga0097620_100014105 3300006931 Bacteria 8014
109 Ga0097620_100020826 3300006931 Bacteria 6582
110 Ga0105245_10210458 3300009098 Bacteria 1871
111 Ga0105248_10003900 3300009177 Bacteria 16492
112 Ga0105248_10015809 3300009177 Bacteria 8318
113 Ga0105248_10027034 3300009177 Bacteria 6383
114 Ga0105248_10039607 3300009177 Bacteria 5280
115 Ga0105248_10242175 3300009177 Bacteria 2030
116 Ga0157373_10006579 3300013100 Bacteria 8667
117 Ga0157373_10017946 3300013100 Bacteria 5152
118 Ga0157373_10138617 3300013100 Bacteria 1710
119 Ga0157373_10177656 3300013100 Bacteria 1499
120 Ga0157371_10001298 3300013102 Bacteria 26285
121 Ga0157371_10090871 3300013102 Bacteria 2163
122 Ga0157370_10002353 3300013104 Bacteria 22828
123 Ga0157370_10015094 3300013104 Bacteria 7870
124 Ga0157370_10041857 3300013104 Bacteria 4417
125 Ga0157369_10009477 3300013105 Bacteria 11133
126 Ga0157369_10027719 3300013105 Bacteria 6276
127 Ga0157369_10035691 3300013105 Bacteria 5450
128 Ga0157369_10102686 3300013105 Bacteria 3046
129 Ga0157369_10152689 3300013105 Bacteria 2441
130 Ga0157374_10015546 3300013296 Bacteria 6677
131 Ga0157374_10113441 3300013296 Bacteria 2609
132 Ga0163162_10004976 3300013306 Bacteria 12799
133 Ga0157375_10005040 3300013308 Bacteria 11472
134 Ga0157375_10283062 3300013308 Bacteria 1821
135 Ga0163163_10032161 3300014325 Bacteria 5067
136 Ga0157376_10055389 3300014969 Bacteria 3308
137 Ga0207697_10049952 3300025315 Bacteria 1726
138 Ga0207697_10083678 3300025315 Bacteria 1346
139 Ga0207680_10040097 3300025903 Bacteria 2722
140 Ga0207680_10061812 3300025903 Bacteria 2285
141 Ga0207647_10001664 3300025904 Bacteria 17118
142 Ga0207647_10001685 3300025904 Bacteria 17028
143 Ga0207647_10070847 3300025904 Bacteria 2105
144 Ga0207645_10047928 3300025907 Bacteria 2728
145 Ga0207705_10000270 3300025909 Bacteria 49639
146 Ga0207705_10000654 3300025909 Bacteria 28865
147 Ga0207705_10006228 3300025909 Bacteria 8862
148 Ga0207705_10012028 3300025909 Bacteria 6253
149 Ga0207705_10012436 3300025909 Bacteria 6148
150 Ga0207705_10034066 3300025909 Bacteria 3640
151 Ga0207705_10075764 3300025909 Bacteria 2444
152 Ga0207707_10015148 3300025912 Bacteria 6712
153 Ga0207707_10173707 3300025912 Bacteria 1883
154 Ga0207707_10348055 3300025912 Bacteria 1277
155 Ga0207660_10148724 3300025917 Bacteria 1798
156 Ga0207662_10016076 3300025918 Bacteria 4217
157 Ga0207657_10000165 3300025919 Bacteria 67173
158 Ga0207657_10001054 3300025919 Bacteria 29233
159 Ga0207657_10001091 3300025919 Bacteria 28769
160 Ga0207657_10003456 3300025919 Bacteria 16857
161 Ga0207657_10006190 3300025919 Bacteria 12435
162 Ga0207657_10047041 3300025919 Bacteria 3776
163 Ga0207657_10071821 3300025919 Bacteria 2929
164 Ga0207657_10072416 3300025919 Bacteria 2915
165 Ga0207649_10011789 3300025920 Bacteria 4833
166 Ga0207649_10040305 3300025920 Bacteria 2838
167 Ga0207649_10061925 3300025920 Bacteria 2357
168 Ga0207652_10000058 3300025921 Bacteria 113620
169 Ga0207652_10032002 3300025921 Bacteria 4418
170 Ga0207652_10113631 3300025921 Bacteria 2404
171 Ga0207652_10295371 3300025921 Bacteria 1462
172 Ga0207650_10005726 3300025925 Bacteria 8477
173 Ga0207650_10161449 3300025925 Bacteria 1776
174 Ga0207659_10005591 3300025926 Bacteria 7632
175 Ga0207659_10007014 3300025926 Bacteria 6919
176 Ga0207664_10241180 3300025929 Bacteria 1574
177 Ga0207644_10000240 3300025931 Bacteria 37642
178 Ga0207644_10000589 3300025931 Bacteria 23204
179 Ga0207644_10003730 3300025931 Bacteria 9879
180 Ga0207644_10009753 3300025931 Bacteria 6313
181 Ga0207644_10044101 3300025931 Bacteria 3167
182 Ga0207644_10060796 3300025931 Bacteria 2734
183 Ga0207690_10046787 3300025932 Bacteria 2867
184 Ga0207690_10073301 3300025932 Bacteria 2367
185 Ga0207706_10002252 3300025933 Bacteria 18838
186 Ga0207706_10004209 3300025933 Bacteria 13551
187 Ga0207706_10004293 3300025933 Bacteria 13391
188 Ga0207706_10005424 3300025933 Bacteria 11885
189 Ga0207706_10007332 3300025933 Bacteria 10200
190 Ga0207706_10026534 3300025933 Bacteria 5185
191 Ga0207706_10042629 3300025933 Bacteria 4022
192 Ga0207706_10134451 3300025933 Bacteria 2175
193 Ga0207669_10001902 3300025937 Bacteria 8856
194 Ga0207669_10004611 3300025937 Bacteria 6084
195 Ga0207665_10009130 3300025939 Bacteria 6508
196 Ga0207691_10001687 3300025940 Bacteria 21797
197 Ga0207691_10009429 3300025940 Bacteria 9375
198 Ga0207691_10073402 3300025940 Bacteria 3086
199 Ga0207711_10010427 3300025941 Bacteria 7715
200 Ga0207711_10013228 3300025941 Bacteria 6857
201 Ga0207711_10023507 3300025941 Bacteria 5159
202 Ga0207711_10053258 3300025941 Bacteria 3470
203 Ga0207711_10070296 3300025941 Bacteria 3035
204 Ga0207661_10002950 3300025944 Bacteria 11762
205 Ga0207679_10004315 3300025945 Bacteria 8844
206 Ga0207679_10009541 3300025945 Bacteria 6221
207 Ga0207679_10021482 3300025945 Bacteria 4377
208 Ga0207679_10090781 3300025945 Bacteria 2362
209 Ga0207679_10099494 3300025945 Bacteria 2271
210 Ga0207667_10000579 3300025949 Bacteria 47716
211 Ga0207667_10068820 3300025949 Bacteria 3685
212 Ga0207667_10078977 3300025949 Bacteria 3410
213 Ga0207667_10160566 3300025949 Bacteria 2312
214 Ga0207651_10002688 3300025960 Bacteria 8513
215 Ga0207651_10066381 3300025960 Bacteria 2534
216 Ga0207651_10071060 3300025960 Bacteria 2465
217 Ga0207640_10049474 3300025981 Bacteria 2722
218 Ga0207658_10011093 3300025986 Bacteria 6137
219 Ga0207658_10027812 3300025986 Bacteria 3977
220 Ga0207677_10002030 3300026023 Bacteria 10679
221 Ga0207703_10008065 3300026035 Bacteria 8323
222 Ga0207639_10275763 3300026041 Bacteria 1477
223 Ga0207678_10000217 3300026067 Bacteria 51179
224 Ga0207678_10009864 3300026067 Bacteria 8388
225 Ga0207678_10021483 3300026067 Bacteria 5660
226 Ga0207678_10050930 3300026067 Bacteria 3576
227 Ga0207678_10062289 3300026067 Bacteria 3207
228 Ga0207702_10015421 3300026078 Bacteria 6329
229 Ga0207702_10019789 3300026078 Bacteria 5573
230 Ga0207702_10069492 3300026078 Bacteria 3028
231 Ga0207641_10029763 3300026088 Bacteria 4516
232 Ga0207641_10174343 3300026088 Bacteria 1965
233 Ga0207648_10005651 3300026089 Bacteria 12555
234 Ga0207648_10183990 3300026089 Bacteria 1850
235 Ga0207676_10024214 3300026095 Bacteria 4489
236 Ga0207683_10000541 3300026121 Bacteria 34994
237 Ga0207683_10002053 3300026121 Bacteria 17819
238 Ga0207683_10005631 3300026121 Bacteria 10745
239 Ga0207683_10124525 3300026121 Bacteria 2316
240 Ga0207698_10000508 3300026142 Bacteria 22632
241 Ga0207698_10009360 3300026142 Bacteria 6244
242 Ga0207698_10056668 3300026142 Bacteria 3027
243 Ga0268266_10068640 3300028379 Bacteria 3070
244 Ga0307408_100060086 3300031548 Bacteria 2770
245 Ga0307408_100128112 3300031548 Bacteria 1977
246 Ga0307408_100160345 3300031548 Bacteria 1786
247 Ga0307408_100283248 3300031548 Bacteria 1381
248 Ga0307405_10002616 3300031731 Bacteria 7999
249 Ga0307413_10043115 3300031824 Bacteria 2656
250 Ga0307413_10109630 3300031824 Bacteria 1845
251 Ga0307410_10000194 3300031852 Bacteria 22605
252 Ga0307410_10002535 3300031852 Bacteria 8837
253 Ga0307410_10031158 3300031852 Bacteria 3418
254 Ga0307410_10035370 3300031852 Bacteria 3243
255 Ga0307407_10000985 3300031903 Bacteria 9755
256 Ga0307407_10006674 3300031903 Bacteria 5158
257 Ga0307407_10007349 3300031903 Bacteria 4984
258 Ga0307407_10032549 3300031903 Bacteria 2836
259 Ga0307407_10060946 3300031903 Bacteria 2203
260 Ga0307412_10018394 3300031911 Bacteria 4204
261 Ga0307412_10044177 3300031911 Bacteria 2906
262 Ga0307412_10067723 3300031911 Bacteria 2425
263 Ga0307412_10085099 3300031911 Bacteria 2197
264 Ga0307409_100000069 3300031995 Bacteria 37984
265 Ga0307409_100001351 3300031995 Bacteria 11931
266 Ga0307409_100001668 3300031995 Bacteria 11161
267 Ga0307409_100005710 3300031995 Bacteria 7212
268 Ga0307409_100062648 3300031995 Bacteria 2912
269 Ga0307409_100073170 3300031995 Bacteria 2732
270 Ga0307416_100005350 3300032002 Bacteria 7875
271 Ga0307416_100048775 3300032002 Bacteria 3362
272 Ga0307416_100228063 3300032002 Bacteria 1793
273 Ga0307416_100257335 3300032002 Bacteria 1703
274 Ga0307414_10000651 3300032004 Bacteria 17739
275 Ga0307414_10000834 3300032004 Bacteria 15720
276 Ga0307414_10004390 3300032004 Bacteria 7657
277 Ga0307411_10000647 3300032005 Bacteria 12652
278 Ga0307411_10001475 3300032005 Bacteria 9664
279 Ga0307411_10004285 3300032005 Bacteria 6807
280 Ga0307411_10020158 3300032005 Bacteria 3870
281 Ga0307411_10021166 3300032005 Bacteria 3799
282 Ga0307411_10045362 3300032005 Bacteria 2827
283 Ga0307411_10175485 3300032005 Bacteria 1621
284 Ga0307411_10266605 3300032005 Bacteria 1355
285 Ga0307415_100001640 3300032126 Bacteria 10835
286 Ga0307415_100067888 3300032126 Bacteria 2493
287 Ga0307415_100157647 3300032126 Bacteria 1755
288 Ga0373935_0006082 3300035692 Bacteria 7177
289 Ga0395899_0000129 3300037312 Bacteria 118043
290 Ga0395899_0000270 3300037312 Bacteria 68004
291 Ga0395899_0000998 3300037312 Bacteria 25996
292 Ga0395899_0003175 3300037312 Bacteria 13042
293 Ga0395900_0000290 3300037418 Bacteria 75444
294 Ga0395900_0001554 3300037418 Bacteria 27256
295 Ga0395900_0001837 3300037418 Bacteria 24190
296 Ga0395900_0005822 3300037418 Bacteria 12876
297 Ga0395900_0090707 3300037418 Bacteria 3141
298 Ga0395900_0093159 3300037418 Bacteria 3095
299 Ga0395900_0117866 3300037418 Bacteria 2724
300 Ga0395900_0120443 3300037418 Bacteria 2693
301 Ga0395900_0179896 3300037418 Bacteria 2149
302 Ga0395900_0333726 3300037418 Bacteria 1493
303 Ga0395898_0000054 3300037466 Bacteria 279561
304 Ga0395898_0002537 3300037466 Bacteria 21412
305 Ga0395898_0006151 3300037466 Bacteria 12854
306 Ga0395898_0009619 3300037466 Bacteria 10149
307 Ga0395898_0132088 3300037466 Bacteria 2391
308 Ga0395898_0136525 3300037466 Bacteria 2348
309 Ga0395898_0361301 3300037466 Bacteria 1384
310 Ga0395905_0000046 3300037471 Bacteria 240463
311 Ga0395905_0001881 3300037471 Bacteria 24188
312 Ga0395905_0004198 3300037471 Bacteria 15079
313 Ga0395905_0015376 3300037471 Bacteria 7273
314 Ga0395905_0022255 3300037471 Bacteria 5998
315 Ga0395905_0068148 3300037471 Bacteria 3333
316 Ga0395905_0117175 3300037471 Bacteria 2503
317 Ga0395905_0257447 3300037471 Bacteria 1630
318 Ga0395905_0378476 3300037471 Bacteria 1309
319 Ga0395901_0000102 3300038443 Bacteria 115611
320 Ga0395901_0001239 3300038443 Bacteria 27244
321 Ga0395901_0015174 3300038443 Bacteria 7835
322 Ga0395901_0020521 3300038443 Bacteria 6763
323 Ga0395901_0043829 3300038443 Bacteria 4640
324 Ga0395901_0063564 3300038443 Bacteria 3841
325 Ga0395901_0105552 3300038443 Bacteria 2957
326 Ga0395901_0279257 3300038443 Bacteria 1735
327 Ga0436365_0512070 3300039437 Bacteria 14106
328 Ga0439432_022254 3300042006 Bacteria 2094
329 Ga0439432_033582 3300042006 Bacteria 1650
330 Ga0439458_0000063 3300042157 Bacteria 18856
331 Ga0466972_0035316 3300044658 Bacteria 2447
332 Ga0466966_0073090 3300044684 Bacteria 2145
333 Ga0466961_0048452 3300044693 Bacteria 2715
334 Ga0466964_0004751 3300044706 Bacteria 5021
335 Ga0466971_0009417 3300044719 Bacteria 4264
336 Ga0466970_0008862 3300044765 Bacteria 5072
337 Ga0466970_0016451 3300044765 Bacteria 3814
338 Ga0466970_0030593 3300044765 Bacteria 2839
339 Ga0466960_0026552 3300044901 Bacteria 2632
340 Ga0466959_0017235 3300045049 Bacteria 5291
341 Ga0466958_0041320 3300045836 Bacteria 2773
342 Ga0466958_0071884 3300045836 Bacteria 2118
343 Ga0466967_0019385 3300045976 Bacteria 5469
344 Ga0466967_0356707 3300045976 Bacteria 1416
345 Ga0495585_0007794 3300046492 Bacteria 6524
346 Ga0495663_0014444 3300046525 Bacteria 2213
347 Ga0495598_0004155 3300046537 Bacteria 3118
348 Ga0495621_0000406 3300046539 Bacteria 10609
349 Ga0495621_0000714 3300046539 Bacteria 8411
350 Ga0495669_0007152 3300046684 Bacteria 4676
351 Ga0495669_0012812 3300046684 Bacteria 3570
352 Ga0495670_0000148 3300046691 Bacteria 30968
353 Ga0496100_0001507 3300048903 Bacteria 11417
354 Ga0496100_0025602 3300048903 Bacteria 3610
355 Ga0496101_0000216 3300048904 Bacteria 43445
356 Ga0496101_0015800 3300048904 Bacteria 5094
357 Ga0496101_0084017 3300048904 Bacteria 2357
358 Ga0496105_0097673 3300048908 Bacteria 2426
359 Ga0496106_0004559 3300048909 Bacteria 10269
360 Ga0496106_0036058 3300048909 Bacteria 3700
361 Ga0496107_0019478 3300048910 Bacteria 4787
362 Ga0496107_0071190 3300048910 Bacteria 2526
363 Ga0496108_0009355 3300048911 Bacteria 7933
364 Ga0496108_0019714 3300048911 Bacteria 5539
365 Ga0496109_0012766 3300048912 Bacteria 7261
366 Ga0496109_0236066 3300048912 Bacteria 1720
367 Ga0496110_0000132 3300048913 Bacteria 42838
368 Ga0496110_0001649 3300048913 Bacteria 16372
369 Ga0496110_0005691 3300048913 Bacteria 9788
370 Ga0496110_0162918 3300048913 Bacteria 2022
371 Ga0496111_0001206 3300048914 Bacteria 14423
372 Ga0496111_0016761 3300048914 Bacteria 5054
373 Ga0496111_0147060 3300048914 Bacteria 1747
374 Ga0496112_0002404 3300048915 Bacteria 15066
375 Ga0496112_0013532 3300048915 Bacteria 7536
376 Ga0496112_0022871 3300048915 Bacteria 5963
377 Ga0496112_0037724 3300048915 Bacteria 4717
378 Ga0496113_0000182 3300048916 Bacteria 28189
379 Ga0496113_0012319 3300048916 Bacteria 5744
380 Ga0496113_0026731 3300048916 Bacteria 4130
381 Ga0496114_0007521 3300048917 Bacteria 8614
382 Ga0496115_0000618 3300048918 Bacteria 26985
383 Ga0501069_0029794 3300049585 Bacteria 2996
384 Ga0501221_008887 3300049704 Bacteria 1755
385 Ga0466962_0047136 3300061719 Bacteria 2059

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0093159 Ga0395900_0093159_1785_2945 372
2 3300037471 Ga0395905_0257447 Ga0395905_0257447_64_1245 372
3 3300049704 Ga0501221_008887 Ga0501221_008887_363_1499 376
4 3300048913 Ga0496110_0001649 Ga0496110_0001649_1008_2150 380
5 3300048915 Ga0496112_0013532 Ga0496112_0013532_3734_4876 380
6 3300005328 Ga0070676_10013671 Ga0070676_100136712 382
7 3300005331 Ga0070670_100007638 Ga0070670_1000076387 382
8 3300005344 Ga0070661_100002568 Ga0070661_1000025685 382
9 3300005354 Ga0070675_100009729 Ga0070675_1000097297 382
10 3300005354 Ga0070675_100042132 Ga0070675_1000421325 382
11 3300005457 Ga0070662_100010228 Ga0070662_1000102288 382
12 3300005457 Ga0070662_100033756 Ga0070662_1000337563 382
13 3300005543 Ga0070672_100025345 Ga0070672_1000253453 382
14 3300005548 Ga0070665_100019688 Ga0070665_1000196887 382
15 3300005548 Ga0070665_100055579 Ga0070665_1000555793 382
16 3300005985 Ga0081539_10010862 Ga0081539_100108626 382
17 3300009177 Ga0105248_10039607 Ga0105248_100396073 382
18 3300025925 Ga0207650_10005726 Ga0207650_100057266 382
19 3300025926 Ga0207659_10005591 Ga0207659_100055914 382
20 3300025931 Ga0207644_10000589 Ga0207644_100005895 382
21 3300025933 Ga0207706_10007332 Ga0207706_100073327 382
22 3300025933 Ga0207706_10026534 Ga0207706_100265346 382
23 3300025940 Ga0207691_10009429 Ga0207691_100094293 382
24 3300025941 Ga0207711_10023507 Ga0207711_100235075 382
25 3300025945 Ga0207679_10009541 Ga0207679_100095414 382
26 3300025945 Ga0207679_10090781 Ga0207679_100907813 382
27 3300025960 Ga0207651_10071060 Ga0207651_100710603 382
28 3300025986 Ga0207658_10027812 Ga0207658_100278123 382
29 3300028379 Ga0268266_10068640 Ga0268266_100686403 382
30 3300031548 Ga0307408_100060086 Ga0307408_1000600863 382
31 3300031548 Ga0307408_100128112 Ga0307408_1001281122 382
32 3300031548 Ga0307408_100160345 Ga0307408_1001603452 382
33 3300031548 Ga0307408_100283248 Ga0307408_1002832481 382
34 3300031731 Ga0307405_10002616 Ga0307405_100026163 382
35 3300031824 Ga0307413_10109630 Ga0307413_101096302 382
36 3300031852 Ga0307410_10000194 Ga0307410_1000019411 382
37 3300031852 Ga0307410_10002535 Ga0307410_100025354 382
38 3300031852 Ga0307410_10031158 Ga0307410_100311582 382
39 3300031852 Ga0307410_10035370 Ga0307410_100353703 382
40 3300031903 Ga0307407_10000985 Ga0307407_100009854 382
41 3300031903 Ga0307407_10007349 Ga0307407_100073494 382
42 3300031903 Ga0307407_10032549 Ga0307407_100325494 382
43 3300031903 Ga0307407_10060946 Ga0307407_100609463 382
44 3300031911 Ga0307412_10067723 Ga0307412_100677233 382
45 3300031911 Ga0307412_10085099 Ga0307412_100850992 382
46 3300031995 Ga0307409_100000069 Ga0307409_10000006915 382
47 3300031995 Ga0307409_100001351 Ga0307409_1000013512 382
48 3300031995 Ga0307409_100001668 Ga0307409_1000016689 382
49 3300031995 Ga0307409_100005710 Ga0307409_1000057102 382
50 3300031995 Ga0307409_100073170 Ga0307409_1000731702 382
51 3300032002 Ga0307416_100005350 Ga0307416_1000053504 382
52 3300032002 Ga0307416_100048775 Ga0307416_1000487753 382
53 3300032002 Ga0307416_100228063 Ga0307416_1002280632 382
54 3300032004 Ga0307414_10000651 Ga0307414_1000065114 382
55 3300032004 Ga0307414_10000834 Ga0307414_100008343 382
56 3300032005 Ga0307411_10000647 Ga0307411_100006477 382
57 3300032005 Ga0307411_10001475 Ga0307411_1000147512 382
58 3300032005 Ga0307411_10004285 Ga0307411_100042852 382
59 3300032005 Ga0307411_10020158 Ga0307411_100201583 382
60 3300032005 Ga0307411_10175485 Ga0307411_101754852 382
61 3300032005 Ga0307411_10266605 Ga0307411_102666052 382
62 3300032126 Ga0307415_100001640 Ga0307415_1000016404 382
63 3300032126 Ga0307415_100157647 Ga0307415_1001576472 382
64 3300042006 Ga0439432_033582 Ga0439432_033582_418_1566 382
65 3300044901 Ga0466960_0026552 Ga0466960_0026552_1230_2381 382
66 3300046492 Ga0495585_0007794 Ga0495585_0007794_3693_4841 382
67 3300046525 Ga0495663_0014444 Ga0495663_0014444_247_1395 382
68 3300046539 Ga0495621_0000714 Ga0495621_0000714_6132_7280 382
69 3300046684 Ga0495669_0007152 Ga0495669_0007152_1191_2339 382
70 3300048913 Ga0496110_0005691 Ga0496110_0005691_5770_6918 382
71 3300005336 Ga0070680_100029717 Ga0070680_1000297176 384
72 3300005339 Ga0070660_100058791 Ga0070660_1000587914 384
73 3300005344 Ga0070661_100094630 Ga0070661_1000946301 384
74 3300005366 Ga0070659_100019287 Ga0070659_1000192873 384
75 3300005455 Ga0070663_100053566 Ga0070663_1000535661 384
76 3300005457 Ga0070662_100000405 Ga0070662_1000004056 384
77 3300005530 Ga0070679_100234357 Ga0070679_1002343572 384
78 3300005539 Ga0068853_100025243 Ga0068853_1000252432 384
79 3300005564 Ga0070664_100003746 Ga0070664_1000037463 384
80 3300013100 Ga0157373_10006579 Ga0157373_100065797 384
81 3300013102 Ga0157371_10090871 Ga0157371_100908712 384
82 3300025917 Ga0207660_10148724 Ga0207660_101487241 384
83 3300025919 Ga0207657_10047041 Ga0207657_100470414 384
84 3300025921 Ga0207652_10032002 Ga0207652_100320022 384
85 3300025933 Ga0207706_10002252 Ga0207706_1000225218 384
86 3300025945 Ga0207679_10004315 Ga0207679_100043155 384
87 3300031903 Ga0307407_10006674 Ga0307407_100066746 384
88 3300031911 Ga0307412_10018394 Ga0307412_100183942 384
89 3300032004 Ga0307414_10004390 Ga0307414_100043907 384
90 3300032005 Ga0307411_10045362 Ga0307411_100453622 384
91 3300037471 Ga0395905_0068148 Ga0395905_0068148_2165_3319 384
92 3300038443 Ga0395901_0105552 Ga0395901_0105552_718_1872 384
93 3300044693 Ga0466961_0048452 Ga0466961_0048452_695_1849 384
94 3300044719 Ga0466971_0009417 Ga0466971_0009417_2123_3277 384
95 3300044765 Ga0466970_0016451 Ga0466970_0016451_2547_3701 384
96 3300045836 Ga0466958_0071884 Ga0466958_0071884_53_1207 384
97 3300048915 Ga0496112_0022871 Ga0496112_0022871_584_1738 384
98 3300048916 Ga0496113_0026731 Ga0496113_0026731_1286_2440 384
99 3300061719 Ga0466962_0047136 Ga0466962_0047136_694_1848 384
100 3300001979 JGI24740J21852_10003633 JGI24740J21852_100036336 385
101 3300005327 Ga0070658_10001056 Ga0070658_1000105613 385
102 3300005327 Ga0070658_10001507 Ga0070658_1000150715 385
103 3300005327 Ga0070658_10012118 Ga0070658_100121184 385
104 3300005327 Ga0070658_10018432 Ga0070658_100184322 385
105 3300005328 Ga0070676_10043143 Ga0070676_100431432 385
106 3300005329 Ga0070683_100001823 Ga0070683_1000018235 385
107 3300005330 Ga0070690_100006550 Ga0070690_1000065507 385
108 3300005331 Ga0070670_100006227 Ga0070670_1000062277 385
109 3300005331 Ga0070670_100010140 Ga0070670_1000101409 385
110 3300005331 Ga0070670_100028155 Ga0070670_1000281551 385
111 3300005335 Ga0070666_10000310 Ga0070666_100003105 385
112 3300005335 Ga0070666_10003456 Ga0070666_100034563 385
113 3300005335 Ga0070666_10023954 Ga0070666_100239542 385
114 3300005335 Ga0070666_10073651 Ga0070666_100736512 385
115 3300005338 Ga0068868_100005004 Ga0068868_1000050049 385
116 3300005339 Ga0070660_100000393 Ga0070660_10000039311 385
117 3300005339 Ga0070660_100005078 Ga0070660_1000050784 385
118 3300005339 Ga0070660_100005430 Ga0070660_1000054305 385
119 3300005339 Ga0070660_100023577 Ga0070660_1000235773 385
120 3300005339 Ga0070660_100180002 Ga0070660_1001800022 385
121 3300005343 Ga0070687_100015493 Ga0070687_1000154932 385
122 3300005344 Ga0070661_100059039 Ga0070661_1000590393 385
123 3300005344 Ga0070661_100101244 Ga0070661_1001012442 385
124 3300005345 Ga0070692_10000436 Ga0070692_100004363 385
125 3300005345 Ga0070692_10000491 Ga0070692_100004913 385
126 3300005354 Ga0070675_100118168 Ga0070675_1001181682 385
127 3300005355 Ga0070671_100007768 Ga0070671_1000077684 385
128 3300005355 Ga0070671_100013990 Ga0070671_1000139903 385
129 3300005355 Ga0070671_100030093 Ga0070671_1000300932 385
130 3300005355 Ga0070671_100123294 Ga0070671_1001232942 385
131 3300005356 Ga0070674_100010882 Ga0070674_1000108825 385
132 3300005356 Ga0070674_100048059 Ga0070674_1000480592 385
133 3300005364 Ga0070673_100084169 Ga0070673_1000841692 385
134 3300005366 Ga0070659_100008864 Ga0070659_1000088647 385
135 3300005367 Ga0070667_100029775 Ga0070667_1000297756 385
136 3300005367 Ga0070667_100048054 Ga0070667_1000480541 385
137 3300005435 Ga0070714_100170033 Ga0070714_1001700332 385
138 3300005436 Ga0070713_100007649 Ga0070713_1000076497 385
139 3300005436 Ga0070713_100019382 Ga0070713_1000193823 385
140 3300005455 Ga0070663_100000271 Ga0070663_10000027115 385
141 3300005455 Ga0070663_100034333 Ga0070663_1000343331 385
142 3300005456 Ga0070678_100000769 Ga0070678_10000076911 385
143 3300005456 Ga0070678_100001896 Ga0070678_1000018968 385
144 3300005456 Ga0070678_100045545 Ga0070678_1000455453 385
145 3300005456 Ga0070678_100120372 Ga0070678_1001203722 385
146 3300005457 Ga0070662_100001018 Ga0070662_1000010187 385
147 3300005457 Ga0070662_100091059 Ga0070662_1000910592 385
148 3300005458 Ga0070681_10015737 Ga0070681_1001573710 385
149 3300005458 Ga0070681_10234766 Ga0070681_102347662 385
150 3300005459 Ga0068867_100037833 Ga0068867_1000378332 385
151 3300005459 Ga0068867_100313174 Ga0068867_1003131741 385
152 3300005530 Ga0070679_100000346 Ga0070679_10000034622 385
153 3300005530 Ga0070679_100093016 Ga0070679_1000930162 385
154 3300005530 Ga0070679_100137231 Ga0070679_1001372313 385
155 3300005539 Ga0068853_100409040 Ga0068853_1004090401 385
156 3300005543 Ga0070672_100014410 Ga0070672_1000144104 385
157 3300005548 Ga0070665_100026549 Ga0070665_1000265495 385
158 3300005563 Ga0068855_100001751 Ga0068855_10000175111 385
159 3300005563 Ga0068855_100016546 Ga0068855_1000165467 385
160 3300005563 Ga0068855_100037414 Ga0068855_1000374146 385
161 3300005564 Ga0070664_100006281 Ga0070664_1000062817 385
162 3300005564 Ga0070664_100016156 Ga0070664_1000161563 385
163 3300005564 Ga0070664_100019989 Ga0070664_1000199892 385
164 3300005564 Ga0070664_100145073 Ga0070664_1001450732 385
165 3300005578 Ga0068854_100014136 Ga0068854_1000141363 385
166 3300005578 Ga0068854_100214048 Ga0068854_1002140482 385
167 3300005614 Ga0068856_100026281 Ga0068856_1000262813 385
168 3300005614 Ga0068856_100081166 Ga0068856_1000811662 385
169 3300005616 Ga0068852_100049356 Ga0068852_1000493562 385
170 3300005616 Ga0068852_100067067 Ga0068852_1000670672 385
171 3300005617 Ga0068859_100014107 Ga0068859_10001410710 385
172 3300005617 Ga0068859_100020826 Ga0068859_1000208265 385
173 3300005718 Ga0068866_10017595 Ga0068866_100175952 385
174 3300005834 Ga0068851_10006181 Ga0068851_100061814 385
175 3300005834 Ga0068851_10030777 Ga0068851_100307772 385
176 3300005841 Ga0068863_100000607 Ga0068863_10000060720 385
177 3300005841 Ga0068863_100079457 Ga0068863_1000794574 385
178 3300005842 Ga0068858_100006875 Ga0068858_1000068753 385
179 3300005842 Ga0068858_100012047 Ga0068858_1000120477 385
180 3300005843 Ga0068860_100061450 Ga0068860_1000614502 385
181 3300005843 Ga0068860_100068957 Ga0068860_1000689572 385
182 3300006028 Ga0070717_10045903 Ga0070717_100459032 385
183 3300006237 Ga0097621_100043380 Ga0097621_1000433802 385
184 3300006237 Ga0097621_100238236 Ga0097621_1002382362 385
185 3300006358 Ga0068871_100041836 Ga0068871_1000418365 385
186 3300006358 Ga0068871_100068259 Ga0068871_1000682593 385
187 3300006931 Ga0097620_100014105 Ga0097620_1000141052 385
188 3300006931 Ga0097620_100020826 Ga0097620_1000208265 385
189 3300009098 Ga0105245_10210458 Ga0105245_102104582 385
190 3300009177 Ga0105248_10003900 Ga0105248_1000390012 385
191 3300009177 Ga0105248_10015809 Ga0105248_100158098 385
192 3300009177 Ga0105248_10027034 Ga0105248_100270343 385
193 3300009177 Ga0105248_10242175 Ga0105248_102421752 385
194 3300013100 Ga0157373_10017946 Ga0157373_100179465 385
195 3300013100 Ga0157373_10138617 Ga0157373_101386172 385
196 3300013100 Ga0157373_10177656 Ga0157373_101776562 385
197 3300013102 Ga0157371_10001298 Ga0157371_1000129817 385
198 3300013104 Ga0157370_10002353 Ga0157370_1000235316 385
199 3300013104 Ga0157370_10015094 Ga0157370_100150946 385
200 3300013104 Ga0157370_10041857 Ga0157370_100418575 385
201 3300013105 Ga0157369_10009477 Ga0157369_1000947712 385
202 3300013105 Ga0157369_10027719 Ga0157369_100277197 385
203 3300013105 Ga0157369_10035691 Ga0157369_100356917 385
204 3300013105 Ga0157369_10102686 Ga0157369_101026862 385
205 3300013105 Ga0157369_10152689 Ga0157369_101526892 385
206 3300013296 Ga0157374_10015546 Ga0157374_100155463 385
207 3300013296 Ga0157374_10113441 Ga0157374_101134412 385
208 3300013306 Ga0163162_10004976 Ga0163162_100049763 385
209 3300013308 Ga0157375_10005040 Ga0157375_1000504014 385
210 3300013308 Ga0157375_10283062 Ga0157375_102830622 385
211 3300014325 Ga0163163_10032161 Ga0163163_100321615 385
212 3300014969 Ga0157376_10055389 Ga0157376_100553893 385
213 3300025315 Ga0207697_10049952 Ga0207697_100499522 385
214 3300025315 Ga0207697_10083678 Ga0207697_100836781 385
215 3300025903 Ga0207680_10040097 Ga0207680_100400973 385
216 3300025903 Ga0207680_10061812 Ga0207680_100618122 385
217 3300025904 Ga0207647_10001664 Ga0207647_100016642 385
218 3300025904 Ga0207647_10001685 Ga0207647_1000168513 385
219 3300025904 Ga0207647_10070847 Ga0207647_100708472 385
220 3300025907 Ga0207645_10047928 Ga0207645_100479282 385
221 3300025909 Ga0207705_10000270 Ga0207705_1000027032 385
222 3300025909 Ga0207705_10000654 Ga0207705_1000065411 385
223 3300025909 Ga0207705_10006228 Ga0207705_100062287 385
224 3300025909 Ga0207705_10012028 Ga0207705_100120285 385
225 3300025909 Ga0207705_10012436 Ga0207705_100124363 385
226 3300025909 Ga0207705_10034066 Ga0207705_100340662 385
227 3300025909 Ga0207705_10075764 Ga0207705_100757642 385
228 3300025912 Ga0207707_10015148 Ga0207707_100151489 385
229 3300025912 Ga0207707_10173707 Ga0207707_101737072 385
230 3300025912 Ga0207707_10348055 Ga0207707_103480552 385
231 3300025918 Ga0207662_10016076 Ga0207662_100160764 385
232 3300025919 Ga0207657_10000165 Ga0207657_1000016554 385
233 3300025919 Ga0207657_10001054 Ga0207657_1000105410 385
234 3300025919 Ga0207657_10001091 Ga0207657_1000109120 385
235 3300025919 Ga0207657_10003456 Ga0207657_1000345617 385
236 3300025919 Ga0207657_10006190 Ga0207657_100061905 385
237 3300025919 Ga0207657_10071821 Ga0207657_100718212 385
238 3300025919 Ga0207657_10072416 Ga0207657_100724163 385
239 3300025920 Ga0207649_10011789 Ga0207649_100117892 385
240 3300025920 Ga0207649_10040305 Ga0207649_100403052 385
241 3300025920 Ga0207649_10061925 Ga0207649_100619253 385
242 3300025921 Ga0207652_10000058 Ga0207652_1000005886 385
243 3300025921 Ga0207652_10113631 Ga0207652_101136312 385
244 3300025921 Ga0207652_10295371 Ga0207652_102953712 385
245 3300025925 Ga0207650_10161449 Ga0207650_101614492 385
246 3300025926 Ga0207659_10007014 Ga0207659_100070142 385
247 3300025929 Ga0207664_10241180 Ga0207664_102411802 385
248 3300025931 Ga0207644_10000240 Ga0207644_1000024027 385
249 3300025931 Ga0207644_10003730 Ga0207644_100037304 385
250 3300025931 Ga0207644_10009753 Ga0207644_100097537 385
251 3300025931 Ga0207644_10044101 Ga0207644_100441013 385
252 3300025931 Ga0207644_10060796 Ga0207644_100607962 385
253 3300025932 Ga0207690_10046787 Ga0207690_100467873 385
254 3300025932 Ga0207690_10073301 Ga0207690_100733012 385
255 3300025933 Ga0207706_10004209 Ga0207706_1000420911 385
256 3300025933 Ga0207706_10004293 Ga0207706_1000429317 385
257 3300025933 Ga0207706_10005424 Ga0207706_100054248 385
258 3300025933 Ga0207706_10042629 Ga0207706_100426292 385
259 3300025933 Ga0207706_10134451 Ga0207706_101344512 385
260 3300025937 Ga0207669_10001902 Ga0207669_100019022 385
261 3300025937 Ga0207669_10004611 Ga0207669_100046113 385
262 3300025939 Ga0207665_10009130 Ga0207665_100091303 385
263 3300025940 Ga0207691_10001687 Ga0207691_100016874 385
264 3300025940 Ga0207691_10073402 Ga0207691_100734022 385
265 3300025941 Ga0207711_10010427 Ga0207711_100104279 385
266 3300025941 Ga0207711_10013228 Ga0207711_100132286 385
267 3300025941 Ga0207711_10053258 Ga0207711_100532583 385
268 3300025941 Ga0207711_10070296 Ga0207711_100702964 385
269 3300025944 Ga0207661_10002950 Ga0207661_100029502 385
270 3300025945 Ga0207679_10021482 Ga0207679_100214822 385
271 3300025945 Ga0207679_10099494 Ga0207679_100994942 385
272 3300025949 Ga0207667_10000579 Ga0207667_1000057931 385
273 3300025949 Ga0207667_10068820 Ga0207667_100688202 385
274 3300025949 Ga0207667_10078977 Ga0207667_100789772 385
275 3300025949 Ga0207667_10160566 Ga0207667_101605662 385
276 3300025960 Ga0207651_10002688 Ga0207651_100026882 385
277 3300025960 Ga0207651_10066381 Ga0207651_100663812 385
278 3300025981 Ga0207640_10049474 Ga0207640_100494742 385
279 3300025986 Ga0207658_10011093 Ga0207658_100110932 385
280 3300026023 Ga0207677_10002030 Ga0207677_100020304 385
281 3300026035 Ga0207703_10008065 Ga0207703_100080655 385
282 3300026041 Ga0207639_10275763 Ga0207639_102757632 385
283 3300026067 Ga0207678_10000217 Ga0207678_1000021724 385
284 3300026067 Ga0207678_10009864 Ga0207678_100098641 385
285 3300026067 Ga0207678_10021483 Ga0207678_100214836 385
286 3300026067 Ga0207678_10050930 Ga0207678_100509305 385
287 3300026067 Ga0207678_10062289 Ga0207678_100622892 385
288 3300026078 Ga0207702_10015421 Ga0207702_100154216 385
289 3300026078 Ga0207702_10019789 Ga0207702_100197896 385
290 3300026078 Ga0207702_10069492 Ga0207702_100694922 385
291 3300026088 Ga0207641_10029763 Ga0207641_100297632 385
292 3300026088 Ga0207641_10174343 Ga0207641_101743432 385
293 3300026089 Ga0207648_10005651 Ga0207648_100056513 385
294 3300026089 Ga0207648_10183990 Ga0207648_101839903 385
295 3300026095 Ga0207676_10024214 Ga0207676_100242145 385
296 3300026121 Ga0207683_10000541 Ga0207683_100005413 385
297 3300026121 Ga0207683_10002053 Ga0207683_1000205314 385
298 3300026121 Ga0207683_10005631 Ga0207683_100056317 385
299 3300026121 Ga0207683_10124525 Ga0207683_101245252 385
300 3300026142 Ga0207698_10000508 Ga0207698_100005085 385
301 3300026142 Ga0207698_10009360 Ga0207698_100093607 385
302 3300026142 Ga0207698_10056668 Ga0207698_100566682 385
303 3300031824 Ga0307413_10043115 Ga0307413_100431152 385
304 3300031911 Ga0307412_10044177 Ga0307412_100441772 385
305 3300031995 Ga0307409_100062648 Ga0307409_1000626482 385
306 3300032002 Ga0307416_100257335 Ga0307416_1002573352 385
307 3300032005 Ga0307411_10021166 Ga0307411_100211662 385
308 3300032126 Ga0307415_100067888 Ga0307415_1000678882 385
309 3300035692 Ga0373935_0006082 Ga0373935_0006082_2148_3308 385
310 3300037312 Ga0395899_0000129 Ga0395899_0000129_66778_67938 385
311 3300037312 Ga0395899_0000270 Ga0395899_0000270_48117_49274 385
312 3300037312 Ga0395899_0000998 Ga0395899_0000998_9754_10911 385
313 3300037312 Ga0395899_0003175 Ga0395899_0003175_2387_3544 385
314 3300037418 Ga0395900_0000290 Ga0395900_0000290_43503_44660 385
315 3300037418 Ga0395900_0001554 Ga0395900_0001554_5759_6919 385
316 3300037418 Ga0395900_0001837 Ga0395900_0001837_42_1199 385
317 3300037418 Ga0395900_0005822 Ga0395900_0005822_693_1850 385
318 3300037418 Ga0395900_0090707 Ga0395900_0090707_1870_3027 385
319 3300037418 Ga0395900_0117866 Ga0395900_0117866_448_1605 385
320 3300037418 Ga0395900_0120443 Ga0395900_0120443_142_1299 385
321 3300037418 Ga0395900_0179896 Ga0395900_0179896_575_1732 385
322 3300037418 Ga0395900_0333726 Ga0395900_0333726_48_1205 385
323 3300037466 Ga0395898_0000054 Ga0395898_0000054_230156_231313 385
324 3300037466 Ga0395898_0002537 Ga0395898_0002537_10585_11742 385
325 3300037466 Ga0395898_0006151 Ga0395898_0006151_5770_6927 385
326 3300037466 Ga0395898_0009619 Ga0395898_0009619_1588_2748 385
327 3300037466 Ga0395898_0132088 Ga0395898_0132088_914_2071 385
328 3300037466 Ga0395898_0136525 Ga0395898_0136525_472_1629 385
329 3300037466 Ga0395898_0361301 Ga0395898_0361301_48_1205 385
330 3300037471 Ga0395905_0000046 Ga0395905_0000046_191162_192319 385
331 3300037471 Ga0395905_0001881 Ga0395905_0001881_12243_13400 385
332 3300037471 Ga0395905_0004198 Ga0395905_0004198_11014_12171 385
333 3300037471 Ga0395905_0015376 Ga0395905_0015376_693_1850 385
334 3300037471 Ga0395905_0022255 Ga0395905_0022255_4261_5418 385
335 3300037471 Ga0395905_0117175 Ga0395905_0117175_992_2152 385
336 3300037471 Ga0395905_0378476 Ga0395905_0378476_72_1229 385
337 3300038443 Ga0395901_0000102 Ga0395901_0000102_31798_32955 385
338 3300038443 Ga0395901_0001239 Ga0395901_0001239_7083_8243 385
339 3300038443 Ga0395901_0015174 Ga0395901_0015174_1607_2764 385
340 3300038443 Ga0395901_0020521 Ga0395901_0020521_3502_4659 385
341 3300038443 Ga0395901_0043829 Ga0395901_0043829_398_1555 385
342 3300038443 Ga0395901_0063564 Ga0395901_0063564_214_1371 385
343 3300038443 Ga0395901_0279257 Ga0395901_0279257_357_1517 385
344 3300039437 Ga0436365_0512070 Ga0436365_0512070_6039_7217 385
345 3300042006 Ga0439432_022254 Ga0439432_022254_114_1271 385
346 3300042157 Ga0439458_0000063 Ga0439458_0000063_12893_14050 385
347 3300044658 Ga0466972_0035316 Ga0466972_0035316_746_1903 385
348 3300044684 Ga0466966_0073090 Ga0466966_0073090_744_1901 385
349 3300044706 Ga0466964_0004751 Ga0466964_0004751_1689_2846 385
350 3300044765 Ga0466970_0008862 Ga0466970_0008862_2638_3795 385
351 3300044765 Ga0466970_0030593 Ga0466970_0030593_1472_2629 385
352 3300045049 Ga0466959_0017235 Ga0466959_0017235_2167_3324 385
353 3300045836 Ga0466958_0041320 Ga0466958_0041320_922_2079 385
354 3300045976 Ga0466967_0019385 Ga0466967_0019385_4045_5202 385
355 3300045976 Ga0466967_0356707 Ga0466967_0356707_217_1374 385
356 3300046537 Ga0495598_0004155 Ga0495598_0004155_635_1798 385
357 3300046539 Ga0495621_0000406 Ga0495621_0000406_6763_7926 385
358 3300046684 Ga0495669_0012812 Ga0495669_0012812_1953_3131 385
359 3300046691 Ga0495670_0000148 Ga0495670_0000148_23043_24206 385
360 3300048903 Ga0496100_0001507 Ga0496100_0001507_9233_10393 385
361 3300048903 Ga0496100_0025602 Ga0496100_0025602_861_2018 385
362 3300048904 Ga0496101_0000216 Ga0496101_0000216_30097_31257 385
363 3300048904 Ga0496101_0015800 Ga0496101_0015800_1616_2773 385
364 3300048904 Ga0496101_0084017 Ga0496101_0084017_484_1662 385
365 3300048908 Ga0496105_0097673 Ga0496105_0097673_749_1909 385
366 3300048909 Ga0496106_0004559 Ga0496106_0004559_2525_3685 385
367 3300048909 Ga0496106_0036058 Ga0496106_0036058_1391_2791 385
368 3300048910 Ga0496107_0019478 Ga0496107_0019478_1496_2656 385
369 3300048910 Ga0496107_0071190 Ga0496107_0071190_1050_2207 385
370 3300048911 Ga0496108_0009355 Ga0496108_0009355_2044_3204 385
371 3300048911 Ga0496108_0019714 Ga0496108_0019714_1340_2503 385
372 3300048912 Ga0496109_0012766 Ga0496109_0012766_1157_2317 385
373 3300048912 Ga0496109_0236066 Ga0496109_0236066_438_1595 385
374 3300048913 Ga0496110_0000132 Ga0496110_0000132_30973_32133 385
375 3300048913 Ga0496110_0162918 Ga0496110_0162918_101_1279 385
376 3300048914 Ga0496111_0001206 Ga0496111_0001206_6875_8035 385
377 3300048914 Ga0496111_0016761 Ga0496111_0016761_3515_4672 385
378 3300048914 Ga0496111_0147060 Ga0496111_0147060_357_1517 385
379 3300048915 Ga0496112_0002404 Ga0496112_0002404_1025_2185 385
380 3300048915 Ga0496112_0037724 Ga0496112_0037724_2124_3287 385
381 3300048916 Ga0496113_0000182 Ga0496113_0000182_7918_9078 385
382 3300048916 Ga0496113_0012319 Ga0496113_0012319_3323_4486 385
383 3300048917 Ga0496114_0007521 Ga0496114_0007521_4985_6142 385
384 3300048918 Ga0496115_0000618 Ga0496115_0000618_13266_14444 385
385 3300049585 Ga0501069_0029794 Ga0501069_0029794_600_1760 385

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.8007 16 383
7cet-assembly1.cif.gz_A crystal structure of d-cycloserine-bound form of cysteine desulfurase nifs from helicobacter pylori 0.7987 17 383
7ceu-assembly1.cif.gz_A crystal structure of l-cycloserine-bound form of cysteine desulfurase nifs from helicobacter pylori 0.7973 17 383
1elu-assembly1.cif.gz_B complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide. 0.7947 11 385
5wt5-assembly1.cif.gz_A l-homocysteine-bound nifs from helicobacter pylori 0.7927 17 383
ID Description Score Start End Superfamily
1qz9A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8797 290 383 3.90.1150.10
af_Q54Q04_346_448_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.853 285 381 3.90.1150.10
af_Q18026_376_468_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8209 302 381 3.90.1150.10
af_Q60358_310_394_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8143 297 385 3.90.1150.10
4isyD01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8143 295 382 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A6J4TR59-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9898 265 385 GO:0005737
GO:0006569
GO:0009435
GO:0030170
GO:0030429
AF-A0A3B0RAL8-F1-model_v4 Cysteine desulfurase 0.9828 292 385 GO:0005737
GO:0006569
GO:0009435
GO:0030170
GO:0030429
AF-A0A6J4TR59-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9818 265 385 GO:0005737
GO:0006569
GO:0009435
GO:0030170
GO:0030429
AF-A0A519KQ54-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9537 1 237 GO:0008483
AF-A0A519KQ54-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9498 1 237 GO:0008483

Feature Viewer

pLDDT pTM Quality
83.59 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map