F430240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 385 | 147 | 385 | 385 |
Family's Representative Sequence
| Representative Sequence | 3300031911|Ga0307412_10018394|Ga0307412_100183942 |
| Length | 387 |
| Sequence | LSFRPLFARSLAAAPGRLHMAAHSHQLWPDASFEGHQQAWLDAASLADRKWDKVMDEVWPEAQANVAFELGVPADRVVFSSNTHDFLIRLFAAAPRRAHGPLRILTSDGEFHSARRQFARWEEEGQALVTRVAAEPFDSFSDRFVEAAQTSEQDLILVSQVLFASGRIFAGIAELSALADPDGPWVVIDGYHAFMAVERPLPEEARDRAFYLGGGYKYAMAGEGMAFLHCPPGFGPRPPLTGWFAEFGDLTAPPGSSVGYTADAMRFMGATFDPSALYRFNAIQRMLREEGLMTAAIAVHVAGLQQRLLDGLSGSALGAAELLNPLGGGPHARFLAFRSPRAAAWNGWLMERGCVTDVRGDVLRIGLGLYHDEADVDAFIALARGLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 99 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 100 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 101 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 102 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 105 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 106 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 115 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 116 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 117 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 118 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 119 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 120 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 121 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 122 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 123 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 124 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 135 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 136 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 137 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 140 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 141 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 142 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 145 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 147 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.79 |
| Rhizosphere | 91.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003633 | 3300001979 | Bacteria | 6725 |
| 2 | Ga0070658_10001056 | 3300005327 | Bacteria | 23556 |
| 3 | Ga0070658_10001507 | 3300005327 | Bacteria | 19770 |
| 4 | Ga0070658_10012118 | 3300005327 | Bacteria | 6923 |
| 5 | Ga0070658_10018432 | 3300005327 | Bacteria | 5587 |
| 6 | Ga0070676_10013671 | 3300005328 | Bacteria | 4449 |
| 7 | Ga0070676_10043143 | 3300005328 | Bacteria | 2620 |
| 8 | Ga0070683_100001823 | 3300005329 | Bacteria | 16621 |
| 9 | Ga0070690_100006550 | 3300005330 | Bacteria | 6612 |
| 10 | Ga0070670_100006227 | 3300005331 | Bacteria | 10094 |
| 11 | Ga0070670_100007638 | 3300005331 | Bacteria | 9189 |
| 12 | Ga0070670_100010140 | 3300005331 | Bacteria | 8037 |
| 13 | Ga0070670_100028155 | 3300005331 | Bacteria | 4835 |
| 14 | Ga0070666_10000310 | 3300005335 | Bacteria | 31154 |
| 15 | Ga0070666_10003456 | 3300005335 | Bacteria | 9571 |
| 16 | Ga0070666_10023954 | 3300005335 | Bacteria | 3975 |
| 17 | Ga0070666_10073651 | 3300005335 | Bacteria | 2326 |
| 18 | Ga0070680_100029717 | 3300005336 | Bacteria | 4388 |
| 19 | Ga0068868_100005004 | 3300005338 | Bacteria | 9310 |
| 20 | Ga0070660_100000393 | 3300005339 | Bacteria | 29017 |
| 21 | Ga0070660_100005078 | 3300005339 | Bacteria | 9095 |
| 22 | Ga0070660_100005430 | 3300005339 | Bacteria | 8827 |
| 23 | Ga0070660_100023577 | 3300005339 | Bacteria | 4559 |
| 24 | Ga0070660_100058791 | 3300005339 | Bacteria | 2981 |
| 25 | Ga0070660_100180002 | 3300005339 | Bacteria | 1710 |
| 26 | Ga0070687_100015493 | 3300005343 | Bacteria | 3450 |
| 27 | Ga0070661_100002568 | 3300005344 | Bacteria | 12449 |
| 28 | Ga0070661_100059039 | 3300005344 | Bacteria | 2812 |
| 29 | Ga0070661_100094630 | 3300005344 | Bacteria | 2214 |
| 30 | Ga0070661_100101244 | 3300005344 | Bacteria | 2143 |
| 31 | Ga0070692_10000436 | 3300005345 | Bacteria | 12687 |
| 32 | Ga0070692_10000491 | 3300005345 | Bacteria | 12172 |
| 33 | Ga0070675_100009729 | 3300005354 | Bacteria | 7491 |
| 34 | Ga0070675_100042132 | 3300005354 | Bacteria | 3729 |
| 35 | Ga0070675_100118168 | 3300005354 | Bacteria | 2251 |
| 36 | Ga0070671_100007768 | 3300005355 | Bacteria | 8567 |
| 37 | Ga0070671_100013990 | 3300005355 | Bacteria | 6479 |
| 38 | Ga0070671_100030093 | 3300005355 | Bacteria | 4480 |
| 39 | Ga0070671_100123294 | 3300005355 | Bacteria | 2181 |
| 40 | Ga0070674_100010882 | 3300005356 | Bacteria | 5518 |
| 41 | Ga0070674_100048059 | 3300005356 | Bacteria | 2927 |
| 42 | Ga0070673_100084169 | 3300005364 | Bacteria | 2586 |
| 43 | Ga0070659_100008864 | 3300005366 | Bacteria | 7371 |
| 44 | Ga0070659_100019287 | 3300005366 | Bacteria | 5165 |
| 45 | Ga0070667_100029775 | 3300005367 | Bacteria | 4551 |
| 46 | Ga0070667_100048054 | 3300005367 | Bacteria | 3591 |
| 47 | Ga0070714_100170033 | 3300005435 | Bacteria | 1977 |
| 48 | Ga0070713_100007649 | 3300005436 | Bacteria | 7604 |
| 49 | Ga0070713_100019382 | 3300005436 | Bacteria | 5192 |
| 50 | Ga0070663_100000271 | 3300005455 | Bacteria | 26098 |
| 51 | Ga0070663_100034333 | 3300005455 | Bacteria | 3513 |
| 52 | Ga0070663_100053566 | 3300005455 | Bacteria | 2881 |
| 53 | Ga0070678_100000769 | 3300005456 | Bacteria | 16071 |
| 54 | Ga0070678_100001896 | 3300005456 | Bacteria | 11265 |
| 55 | Ga0070678_100045545 | 3300005456 | Bacteria | 3139 |
| 56 | Ga0070678_100120372 | 3300005456 | Bacteria | 2069 |
| 57 | Ga0070662_100000405 | 3300005457 | Bacteria | 25630 |
| 58 | Ga0070662_100001018 | 3300005457 | Bacteria | 17157 |
| 59 | Ga0070662_100010228 | 3300005457 | Bacteria | 6151 |
| 60 | Ga0070662_100033756 | 3300005457 | Bacteria | 3605 |
| 61 | Ga0070662_100091059 | 3300005457 | Bacteria | 2290 |
| 62 | Ga0070681_10015737 | 3300005458 | Bacteria | 7540 |
| 63 | Ga0070681_10234766 | 3300005458 | Bacteria | 1748 |
| 64 | Ga0068867_100037833 | 3300005459 | Bacteria | 3509 |
| 65 | Ga0068867_100313174 | 3300005459 | Bacteria | 1298 |
| 66 | Ga0070679_100000346 | 3300005530 | Bacteria | 39334 |
| 67 | Ga0070679_100093016 | 3300005530 | Bacteria | 3003 |
| 68 | Ga0070679_100137231 | 3300005530 | Bacteria | 2427 |
| 69 | Ga0070679_100234357 | 3300005530 | Bacteria | 1795 |
| 70 | Ga0068853_100025243 | 3300005539 | Bacteria | 4987 |
| 71 | Ga0068853_100409040 | 3300005539 | Bacteria | 1271 |
| 72 | Ga0070672_100014410 | 3300005543 | Bacteria | 5603 |
| 73 | Ga0070672_100025345 | 3300005543 | Bacteria | 4397 |
| 74 | Ga0070665_100019688 | 3300005548 | Bacteria | 6775 |
| 75 | Ga0070665_100026549 | 3300005548 | Bacteria | 5831 |
| 76 | Ga0070665_100055579 | 3300005548 | Bacteria | 3970 |
| 77 | Ga0068855_100001751 | 3300005563 | Bacteria | 27092 |
| 78 | Ga0068855_100016546 | 3300005563 | Bacteria | 8871 |
| 79 | Ga0068855_100037414 | 3300005563 | Bacteria | 5771 |
| 80 | Ga0070664_100003746 | 3300005564 | Bacteria | 12266 |
| 81 | Ga0070664_100006281 | 3300005564 | Bacteria | 9589 |
| 82 | Ga0070664_100016156 | 3300005564 | Bacteria | 6117 |
| 83 | Ga0070664_100019989 | 3300005564 | Bacteria | 5512 |
| 84 | Ga0070664_100145073 | 3300005564 | Bacteria | 2093 |
| 85 | Ga0068854_100014136 | 3300005578 | Bacteria | 5256 |
| 86 | Ga0068854_100214048 | 3300005578 | Bacteria | 1521 |
| 87 | Ga0068856_100026281 | 3300005614 | Bacteria | 5676 |
| 88 | Ga0068856_100081166 | 3300005614 | Bacteria | 3217 |
| 89 | Ga0068852_100049356 | 3300005616 | Bacteria | 3600 |
| 90 | Ga0068852_100067067 | 3300005616 | Bacteria | 3136 |
| 91 | Ga0068859_100014107 | 3300005617 | Bacteria | 8014 |
| 92 | Ga0068859_100020826 | 3300005617 | Bacteria | 6582 |
| 93 | Ga0068866_10017595 | 3300005718 | Bacteria | 3217 |
| 94 | Ga0068851_10006181 | 3300005834 | Bacteria | 5466 |
| 95 | Ga0068851_10030777 | 3300005834 | Bacteria | 2663 |
| 96 | Ga0068863_100000607 | 3300005841 | Bacteria | 36378 |
| 97 | Ga0068863_100079457 | 3300005841 | Bacteria | 3106 |
| 98 | Ga0068858_100006875 | 3300005842 | Bacteria | 11055 |
| 99 | Ga0068858_100012047 | 3300005842 | Bacteria | 8151 |
| 100 | Ga0068860_100061450 | 3300005843 | Bacteria | 3570 |
| 101 | Ga0068860_100068957 | 3300005843 | Bacteria | 3361 |
| 102 | Ga0081539_10010862 | 3300005985 | Bacteria | 7314 |
| 103 | Ga0070717_10045903 | 3300006028 | Bacteria | 3573 |
| 104 | Ga0097621_100043380 | 3300006237 | Bacteria | 3625 |
| 105 | Ga0097621_100238236 | 3300006237 | Bacteria | 1590 |
| 106 | Ga0068871_100041836 | 3300006358 | Bacteria | 3676 |
| 107 | Ga0068871_100068259 | 3300006358 | Bacteria | 2919 |
| 108 | Ga0097620_100014105 | 3300006931 | Bacteria | 8014 |
| 109 | Ga0097620_100020826 | 3300006931 | Bacteria | 6582 |
| 110 | Ga0105245_10210458 | 3300009098 | Bacteria | 1871 |
| 111 | Ga0105248_10003900 | 3300009177 | Bacteria | 16492 |
| 112 | Ga0105248_10015809 | 3300009177 | Bacteria | 8318 |
| 113 | Ga0105248_10027034 | 3300009177 | Bacteria | 6383 |
| 114 | Ga0105248_10039607 | 3300009177 | Bacteria | 5280 |
| 115 | Ga0105248_10242175 | 3300009177 | Bacteria | 2030 |
| 116 | Ga0157373_10006579 | 3300013100 | Bacteria | 8667 |
| 117 | Ga0157373_10017946 | 3300013100 | Bacteria | 5152 |
| 118 | Ga0157373_10138617 | 3300013100 | Bacteria | 1710 |
| 119 | Ga0157373_10177656 | 3300013100 | Bacteria | 1499 |
| 120 | Ga0157371_10001298 | 3300013102 | Bacteria | 26285 |
| 121 | Ga0157371_10090871 | 3300013102 | Bacteria | 2163 |
| 122 | Ga0157370_10002353 | 3300013104 | Bacteria | 22828 |
| 123 | Ga0157370_10015094 | 3300013104 | Bacteria | 7870 |
| 124 | Ga0157370_10041857 | 3300013104 | Bacteria | 4417 |
| 125 | Ga0157369_10009477 | 3300013105 | Bacteria | 11133 |
| 126 | Ga0157369_10027719 | 3300013105 | Bacteria | 6276 |
| 127 | Ga0157369_10035691 | 3300013105 | Bacteria | 5450 |
| 128 | Ga0157369_10102686 | 3300013105 | Bacteria | 3046 |
| 129 | Ga0157369_10152689 | 3300013105 | Bacteria | 2441 |
| 130 | Ga0157374_10015546 | 3300013296 | Bacteria | 6677 |
| 131 | Ga0157374_10113441 | 3300013296 | Bacteria | 2609 |
| 132 | Ga0163162_10004976 | 3300013306 | Bacteria | 12799 |
| 133 | Ga0157375_10005040 | 3300013308 | Bacteria | 11472 |
| 134 | Ga0157375_10283062 | 3300013308 | Bacteria | 1821 |
| 135 | Ga0163163_10032161 | 3300014325 | Bacteria | 5067 |
| 136 | Ga0157376_10055389 | 3300014969 | Bacteria | 3308 |
| 137 | Ga0207697_10049952 | 3300025315 | Bacteria | 1726 |
| 138 | Ga0207697_10083678 | 3300025315 | Bacteria | 1346 |
| 139 | Ga0207680_10040097 | 3300025903 | Bacteria | 2722 |
| 140 | Ga0207680_10061812 | 3300025903 | Bacteria | 2285 |
| 141 | Ga0207647_10001664 | 3300025904 | Bacteria | 17118 |
| 142 | Ga0207647_10001685 | 3300025904 | Bacteria | 17028 |
| 143 | Ga0207647_10070847 | 3300025904 | Bacteria | 2105 |
| 144 | Ga0207645_10047928 | 3300025907 | Bacteria | 2728 |
| 145 | Ga0207705_10000270 | 3300025909 | Bacteria | 49639 |
| 146 | Ga0207705_10000654 | 3300025909 | Bacteria | 28865 |
| 147 | Ga0207705_10006228 | 3300025909 | Bacteria | 8862 |
| 148 | Ga0207705_10012028 | 3300025909 | Bacteria | 6253 |
| 149 | Ga0207705_10012436 | 3300025909 | Bacteria | 6148 |
| 150 | Ga0207705_10034066 | 3300025909 | Bacteria | 3640 |
| 151 | Ga0207705_10075764 | 3300025909 | Bacteria | 2444 |
| 152 | Ga0207707_10015148 | 3300025912 | Bacteria | 6712 |
| 153 | Ga0207707_10173707 | 3300025912 | Bacteria | 1883 |
| 154 | Ga0207707_10348055 | 3300025912 | Bacteria | 1277 |
| 155 | Ga0207660_10148724 | 3300025917 | Bacteria | 1798 |
| 156 | Ga0207662_10016076 | 3300025918 | Bacteria | 4217 |
| 157 | Ga0207657_10000165 | 3300025919 | Bacteria | 67173 |
| 158 | Ga0207657_10001054 | 3300025919 | Bacteria | 29233 |
| 159 | Ga0207657_10001091 | 3300025919 | Bacteria | 28769 |
| 160 | Ga0207657_10003456 | 3300025919 | Bacteria | 16857 |
| 161 | Ga0207657_10006190 | 3300025919 | Bacteria | 12435 |
| 162 | Ga0207657_10047041 | 3300025919 | Bacteria | 3776 |
| 163 | Ga0207657_10071821 | 3300025919 | Bacteria | 2929 |
| 164 | Ga0207657_10072416 | 3300025919 | Bacteria | 2915 |
| 165 | Ga0207649_10011789 | 3300025920 | Bacteria | 4833 |
| 166 | Ga0207649_10040305 | 3300025920 | Bacteria | 2838 |
| 167 | Ga0207649_10061925 | 3300025920 | Bacteria | 2357 |
| 168 | Ga0207652_10000058 | 3300025921 | Bacteria | 113620 |
| 169 | Ga0207652_10032002 | 3300025921 | Bacteria | 4418 |
| 170 | Ga0207652_10113631 | 3300025921 | Bacteria | 2404 |
| 171 | Ga0207652_10295371 | 3300025921 | Bacteria | 1462 |
| 172 | Ga0207650_10005726 | 3300025925 | Bacteria | 8477 |
| 173 | Ga0207650_10161449 | 3300025925 | Bacteria | 1776 |
| 174 | Ga0207659_10005591 | 3300025926 | Bacteria | 7632 |
| 175 | Ga0207659_10007014 | 3300025926 | Bacteria | 6919 |
| 176 | Ga0207664_10241180 | 3300025929 | Bacteria | 1574 |
| 177 | Ga0207644_10000240 | 3300025931 | Bacteria | 37642 |
| 178 | Ga0207644_10000589 | 3300025931 | Bacteria | 23204 |
| 179 | Ga0207644_10003730 | 3300025931 | Bacteria | 9879 |
| 180 | Ga0207644_10009753 | 3300025931 | Bacteria | 6313 |
| 181 | Ga0207644_10044101 | 3300025931 | Bacteria | 3167 |
| 182 | Ga0207644_10060796 | 3300025931 | Bacteria | 2734 |
| 183 | Ga0207690_10046787 | 3300025932 | Bacteria | 2867 |
| 184 | Ga0207690_10073301 | 3300025932 | Bacteria | 2367 |
| 185 | Ga0207706_10002252 | 3300025933 | Bacteria | 18838 |
| 186 | Ga0207706_10004209 | 3300025933 | Bacteria | 13551 |
| 187 | Ga0207706_10004293 | 3300025933 | Bacteria | 13391 |
| 188 | Ga0207706_10005424 | 3300025933 | Bacteria | 11885 |
| 189 | Ga0207706_10007332 | 3300025933 | Bacteria | 10200 |
| 190 | Ga0207706_10026534 | 3300025933 | Bacteria | 5185 |
| 191 | Ga0207706_10042629 | 3300025933 | Bacteria | 4022 |
| 192 | Ga0207706_10134451 | 3300025933 | Bacteria | 2175 |
| 193 | Ga0207669_10001902 | 3300025937 | Bacteria | 8856 |
| 194 | Ga0207669_10004611 | 3300025937 | Bacteria | 6084 |
| 195 | Ga0207665_10009130 | 3300025939 | Bacteria | 6508 |
| 196 | Ga0207691_10001687 | 3300025940 | Bacteria | 21797 |
| 197 | Ga0207691_10009429 | 3300025940 | Bacteria | 9375 |
| 198 | Ga0207691_10073402 | 3300025940 | Bacteria | 3086 |
| 199 | Ga0207711_10010427 | 3300025941 | Bacteria | 7715 |
| 200 | Ga0207711_10013228 | 3300025941 | Bacteria | 6857 |
| 201 | Ga0207711_10023507 | 3300025941 | Bacteria | 5159 |
| 202 | Ga0207711_10053258 | 3300025941 | Bacteria | 3470 |
| 203 | Ga0207711_10070296 | 3300025941 | Bacteria | 3035 |
| 204 | Ga0207661_10002950 | 3300025944 | Bacteria | 11762 |
| 205 | Ga0207679_10004315 | 3300025945 | Bacteria | 8844 |
| 206 | Ga0207679_10009541 | 3300025945 | Bacteria | 6221 |
| 207 | Ga0207679_10021482 | 3300025945 | Bacteria | 4377 |
| 208 | Ga0207679_10090781 | 3300025945 | Bacteria | 2362 |
| 209 | Ga0207679_10099494 | 3300025945 | Bacteria | 2271 |
| 210 | Ga0207667_10000579 | 3300025949 | Bacteria | 47716 |
| 211 | Ga0207667_10068820 | 3300025949 | Bacteria | 3685 |
| 212 | Ga0207667_10078977 | 3300025949 | Bacteria | 3410 |
| 213 | Ga0207667_10160566 | 3300025949 | Bacteria | 2312 |
| 214 | Ga0207651_10002688 | 3300025960 | Bacteria | 8513 |
| 215 | Ga0207651_10066381 | 3300025960 | Bacteria | 2534 |
| 216 | Ga0207651_10071060 | 3300025960 | Bacteria | 2465 |
| 217 | Ga0207640_10049474 | 3300025981 | Bacteria | 2722 |
| 218 | Ga0207658_10011093 | 3300025986 | Bacteria | 6137 |
| 219 | Ga0207658_10027812 | 3300025986 | Bacteria | 3977 |
| 220 | Ga0207677_10002030 | 3300026023 | Bacteria | 10679 |
| 221 | Ga0207703_10008065 | 3300026035 | Bacteria | 8323 |
| 222 | Ga0207639_10275763 | 3300026041 | Bacteria | 1477 |
| 223 | Ga0207678_10000217 | 3300026067 | Bacteria | 51179 |
| 224 | Ga0207678_10009864 | 3300026067 | Bacteria | 8388 |
| 225 | Ga0207678_10021483 | 3300026067 | Bacteria | 5660 |
| 226 | Ga0207678_10050930 | 3300026067 | Bacteria | 3576 |
| 227 | Ga0207678_10062289 | 3300026067 | Bacteria | 3207 |
| 228 | Ga0207702_10015421 | 3300026078 | Bacteria | 6329 |
| 229 | Ga0207702_10019789 | 3300026078 | Bacteria | 5573 |
| 230 | Ga0207702_10069492 | 3300026078 | Bacteria | 3028 |
| 231 | Ga0207641_10029763 | 3300026088 | Bacteria | 4516 |
| 232 | Ga0207641_10174343 | 3300026088 | Bacteria | 1965 |
| 233 | Ga0207648_10005651 | 3300026089 | Bacteria | 12555 |
| 234 | Ga0207648_10183990 | 3300026089 | Bacteria | 1850 |
| 235 | Ga0207676_10024214 | 3300026095 | Bacteria | 4489 |
| 236 | Ga0207683_10000541 | 3300026121 | Bacteria | 34994 |
| 237 | Ga0207683_10002053 | 3300026121 | Bacteria | 17819 |
| 238 | Ga0207683_10005631 | 3300026121 | Bacteria | 10745 |
| 239 | Ga0207683_10124525 | 3300026121 | Bacteria | 2316 |
| 240 | Ga0207698_10000508 | 3300026142 | Bacteria | 22632 |
| 241 | Ga0207698_10009360 | 3300026142 | Bacteria | 6244 |
| 242 | Ga0207698_10056668 | 3300026142 | Bacteria | 3027 |
| 243 | Ga0268266_10068640 | 3300028379 | Bacteria | 3070 |
| 244 | Ga0307408_100060086 | 3300031548 | Bacteria | 2770 |
| 245 | Ga0307408_100128112 | 3300031548 | Bacteria | 1977 |
| 246 | Ga0307408_100160345 | 3300031548 | Bacteria | 1786 |
| 247 | Ga0307408_100283248 | 3300031548 | Bacteria | 1381 |
| 248 | Ga0307405_10002616 | 3300031731 | Bacteria | 7999 |
| 249 | Ga0307413_10043115 | 3300031824 | Bacteria | 2656 |
| 250 | Ga0307413_10109630 | 3300031824 | Bacteria | 1845 |
| 251 | Ga0307410_10000194 | 3300031852 | Bacteria | 22605 |
| 252 | Ga0307410_10002535 | 3300031852 | Bacteria | 8837 |
| 253 | Ga0307410_10031158 | 3300031852 | Bacteria | 3418 |
| 254 | Ga0307410_10035370 | 3300031852 | Bacteria | 3243 |
| 255 | Ga0307407_10000985 | 3300031903 | Bacteria | 9755 |
| 256 | Ga0307407_10006674 | 3300031903 | Bacteria | 5158 |
| 257 | Ga0307407_10007349 | 3300031903 | Bacteria | 4984 |
| 258 | Ga0307407_10032549 | 3300031903 | Bacteria | 2836 |
| 259 | Ga0307407_10060946 | 3300031903 | Bacteria | 2203 |
| 260 | Ga0307412_10018394 | 3300031911 | Bacteria | 4204 |
| 261 | Ga0307412_10044177 | 3300031911 | Bacteria | 2906 |
| 262 | Ga0307412_10067723 | 3300031911 | Bacteria | 2425 |
| 263 | Ga0307412_10085099 | 3300031911 | Bacteria | 2197 |
| 264 | Ga0307409_100000069 | 3300031995 | Bacteria | 37984 |
| 265 | Ga0307409_100001351 | 3300031995 | Bacteria | 11931 |
| 266 | Ga0307409_100001668 | 3300031995 | Bacteria | 11161 |
| 267 | Ga0307409_100005710 | 3300031995 | Bacteria | 7212 |
| 268 | Ga0307409_100062648 | 3300031995 | Bacteria | 2912 |
| 269 | Ga0307409_100073170 | 3300031995 | Bacteria | 2732 |
| 270 | Ga0307416_100005350 | 3300032002 | Bacteria | 7875 |
| 271 | Ga0307416_100048775 | 3300032002 | Bacteria | 3362 |
| 272 | Ga0307416_100228063 | 3300032002 | Bacteria | 1793 |
| 273 | Ga0307416_100257335 | 3300032002 | Bacteria | 1703 |
| 274 | Ga0307414_10000651 | 3300032004 | Bacteria | 17739 |
| 275 | Ga0307414_10000834 | 3300032004 | Bacteria | 15720 |
| 276 | Ga0307414_10004390 | 3300032004 | Bacteria | 7657 |
| 277 | Ga0307411_10000647 | 3300032005 | Bacteria | 12652 |
| 278 | Ga0307411_10001475 | 3300032005 | Bacteria | 9664 |
| 279 | Ga0307411_10004285 | 3300032005 | Bacteria | 6807 |
| 280 | Ga0307411_10020158 | 3300032005 | Bacteria | 3870 |
| 281 | Ga0307411_10021166 | 3300032005 | Bacteria | 3799 |
| 282 | Ga0307411_10045362 | 3300032005 | Bacteria | 2827 |
| 283 | Ga0307411_10175485 | 3300032005 | Bacteria | 1621 |
| 284 | Ga0307411_10266605 | 3300032005 | Bacteria | 1355 |
| 285 | Ga0307415_100001640 | 3300032126 | Bacteria | 10835 |
| 286 | Ga0307415_100067888 | 3300032126 | Bacteria | 2493 |
| 287 | Ga0307415_100157647 | 3300032126 | Bacteria | 1755 |
| 288 | Ga0373935_0006082 | 3300035692 | Bacteria | 7177 |
| 289 | Ga0395899_0000129 | 3300037312 | Bacteria | 118043 |
| 290 | Ga0395899_0000270 | 3300037312 | Bacteria | 68004 |
| 291 | Ga0395899_0000998 | 3300037312 | Bacteria | 25996 |
| 292 | Ga0395899_0003175 | 3300037312 | Bacteria | 13042 |
| 293 | Ga0395900_0000290 | 3300037418 | Bacteria | 75444 |
| 294 | Ga0395900_0001554 | 3300037418 | Bacteria | 27256 |
| 295 | Ga0395900_0001837 | 3300037418 | Bacteria | 24190 |
| 296 | Ga0395900_0005822 | 3300037418 | Bacteria | 12876 |
| 297 | Ga0395900_0090707 | 3300037418 | Bacteria | 3141 |
| 298 | Ga0395900_0093159 | 3300037418 | Bacteria | 3095 |
| 299 | Ga0395900_0117866 | 3300037418 | Bacteria | 2724 |
| 300 | Ga0395900_0120443 | 3300037418 | Bacteria | 2693 |
| 301 | Ga0395900_0179896 | 3300037418 | Bacteria | 2149 |
| 302 | Ga0395900_0333726 | 3300037418 | Bacteria | 1493 |
| 303 | Ga0395898_0000054 | 3300037466 | Bacteria | 279561 |
| 304 | Ga0395898_0002537 | 3300037466 | Bacteria | 21412 |
| 305 | Ga0395898_0006151 | 3300037466 | Bacteria | 12854 |
| 306 | Ga0395898_0009619 | 3300037466 | Bacteria | 10149 |
| 307 | Ga0395898_0132088 | 3300037466 | Bacteria | 2391 |
| 308 | Ga0395898_0136525 | 3300037466 | Bacteria | 2348 |
| 309 | Ga0395898_0361301 | 3300037466 | Bacteria | 1384 |
| 310 | Ga0395905_0000046 | 3300037471 | Bacteria | 240463 |
| 311 | Ga0395905_0001881 | 3300037471 | Bacteria | 24188 |
| 312 | Ga0395905_0004198 | 3300037471 | Bacteria | 15079 |
| 313 | Ga0395905_0015376 | 3300037471 | Bacteria | 7273 |
| 314 | Ga0395905_0022255 | 3300037471 | Bacteria | 5998 |
| 315 | Ga0395905_0068148 | 3300037471 | Bacteria | 3333 |
| 316 | Ga0395905_0117175 | 3300037471 | Bacteria | 2503 |
| 317 | Ga0395905_0257447 | 3300037471 | Bacteria | 1630 |
| 318 | Ga0395905_0378476 | 3300037471 | Bacteria | 1309 |
| 319 | Ga0395901_0000102 | 3300038443 | Bacteria | 115611 |
| 320 | Ga0395901_0001239 | 3300038443 | Bacteria | 27244 |
| 321 | Ga0395901_0015174 | 3300038443 | Bacteria | 7835 |
| 322 | Ga0395901_0020521 | 3300038443 | Bacteria | 6763 |
| 323 | Ga0395901_0043829 | 3300038443 | Bacteria | 4640 |
| 324 | Ga0395901_0063564 | 3300038443 | Bacteria | 3841 |
| 325 | Ga0395901_0105552 | 3300038443 | Bacteria | 2957 |
| 326 | Ga0395901_0279257 | 3300038443 | Bacteria | 1735 |
| 327 | Ga0436365_0512070 | 3300039437 | Bacteria | 14106 |
| 328 | Ga0439432_022254 | 3300042006 | Bacteria | 2094 |
| 329 | Ga0439432_033582 | 3300042006 | Bacteria | 1650 |
| 330 | Ga0439458_0000063 | 3300042157 | Bacteria | 18856 |
| 331 | Ga0466972_0035316 | 3300044658 | Bacteria | 2447 |
| 332 | Ga0466966_0073090 | 3300044684 | Bacteria | 2145 |
| 333 | Ga0466961_0048452 | 3300044693 | Bacteria | 2715 |
| 334 | Ga0466964_0004751 | 3300044706 | Bacteria | 5021 |
| 335 | Ga0466971_0009417 | 3300044719 | Bacteria | 4264 |
| 336 | Ga0466970_0008862 | 3300044765 | Bacteria | 5072 |
| 337 | Ga0466970_0016451 | 3300044765 | Bacteria | 3814 |
| 338 | Ga0466970_0030593 | 3300044765 | Bacteria | 2839 |
| 339 | Ga0466960_0026552 | 3300044901 | Bacteria | 2632 |
| 340 | Ga0466959_0017235 | 3300045049 | Bacteria | 5291 |
| 341 | Ga0466958_0041320 | 3300045836 | Bacteria | 2773 |
| 342 | Ga0466958_0071884 | 3300045836 | Bacteria | 2118 |
| 343 | Ga0466967_0019385 | 3300045976 | Bacteria | 5469 |
| 344 | Ga0466967_0356707 | 3300045976 | Bacteria | 1416 |
| 345 | Ga0495585_0007794 | 3300046492 | Bacteria | 6524 |
| 346 | Ga0495663_0014444 | 3300046525 | Bacteria | 2213 |
| 347 | Ga0495598_0004155 | 3300046537 | Bacteria | 3118 |
| 348 | Ga0495621_0000406 | 3300046539 | Bacteria | 10609 |
| 349 | Ga0495621_0000714 | 3300046539 | Bacteria | 8411 |
| 350 | Ga0495669_0007152 | 3300046684 | Bacteria | 4676 |
| 351 | Ga0495669_0012812 | 3300046684 | Bacteria | 3570 |
| 352 | Ga0495670_0000148 | 3300046691 | Bacteria | 30968 |
| 353 | Ga0496100_0001507 | 3300048903 | Bacteria | 11417 |
| 354 | Ga0496100_0025602 | 3300048903 | Bacteria | 3610 |
| 355 | Ga0496101_0000216 | 3300048904 | Bacteria | 43445 |
| 356 | Ga0496101_0015800 | 3300048904 | Bacteria | 5094 |
| 357 | Ga0496101_0084017 | 3300048904 | Bacteria | 2357 |
| 358 | Ga0496105_0097673 | 3300048908 | Bacteria | 2426 |
| 359 | Ga0496106_0004559 | 3300048909 | Bacteria | 10269 |
| 360 | Ga0496106_0036058 | 3300048909 | Bacteria | 3700 |
| 361 | Ga0496107_0019478 | 3300048910 | Bacteria | 4787 |
| 362 | Ga0496107_0071190 | 3300048910 | Bacteria | 2526 |
| 363 | Ga0496108_0009355 | 3300048911 | Bacteria | 7933 |
| 364 | Ga0496108_0019714 | 3300048911 | Bacteria | 5539 |
| 365 | Ga0496109_0012766 | 3300048912 | Bacteria | 7261 |
| 366 | Ga0496109_0236066 | 3300048912 | Bacteria | 1720 |
| 367 | Ga0496110_0000132 | 3300048913 | Bacteria | 42838 |
| 368 | Ga0496110_0001649 | 3300048913 | Bacteria | 16372 |
| 369 | Ga0496110_0005691 | 3300048913 | Bacteria | 9788 |
| 370 | Ga0496110_0162918 | 3300048913 | Bacteria | 2022 |
| 371 | Ga0496111_0001206 | 3300048914 | Bacteria | 14423 |
| 372 | Ga0496111_0016761 | 3300048914 | Bacteria | 5054 |
| 373 | Ga0496111_0147060 | 3300048914 | Bacteria | 1747 |
| 374 | Ga0496112_0002404 | 3300048915 | Bacteria | 15066 |
| 375 | Ga0496112_0013532 | 3300048915 | Bacteria | 7536 |
| 376 | Ga0496112_0022871 | 3300048915 | Bacteria | 5963 |
| 377 | Ga0496112_0037724 | 3300048915 | Bacteria | 4717 |
| 378 | Ga0496113_0000182 | 3300048916 | Bacteria | 28189 |
| 379 | Ga0496113_0012319 | 3300048916 | Bacteria | 5744 |
| 380 | Ga0496113_0026731 | 3300048916 | Bacteria | 4130 |
| 381 | Ga0496114_0007521 | 3300048917 | Bacteria | 8614 |
| 382 | Ga0496115_0000618 | 3300048918 | Bacteria | 26985 |
| 383 | Ga0501069_0029794 | 3300049585 | Bacteria | 2996 |
| 384 | Ga0501221_008887 | 3300049704 | Bacteria | 1755 |
| 385 | Ga0466962_0047136 | 3300061719 | Bacteria | 2059 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0093159 | Ga0395900_0093159_1785_2945 | 372 |
| 2 | 3300037471 | Ga0395905_0257447 | Ga0395905_0257447_64_1245 | 372 |
| 3 | 3300049704 | Ga0501221_008887 | Ga0501221_008887_363_1499 | 376 |
| 4 | 3300048913 | Ga0496110_0001649 | Ga0496110_0001649_1008_2150 | 380 |
| 5 | 3300048915 | Ga0496112_0013532 | Ga0496112_0013532_3734_4876 | 380 |
| 6 | 3300005328 | Ga0070676_10013671 | Ga0070676_100136712 | 382 |
| 7 | 3300005331 | Ga0070670_100007638 | Ga0070670_1000076387 | 382 |
| 8 | 3300005344 | Ga0070661_100002568 | Ga0070661_1000025685 | 382 |
| 9 | 3300005354 | Ga0070675_100009729 | Ga0070675_1000097297 | 382 |
| 10 | 3300005354 | Ga0070675_100042132 | Ga0070675_1000421325 | 382 |
| 11 | 3300005457 | Ga0070662_100010228 | Ga0070662_1000102288 | 382 |
| 12 | 3300005457 | Ga0070662_100033756 | Ga0070662_1000337563 | 382 |
| 13 | 3300005543 | Ga0070672_100025345 | Ga0070672_1000253453 | 382 |
| 14 | 3300005548 | Ga0070665_100019688 | Ga0070665_1000196887 | 382 |
| 15 | 3300005548 | Ga0070665_100055579 | Ga0070665_1000555793 | 382 |
| 16 | 3300005985 | Ga0081539_10010862 | Ga0081539_100108626 | 382 |
| 17 | 3300009177 | Ga0105248_10039607 | Ga0105248_100396073 | 382 |
| 18 | 3300025925 | Ga0207650_10005726 | Ga0207650_100057266 | 382 |
| 19 | 3300025926 | Ga0207659_10005591 | Ga0207659_100055914 | 382 |
| 20 | 3300025931 | Ga0207644_10000589 | Ga0207644_100005895 | 382 |
| 21 | 3300025933 | Ga0207706_10007332 | Ga0207706_100073327 | 382 |
| 22 | 3300025933 | Ga0207706_10026534 | Ga0207706_100265346 | 382 |
| 23 | 3300025940 | Ga0207691_10009429 | Ga0207691_100094293 | 382 |
| 24 | 3300025941 | Ga0207711_10023507 | Ga0207711_100235075 | 382 |
| 25 | 3300025945 | Ga0207679_10009541 | Ga0207679_100095414 | 382 |
| 26 | 3300025945 | Ga0207679_10090781 | Ga0207679_100907813 | 382 |
| 27 | 3300025960 | Ga0207651_10071060 | Ga0207651_100710603 | 382 |
| 28 | 3300025986 | Ga0207658_10027812 | Ga0207658_100278123 | 382 |
| 29 | 3300028379 | Ga0268266_10068640 | Ga0268266_100686403 | 382 |
| 30 | 3300031548 | Ga0307408_100060086 | Ga0307408_1000600863 | 382 |
| 31 | 3300031548 | Ga0307408_100128112 | Ga0307408_1001281122 | 382 |
| 32 | 3300031548 | Ga0307408_100160345 | Ga0307408_1001603452 | 382 |
| 33 | 3300031548 | Ga0307408_100283248 | Ga0307408_1002832481 | 382 |
| 34 | 3300031731 | Ga0307405_10002616 | Ga0307405_100026163 | 382 |
| 35 | 3300031824 | Ga0307413_10109630 | Ga0307413_101096302 | 382 |
| 36 | 3300031852 | Ga0307410_10000194 | Ga0307410_1000019411 | 382 |
| 37 | 3300031852 | Ga0307410_10002535 | Ga0307410_100025354 | 382 |
| 38 | 3300031852 | Ga0307410_10031158 | Ga0307410_100311582 | 382 |
| 39 | 3300031852 | Ga0307410_10035370 | Ga0307410_100353703 | 382 |
| 40 | 3300031903 | Ga0307407_10000985 | Ga0307407_100009854 | 382 |
| 41 | 3300031903 | Ga0307407_10007349 | Ga0307407_100073494 | 382 |
| 42 | 3300031903 | Ga0307407_10032549 | Ga0307407_100325494 | 382 |
| 43 | 3300031903 | Ga0307407_10060946 | Ga0307407_100609463 | 382 |
| 44 | 3300031911 | Ga0307412_10067723 | Ga0307412_100677233 | 382 |
| 45 | 3300031911 | Ga0307412_10085099 | Ga0307412_100850992 | 382 |
| 46 | 3300031995 | Ga0307409_100000069 | Ga0307409_10000006915 | 382 |
| 47 | 3300031995 | Ga0307409_100001351 | Ga0307409_1000013512 | 382 |
| 48 | 3300031995 | Ga0307409_100001668 | Ga0307409_1000016689 | 382 |
| 49 | 3300031995 | Ga0307409_100005710 | Ga0307409_1000057102 | 382 |
| 50 | 3300031995 | Ga0307409_100073170 | Ga0307409_1000731702 | 382 |
| 51 | 3300032002 | Ga0307416_100005350 | Ga0307416_1000053504 | 382 |
| 52 | 3300032002 | Ga0307416_100048775 | Ga0307416_1000487753 | 382 |
| 53 | 3300032002 | Ga0307416_100228063 | Ga0307416_1002280632 | 382 |
| 54 | 3300032004 | Ga0307414_10000651 | Ga0307414_1000065114 | 382 |
| 55 | 3300032004 | Ga0307414_10000834 | Ga0307414_100008343 | 382 |
| 56 | 3300032005 | Ga0307411_10000647 | Ga0307411_100006477 | 382 |
| 57 | 3300032005 | Ga0307411_10001475 | Ga0307411_1000147512 | 382 |
| 58 | 3300032005 | Ga0307411_10004285 | Ga0307411_100042852 | 382 |
| 59 | 3300032005 | Ga0307411_10020158 | Ga0307411_100201583 | 382 |
| 60 | 3300032005 | Ga0307411_10175485 | Ga0307411_101754852 | 382 |
| 61 | 3300032005 | Ga0307411_10266605 | Ga0307411_102666052 | 382 |
| 62 | 3300032126 | Ga0307415_100001640 | Ga0307415_1000016404 | 382 |
| 63 | 3300032126 | Ga0307415_100157647 | Ga0307415_1001576472 | 382 |
| 64 | 3300042006 | Ga0439432_033582 | Ga0439432_033582_418_1566 | 382 |
| 65 | 3300044901 | Ga0466960_0026552 | Ga0466960_0026552_1230_2381 | 382 |
| 66 | 3300046492 | Ga0495585_0007794 | Ga0495585_0007794_3693_4841 | 382 |
| 67 | 3300046525 | Ga0495663_0014444 | Ga0495663_0014444_247_1395 | 382 |
| 68 | 3300046539 | Ga0495621_0000714 | Ga0495621_0000714_6132_7280 | 382 |
| 69 | 3300046684 | Ga0495669_0007152 | Ga0495669_0007152_1191_2339 | 382 |
| 70 | 3300048913 | Ga0496110_0005691 | Ga0496110_0005691_5770_6918 | 382 |
| 71 | 3300005336 | Ga0070680_100029717 | Ga0070680_1000297176 | 384 |
| 72 | 3300005339 | Ga0070660_100058791 | Ga0070660_1000587914 | 384 |
| 73 | 3300005344 | Ga0070661_100094630 | Ga0070661_1000946301 | 384 |
| 74 | 3300005366 | Ga0070659_100019287 | Ga0070659_1000192873 | 384 |
| 75 | 3300005455 | Ga0070663_100053566 | Ga0070663_1000535661 | 384 |
| 76 | 3300005457 | Ga0070662_100000405 | Ga0070662_1000004056 | 384 |
| 77 | 3300005530 | Ga0070679_100234357 | Ga0070679_1002343572 | 384 |
| 78 | 3300005539 | Ga0068853_100025243 | Ga0068853_1000252432 | 384 |
| 79 | 3300005564 | Ga0070664_100003746 | Ga0070664_1000037463 | 384 |
| 80 | 3300013100 | Ga0157373_10006579 | Ga0157373_100065797 | 384 |
| 81 | 3300013102 | Ga0157371_10090871 | Ga0157371_100908712 | 384 |
| 82 | 3300025917 | Ga0207660_10148724 | Ga0207660_101487241 | 384 |
| 83 | 3300025919 | Ga0207657_10047041 | Ga0207657_100470414 | 384 |
| 84 | 3300025921 | Ga0207652_10032002 | Ga0207652_100320022 | 384 |
| 85 | 3300025933 | Ga0207706_10002252 | Ga0207706_1000225218 | 384 |
| 86 | 3300025945 | Ga0207679_10004315 | Ga0207679_100043155 | 384 |
| 87 | 3300031903 | Ga0307407_10006674 | Ga0307407_100066746 | 384 |
| 88 | 3300031911 | Ga0307412_10018394 | Ga0307412_100183942 | 384 |
| 89 | 3300032004 | Ga0307414_10004390 | Ga0307414_100043907 | 384 |
| 90 | 3300032005 | Ga0307411_10045362 | Ga0307411_100453622 | 384 |
| 91 | 3300037471 | Ga0395905_0068148 | Ga0395905_0068148_2165_3319 | 384 |
| 92 | 3300038443 | Ga0395901_0105552 | Ga0395901_0105552_718_1872 | 384 |
| 93 | 3300044693 | Ga0466961_0048452 | Ga0466961_0048452_695_1849 | 384 |
| 94 | 3300044719 | Ga0466971_0009417 | Ga0466971_0009417_2123_3277 | 384 |
| 95 | 3300044765 | Ga0466970_0016451 | Ga0466970_0016451_2547_3701 | 384 |
| 96 | 3300045836 | Ga0466958_0071884 | Ga0466958_0071884_53_1207 | 384 |
| 97 | 3300048915 | Ga0496112_0022871 | Ga0496112_0022871_584_1738 | 384 |
| 98 | 3300048916 | Ga0496113_0026731 | Ga0496113_0026731_1286_2440 | 384 |
| 99 | 3300061719 | Ga0466962_0047136 | Ga0466962_0047136_694_1848 | 384 |
| 100 | 3300001979 | JGI24740J21852_10003633 | JGI24740J21852_100036336 | 385 |
| 101 | 3300005327 | Ga0070658_10001056 | Ga0070658_1000105613 | 385 |
| 102 | 3300005327 | Ga0070658_10001507 | Ga0070658_1000150715 | 385 |
| 103 | 3300005327 | Ga0070658_10012118 | Ga0070658_100121184 | 385 |
| 104 | 3300005327 | Ga0070658_10018432 | Ga0070658_100184322 | 385 |
| 105 | 3300005328 | Ga0070676_10043143 | Ga0070676_100431432 | 385 |
| 106 | 3300005329 | Ga0070683_100001823 | Ga0070683_1000018235 | 385 |
| 107 | 3300005330 | Ga0070690_100006550 | Ga0070690_1000065507 | 385 |
| 108 | 3300005331 | Ga0070670_100006227 | Ga0070670_1000062277 | 385 |
| 109 | 3300005331 | Ga0070670_100010140 | Ga0070670_1000101409 | 385 |
| 110 | 3300005331 | Ga0070670_100028155 | Ga0070670_1000281551 | 385 |
| 111 | 3300005335 | Ga0070666_10000310 | Ga0070666_100003105 | 385 |
| 112 | 3300005335 | Ga0070666_10003456 | Ga0070666_100034563 | 385 |
| 113 | 3300005335 | Ga0070666_10023954 | Ga0070666_100239542 | 385 |
| 114 | 3300005335 | Ga0070666_10073651 | Ga0070666_100736512 | 385 |
| 115 | 3300005338 | Ga0068868_100005004 | Ga0068868_1000050049 | 385 |
| 116 | 3300005339 | Ga0070660_100000393 | Ga0070660_10000039311 | 385 |
| 117 | 3300005339 | Ga0070660_100005078 | Ga0070660_1000050784 | 385 |
| 118 | 3300005339 | Ga0070660_100005430 | Ga0070660_1000054305 | 385 |
| 119 | 3300005339 | Ga0070660_100023577 | Ga0070660_1000235773 | 385 |
| 120 | 3300005339 | Ga0070660_100180002 | Ga0070660_1001800022 | 385 |
| 121 | 3300005343 | Ga0070687_100015493 | Ga0070687_1000154932 | 385 |
| 122 | 3300005344 | Ga0070661_100059039 | Ga0070661_1000590393 | 385 |
| 123 | 3300005344 | Ga0070661_100101244 | Ga0070661_1001012442 | 385 |
| 124 | 3300005345 | Ga0070692_10000436 | Ga0070692_100004363 | 385 |
| 125 | 3300005345 | Ga0070692_10000491 | Ga0070692_100004913 | 385 |
| 126 | 3300005354 | Ga0070675_100118168 | Ga0070675_1001181682 | 385 |
| 127 | 3300005355 | Ga0070671_100007768 | Ga0070671_1000077684 | 385 |
| 128 | 3300005355 | Ga0070671_100013990 | Ga0070671_1000139903 | 385 |
| 129 | 3300005355 | Ga0070671_100030093 | Ga0070671_1000300932 | 385 |
| 130 | 3300005355 | Ga0070671_100123294 | Ga0070671_1001232942 | 385 |
| 131 | 3300005356 | Ga0070674_100010882 | Ga0070674_1000108825 | 385 |
| 132 | 3300005356 | Ga0070674_100048059 | Ga0070674_1000480592 | 385 |
| 133 | 3300005364 | Ga0070673_100084169 | Ga0070673_1000841692 | 385 |
| 134 | 3300005366 | Ga0070659_100008864 | Ga0070659_1000088647 | 385 |
| 135 | 3300005367 | Ga0070667_100029775 | Ga0070667_1000297756 | 385 |
| 136 | 3300005367 | Ga0070667_100048054 | Ga0070667_1000480541 | 385 |
| 137 | 3300005435 | Ga0070714_100170033 | Ga0070714_1001700332 | 385 |
| 138 | 3300005436 | Ga0070713_100007649 | Ga0070713_1000076497 | 385 |
| 139 | 3300005436 | Ga0070713_100019382 | Ga0070713_1000193823 | 385 |
| 140 | 3300005455 | Ga0070663_100000271 | Ga0070663_10000027115 | 385 |
| 141 | 3300005455 | Ga0070663_100034333 | Ga0070663_1000343331 | 385 |
| 142 | 3300005456 | Ga0070678_100000769 | Ga0070678_10000076911 | 385 |
| 143 | 3300005456 | Ga0070678_100001896 | Ga0070678_1000018968 | 385 |
| 144 | 3300005456 | Ga0070678_100045545 | Ga0070678_1000455453 | 385 |
| 145 | 3300005456 | Ga0070678_100120372 | Ga0070678_1001203722 | 385 |
| 146 | 3300005457 | Ga0070662_100001018 | Ga0070662_1000010187 | 385 |
| 147 | 3300005457 | Ga0070662_100091059 | Ga0070662_1000910592 | 385 |
| 148 | 3300005458 | Ga0070681_10015737 | Ga0070681_1001573710 | 385 |
| 149 | 3300005458 | Ga0070681_10234766 | Ga0070681_102347662 | 385 |
| 150 | 3300005459 | Ga0068867_100037833 | Ga0068867_1000378332 | 385 |
| 151 | 3300005459 | Ga0068867_100313174 | Ga0068867_1003131741 | 385 |
| 152 | 3300005530 | Ga0070679_100000346 | Ga0070679_10000034622 | 385 |
| 153 | 3300005530 | Ga0070679_100093016 | Ga0070679_1000930162 | 385 |
| 154 | 3300005530 | Ga0070679_100137231 | Ga0070679_1001372313 | 385 |
| 155 | 3300005539 | Ga0068853_100409040 | Ga0068853_1004090401 | 385 |
| 156 | 3300005543 | Ga0070672_100014410 | Ga0070672_1000144104 | 385 |
| 157 | 3300005548 | Ga0070665_100026549 | Ga0070665_1000265495 | 385 |
| 158 | 3300005563 | Ga0068855_100001751 | Ga0068855_10000175111 | 385 |
| 159 | 3300005563 | Ga0068855_100016546 | Ga0068855_1000165467 | 385 |
| 160 | 3300005563 | Ga0068855_100037414 | Ga0068855_1000374146 | 385 |
| 161 | 3300005564 | Ga0070664_100006281 | Ga0070664_1000062817 | 385 |
| 162 | 3300005564 | Ga0070664_100016156 | Ga0070664_1000161563 | 385 |
| 163 | 3300005564 | Ga0070664_100019989 | Ga0070664_1000199892 | 385 |
| 164 | 3300005564 | Ga0070664_100145073 | Ga0070664_1001450732 | 385 |
| 165 | 3300005578 | Ga0068854_100014136 | Ga0068854_1000141363 | 385 |
| 166 | 3300005578 | Ga0068854_100214048 | Ga0068854_1002140482 | 385 |
| 167 | 3300005614 | Ga0068856_100026281 | Ga0068856_1000262813 | 385 |
| 168 | 3300005614 | Ga0068856_100081166 | Ga0068856_1000811662 | 385 |
| 169 | 3300005616 | Ga0068852_100049356 | Ga0068852_1000493562 | 385 |
| 170 | 3300005616 | Ga0068852_100067067 | Ga0068852_1000670672 | 385 |
| 171 | 3300005617 | Ga0068859_100014107 | Ga0068859_10001410710 | 385 |
| 172 | 3300005617 | Ga0068859_100020826 | Ga0068859_1000208265 | 385 |
| 173 | 3300005718 | Ga0068866_10017595 | Ga0068866_100175952 | 385 |
| 174 | 3300005834 | Ga0068851_10006181 | Ga0068851_100061814 | 385 |
| 175 | 3300005834 | Ga0068851_10030777 | Ga0068851_100307772 | 385 |
| 176 | 3300005841 | Ga0068863_100000607 | Ga0068863_10000060720 | 385 |
| 177 | 3300005841 | Ga0068863_100079457 | Ga0068863_1000794574 | 385 |
| 178 | 3300005842 | Ga0068858_100006875 | Ga0068858_1000068753 | 385 |
| 179 | 3300005842 | Ga0068858_100012047 | Ga0068858_1000120477 | 385 |
| 180 | 3300005843 | Ga0068860_100061450 | Ga0068860_1000614502 | 385 |
| 181 | 3300005843 | Ga0068860_100068957 | Ga0068860_1000689572 | 385 |
| 182 | 3300006028 | Ga0070717_10045903 | Ga0070717_100459032 | 385 |
| 183 | 3300006237 | Ga0097621_100043380 | Ga0097621_1000433802 | 385 |
| 184 | 3300006237 | Ga0097621_100238236 | Ga0097621_1002382362 | 385 |
| 185 | 3300006358 | Ga0068871_100041836 | Ga0068871_1000418365 | 385 |
| 186 | 3300006358 | Ga0068871_100068259 | Ga0068871_1000682593 | 385 |
| 187 | 3300006931 | Ga0097620_100014105 | Ga0097620_1000141052 | 385 |
| 188 | 3300006931 | Ga0097620_100020826 | Ga0097620_1000208265 | 385 |
| 189 | 3300009098 | Ga0105245_10210458 | Ga0105245_102104582 | 385 |
| 190 | 3300009177 | Ga0105248_10003900 | Ga0105248_1000390012 | 385 |
| 191 | 3300009177 | Ga0105248_10015809 | Ga0105248_100158098 | 385 |
| 192 | 3300009177 | Ga0105248_10027034 | Ga0105248_100270343 | 385 |
| 193 | 3300009177 | Ga0105248_10242175 | Ga0105248_102421752 | 385 |
| 194 | 3300013100 | Ga0157373_10017946 | Ga0157373_100179465 | 385 |
| 195 | 3300013100 | Ga0157373_10138617 | Ga0157373_101386172 | 385 |
| 196 | 3300013100 | Ga0157373_10177656 | Ga0157373_101776562 | 385 |
| 197 | 3300013102 | Ga0157371_10001298 | Ga0157371_1000129817 | 385 |
| 198 | 3300013104 | Ga0157370_10002353 | Ga0157370_1000235316 | 385 |
| 199 | 3300013104 | Ga0157370_10015094 | Ga0157370_100150946 | 385 |
| 200 | 3300013104 | Ga0157370_10041857 | Ga0157370_100418575 | 385 |
| 201 | 3300013105 | Ga0157369_10009477 | Ga0157369_1000947712 | 385 |
| 202 | 3300013105 | Ga0157369_10027719 | Ga0157369_100277197 | 385 |
| 203 | 3300013105 | Ga0157369_10035691 | Ga0157369_100356917 | 385 |
| 204 | 3300013105 | Ga0157369_10102686 | Ga0157369_101026862 | 385 |
| 205 | 3300013105 | Ga0157369_10152689 | Ga0157369_101526892 | 385 |
| 206 | 3300013296 | Ga0157374_10015546 | Ga0157374_100155463 | 385 |
| 207 | 3300013296 | Ga0157374_10113441 | Ga0157374_101134412 | 385 |
| 208 | 3300013306 | Ga0163162_10004976 | Ga0163162_100049763 | 385 |
| 209 | 3300013308 | Ga0157375_10005040 | Ga0157375_1000504014 | 385 |
| 210 | 3300013308 | Ga0157375_10283062 | Ga0157375_102830622 | 385 |
| 211 | 3300014325 | Ga0163163_10032161 | Ga0163163_100321615 | 385 |
| 212 | 3300014969 | Ga0157376_10055389 | Ga0157376_100553893 | 385 |
| 213 | 3300025315 | Ga0207697_10049952 | Ga0207697_100499522 | 385 |
| 214 | 3300025315 | Ga0207697_10083678 | Ga0207697_100836781 | 385 |
| 215 | 3300025903 | Ga0207680_10040097 | Ga0207680_100400973 | 385 |
| 216 | 3300025903 | Ga0207680_10061812 | Ga0207680_100618122 | 385 |
| 217 | 3300025904 | Ga0207647_10001664 | Ga0207647_100016642 | 385 |
| 218 | 3300025904 | Ga0207647_10001685 | Ga0207647_1000168513 | 385 |
| 219 | 3300025904 | Ga0207647_10070847 | Ga0207647_100708472 | 385 |
| 220 | 3300025907 | Ga0207645_10047928 | Ga0207645_100479282 | 385 |
| 221 | 3300025909 | Ga0207705_10000270 | Ga0207705_1000027032 | 385 |
| 222 | 3300025909 | Ga0207705_10000654 | Ga0207705_1000065411 | 385 |
| 223 | 3300025909 | Ga0207705_10006228 | Ga0207705_100062287 | 385 |
| 224 | 3300025909 | Ga0207705_10012028 | Ga0207705_100120285 | 385 |
| 225 | 3300025909 | Ga0207705_10012436 | Ga0207705_100124363 | 385 |
| 226 | 3300025909 | Ga0207705_10034066 | Ga0207705_100340662 | 385 |
| 227 | 3300025909 | Ga0207705_10075764 | Ga0207705_100757642 | 385 |
| 228 | 3300025912 | Ga0207707_10015148 | Ga0207707_100151489 | 385 |
| 229 | 3300025912 | Ga0207707_10173707 | Ga0207707_101737072 | 385 |
| 230 | 3300025912 | Ga0207707_10348055 | Ga0207707_103480552 | 385 |
| 231 | 3300025918 | Ga0207662_10016076 | Ga0207662_100160764 | 385 |
| 232 | 3300025919 | Ga0207657_10000165 | Ga0207657_1000016554 | 385 |
| 233 | 3300025919 | Ga0207657_10001054 | Ga0207657_1000105410 | 385 |
| 234 | 3300025919 | Ga0207657_10001091 | Ga0207657_1000109120 | 385 |
| 235 | 3300025919 | Ga0207657_10003456 | Ga0207657_1000345617 | 385 |
| 236 | 3300025919 | Ga0207657_10006190 | Ga0207657_100061905 | 385 |
| 237 | 3300025919 | Ga0207657_10071821 | Ga0207657_100718212 | 385 |
| 238 | 3300025919 | Ga0207657_10072416 | Ga0207657_100724163 | 385 |
| 239 | 3300025920 | Ga0207649_10011789 | Ga0207649_100117892 | 385 |
| 240 | 3300025920 | Ga0207649_10040305 | Ga0207649_100403052 | 385 |
| 241 | 3300025920 | Ga0207649_10061925 | Ga0207649_100619253 | 385 |
| 242 | 3300025921 | Ga0207652_10000058 | Ga0207652_1000005886 | 385 |
| 243 | 3300025921 | Ga0207652_10113631 | Ga0207652_101136312 | 385 |
| 244 | 3300025921 | Ga0207652_10295371 | Ga0207652_102953712 | 385 |
| 245 | 3300025925 | Ga0207650_10161449 | Ga0207650_101614492 | 385 |
| 246 | 3300025926 | Ga0207659_10007014 | Ga0207659_100070142 | 385 |
| 247 | 3300025929 | Ga0207664_10241180 | Ga0207664_102411802 | 385 |
| 248 | 3300025931 | Ga0207644_10000240 | Ga0207644_1000024027 | 385 |
| 249 | 3300025931 | Ga0207644_10003730 | Ga0207644_100037304 | 385 |
| 250 | 3300025931 | Ga0207644_10009753 | Ga0207644_100097537 | 385 |
| 251 | 3300025931 | Ga0207644_10044101 | Ga0207644_100441013 | 385 |
| 252 | 3300025931 | Ga0207644_10060796 | Ga0207644_100607962 | 385 |
| 253 | 3300025932 | Ga0207690_10046787 | Ga0207690_100467873 | 385 |
| 254 | 3300025932 | Ga0207690_10073301 | Ga0207690_100733012 | 385 |
| 255 | 3300025933 | Ga0207706_10004209 | Ga0207706_1000420911 | 385 |
| 256 | 3300025933 | Ga0207706_10004293 | Ga0207706_1000429317 | 385 |
| 257 | 3300025933 | Ga0207706_10005424 | Ga0207706_100054248 | 385 |
| 258 | 3300025933 | Ga0207706_10042629 | Ga0207706_100426292 | 385 |
| 259 | 3300025933 | Ga0207706_10134451 | Ga0207706_101344512 | 385 |
| 260 | 3300025937 | Ga0207669_10001902 | Ga0207669_100019022 | 385 |
| 261 | 3300025937 | Ga0207669_10004611 | Ga0207669_100046113 | 385 |
| 262 | 3300025939 | Ga0207665_10009130 | Ga0207665_100091303 | 385 |
| 263 | 3300025940 | Ga0207691_10001687 | Ga0207691_100016874 | 385 |
| 264 | 3300025940 | Ga0207691_10073402 | Ga0207691_100734022 | 385 |
| 265 | 3300025941 | Ga0207711_10010427 | Ga0207711_100104279 | 385 |
| 266 | 3300025941 | Ga0207711_10013228 | Ga0207711_100132286 | 385 |
| 267 | 3300025941 | Ga0207711_10053258 | Ga0207711_100532583 | 385 |
| 268 | 3300025941 | Ga0207711_10070296 | Ga0207711_100702964 | 385 |
| 269 | 3300025944 | Ga0207661_10002950 | Ga0207661_100029502 | 385 |
| 270 | 3300025945 | Ga0207679_10021482 | Ga0207679_100214822 | 385 |
| 271 | 3300025945 | Ga0207679_10099494 | Ga0207679_100994942 | 385 |
| 272 | 3300025949 | Ga0207667_10000579 | Ga0207667_1000057931 | 385 |
| 273 | 3300025949 | Ga0207667_10068820 | Ga0207667_100688202 | 385 |
| 274 | 3300025949 | Ga0207667_10078977 | Ga0207667_100789772 | 385 |
| 275 | 3300025949 | Ga0207667_10160566 | Ga0207667_101605662 | 385 |
| 276 | 3300025960 | Ga0207651_10002688 | Ga0207651_100026882 | 385 |
| 277 | 3300025960 | Ga0207651_10066381 | Ga0207651_100663812 | 385 |
| 278 | 3300025981 | Ga0207640_10049474 | Ga0207640_100494742 | 385 |
| 279 | 3300025986 | Ga0207658_10011093 | Ga0207658_100110932 | 385 |
| 280 | 3300026023 | Ga0207677_10002030 | Ga0207677_100020304 | 385 |
| 281 | 3300026035 | Ga0207703_10008065 | Ga0207703_100080655 | 385 |
| 282 | 3300026041 | Ga0207639_10275763 | Ga0207639_102757632 | 385 |
| 283 | 3300026067 | Ga0207678_10000217 | Ga0207678_1000021724 | 385 |
| 284 | 3300026067 | Ga0207678_10009864 | Ga0207678_100098641 | 385 |
| 285 | 3300026067 | Ga0207678_10021483 | Ga0207678_100214836 | 385 |
| 286 | 3300026067 | Ga0207678_10050930 | Ga0207678_100509305 | 385 |
| 287 | 3300026067 | Ga0207678_10062289 | Ga0207678_100622892 | 385 |
| 288 | 3300026078 | Ga0207702_10015421 | Ga0207702_100154216 | 385 |
| 289 | 3300026078 | Ga0207702_10019789 | Ga0207702_100197896 | 385 |
| 290 | 3300026078 | Ga0207702_10069492 | Ga0207702_100694922 | 385 |
| 291 | 3300026088 | Ga0207641_10029763 | Ga0207641_100297632 | 385 |
| 292 | 3300026088 | Ga0207641_10174343 | Ga0207641_101743432 | 385 |
| 293 | 3300026089 | Ga0207648_10005651 | Ga0207648_100056513 | 385 |
| 294 | 3300026089 | Ga0207648_10183990 | Ga0207648_101839903 | 385 |
| 295 | 3300026095 | Ga0207676_10024214 | Ga0207676_100242145 | 385 |
| 296 | 3300026121 | Ga0207683_10000541 | Ga0207683_100005413 | 385 |
| 297 | 3300026121 | Ga0207683_10002053 | Ga0207683_1000205314 | 385 |
| 298 | 3300026121 | Ga0207683_10005631 | Ga0207683_100056317 | 385 |
| 299 | 3300026121 | Ga0207683_10124525 | Ga0207683_101245252 | 385 |
| 300 | 3300026142 | Ga0207698_10000508 | Ga0207698_100005085 | 385 |
| 301 | 3300026142 | Ga0207698_10009360 | Ga0207698_100093607 | 385 |
| 302 | 3300026142 | Ga0207698_10056668 | Ga0207698_100566682 | 385 |
| 303 | 3300031824 | Ga0307413_10043115 | Ga0307413_100431152 | 385 |
| 304 | 3300031911 | Ga0307412_10044177 | Ga0307412_100441772 | 385 |
| 305 | 3300031995 | Ga0307409_100062648 | Ga0307409_1000626482 | 385 |
| 306 | 3300032002 | Ga0307416_100257335 | Ga0307416_1002573352 | 385 |
| 307 | 3300032005 | Ga0307411_10021166 | Ga0307411_100211662 | 385 |
| 308 | 3300032126 | Ga0307415_100067888 | Ga0307415_1000678882 | 385 |
| 309 | 3300035692 | Ga0373935_0006082 | Ga0373935_0006082_2148_3308 | 385 |
| 310 | 3300037312 | Ga0395899_0000129 | Ga0395899_0000129_66778_67938 | 385 |
| 311 | 3300037312 | Ga0395899_0000270 | Ga0395899_0000270_48117_49274 | 385 |
| 312 | 3300037312 | Ga0395899_0000998 | Ga0395899_0000998_9754_10911 | 385 |
| 313 | 3300037312 | Ga0395899_0003175 | Ga0395899_0003175_2387_3544 | 385 |
| 314 | 3300037418 | Ga0395900_0000290 | Ga0395900_0000290_43503_44660 | 385 |
| 315 | 3300037418 | Ga0395900_0001554 | Ga0395900_0001554_5759_6919 | 385 |
| 316 | 3300037418 | Ga0395900_0001837 | Ga0395900_0001837_42_1199 | 385 |
| 317 | 3300037418 | Ga0395900_0005822 | Ga0395900_0005822_693_1850 | 385 |
| 318 | 3300037418 | Ga0395900_0090707 | Ga0395900_0090707_1870_3027 | 385 |
| 319 | 3300037418 | Ga0395900_0117866 | Ga0395900_0117866_448_1605 | 385 |
| 320 | 3300037418 | Ga0395900_0120443 | Ga0395900_0120443_142_1299 | 385 |
| 321 | 3300037418 | Ga0395900_0179896 | Ga0395900_0179896_575_1732 | 385 |
| 322 | 3300037418 | Ga0395900_0333726 | Ga0395900_0333726_48_1205 | 385 |
| 323 | 3300037466 | Ga0395898_0000054 | Ga0395898_0000054_230156_231313 | 385 |
| 324 | 3300037466 | Ga0395898_0002537 | Ga0395898_0002537_10585_11742 | 385 |
| 325 | 3300037466 | Ga0395898_0006151 | Ga0395898_0006151_5770_6927 | 385 |
| 326 | 3300037466 | Ga0395898_0009619 | Ga0395898_0009619_1588_2748 | 385 |
| 327 | 3300037466 | Ga0395898_0132088 | Ga0395898_0132088_914_2071 | 385 |
| 328 | 3300037466 | Ga0395898_0136525 | Ga0395898_0136525_472_1629 | 385 |
| 329 | 3300037466 | Ga0395898_0361301 | Ga0395898_0361301_48_1205 | 385 |
| 330 | 3300037471 | Ga0395905_0000046 | Ga0395905_0000046_191162_192319 | 385 |
| 331 | 3300037471 | Ga0395905_0001881 | Ga0395905_0001881_12243_13400 | 385 |
| 332 | 3300037471 | Ga0395905_0004198 | Ga0395905_0004198_11014_12171 | 385 |
| 333 | 3300037471 | Ga0395905_0015376 | Ga0395905_0015376_693_1850 | 385 |
| 334 | 3300037471 | Ga0395905_0022255 | Ga0395905_0022255_4261_5418 | 385 |
| 335 | 3300037471 | Ga0395905_0117175 | Ga0395905_0117175_992_2152 | 385 |
| 336 | 3300037471 | Ga0395905_0378476 | Ga0395905_0378476_72_1229 | 385 |
| 337 | 3300038443 | Ga0395901_0000102 | Ga0395901_0000102_31798_32955 | 385 |
| 338 | 3300038443 | Ga0395901_0001239 | Ga0395901_0001239_7083_8243 | 385 |
| 339 | 3300038443 | Ga0395901_0015174 | Ga0395901_0015174_1607_2764 | 385 |
| 340 | 3300038443 | Ga0395901_0020521 | Ga0395901_0020521_3502_4659 | 385 |
| 341 | 3300038443 | Ga0395901_0043829 | Ga0395901_0043829_398_1555 | 385 |
| 342 | 3300038443 | Ga0395901_0063564 | Ga0395901_0063564_214_1371 | 385 |
| 343 | 3300038443 | Ga0395901_0279257 | Ga0395901_0279257_357_1517 | 385 |
| 344 | 3300039437 | Ga0436365_0512070 | Ga0436365_0512070_6039_7217 | 385 |
| 345 | 3300042006 | Ga0439432_022254 | Ga0439432_022254_114_1271 | 385 |
| 346 | 3300042157 | Ga0439458_0000063 | Ga0439458_0000063_12893_14050 | 385 |
| 347 | 3300044658 | Ga0466972_0035316 | Ga0466972_0035316_746_1903 | 385 |
| 348 | 3300044684 | Ga0466966_0073090 | Ga0466966_0073090_744_1901 | 385 |
| 349 | 3300044706 | Ga0466964_0004751 | Ga0466964_0004751_1689_2846 | 385 |
| 350 | 3300044765 | Ga0466970_0008862 | Ga0466970_0008862_2638_3795 | 385 |
| 351 | 3300044765 | Ga0466970_0030593 | Ga0466970_0030593_1472_2629 | 385 |
| 352 | 3300045049 | Ga0466959_0017235 | Ga0466959_0017235_2167_3324 | 385 |
| 353 | 3300045836 | Ga0466958_0041320 | Ga0466958_0041320_922_2079 | 385 |
| 354 | 3300045976 | Ga0466967_0019385 | Ga0466967_0019385_4045_5202 | 385 |
| 355 | 3300045976 | Ga0466967_0356707 | Ga0466967_0356707_217_1374 | 385 |
| 356 | 3300046537 | Ga0495598_0004155 | Ga0495598_0004155_635_1798 | 385 |
| 357 | 3300046539 | Ga0495621_0000406 | Ga0495621_0000406_6763_7926 | 385 |
| 358 | 3300046684 | Ga0495669_0012812 | Ga0495669_0012812_1953_3131 | 385 |
| 359 | 3300046691 | Ga0495670_0000148 | Ga0495670_0000148_23043_24206 | 385 |
| 360 | 3300048903 | Ga0496100_0001507 | Ga0496100_0001507_9233_10393 | 385 |
| 361 | 3300048903 | Ga0496100_0025602 | Ga0496100_0025602_861_2018 | 385 |
| 362 | 3300048904 | Ga0496101_0000216 | Ga0496101_0000216_30097_31257 | 385 |
| 363 | 3300048904 | Ga0496101_0015800 | Ga0496101_0015800_1616_2773 | 385 |
| 364 | 3300048904 | Ga0496101_0084017 | Ga0496101_0084017_484_1662 | 385 |
| 365 | 3300048908 | Ga0496105_0097673 | Ga0496105_0097673_749_1909 | 385 |
| 366 | 3300048909 | Ga0496106_0004559 | Ga0496106_0004559_2525_3685 | 385 |
| 367 | 3300048909 | Ga0496106_0036058 | Ga0496106_0036058_1391_2791 | 385 |
| 368 | 3300048910 | Ga0496107_0019478 | Ga0496107_0019478_1496_2656 | 385 |
| 369 | 3300048910 | Ga0496107_0071190 | Ga0496107_0071190_1050_2207 | 385 |
| 370 | 3300048911 | Ga0496108_0009355 | Ga0496108_0009355_2044_3204 | 385 |
| 371 | 3300048911 | Ga0496108_0019714 | Ga0496108_0019714_1340_2503 | 385 |
| 372 | 3300048912 | Ga0496109_0012766 | Ga0496109_0012766_1157_2317 | 385 |
| 373 | 3300048912 | Ga0496109_0236066 | Ga0496109_0236066_438_1595 | 385 |
| 374 | 3300048913 | Ga0496110_0000132 | Ga0496110_0000132_30973_32133 | 385 |
| 375 | 3300048913 | Ga0496110_0162918 | Ga0496110_0162918_101_1279 | 385 |
| 376 | 3300048914 | Ga0496111_0001206 | Ga0496111_0001206_6875_8035 | 385 |
| 377 | 3300048914 | Ga0496111_0016761 | Ga0496111_0016761_3515_4672 | 385 |
| 378 | 3300048914 | Ga0496111_0147060 | Ga0496111_0147060_357_1517 | 385 |
| 379 | 3300048915 | Ga0496112_0002404 | Ga0496112_0002404_1025_2185 | 385 |
| 380 | 3300048915 | Ga0496112_0037724 | Ga0496112_0037724_2124_3287 | 385 |
| 381 | 3300048916 | Ga0496113_0000182 | Ga0496113_0000182_7918_9078 | 385 |
| 382 | 3300048916 | Ga0496113_0012319 | Ga0496113_0012319_3323_4486 | 385 |
| 383 | 3300048917 | Ga0496114_0007521 | Ga0496114_0007521_4985_6142 | 385 |
| 384 | 3300048918 | Ga0496115_0000618 | Ga0496115_0000618_13266_14444 | 385 |
| 385 | 3300049585 | Ga0501069_0029794 | Ga0501069_0029794_600_1760 | 385 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qz9-assembly1.cif.gz_A-2 | the three dimensional structure of kynureninase from pseudomonas fluorescens | 0.8007 | 16 | 383 |
| 7cet-assembly1.cif.gz_A | crystal structure of d-cycloserine-bound form of cysteine desulfurase nifs from helicobacter pylori | 0.7987 | 17 | 383 |
| 7ceu-assembly1.cif.gz_A | crystal structure of l-cycloserine-bound form of cysteine desulfurase nifs from helicobacter pylori | 0.7973 | 17 | 383 |
| 1elu-assembly1.cif.gz_B | complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide. | 0.7947 | 11 | 385 |
| 5wt5-assembly1.cif.gz_A | l-homocysteine-bound nifs from helicobacter pylori | 0.7927 | 17 | 383 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1qz9A01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.8797 | 290 | 383 | 3.90.1150.10 |
| af_Q54Q04_346_448_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.853 | 285 | 381 | 3.90.1150.10 |
| af_Q18026_376_468_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.8209 | 302 | 381 | 3.90.1150.10 |
| af_Q60358_310_394_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.8143 | 297 | 385 | 3.90.1150.10 |
| 4isyD01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.8143 | 295 | 382 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4TR59-F1-model_v4 | Aminotransferase class V-fold PLP-dependent enzyme | 0.9898 | 265 | 385 |
GO:0005737
GO:0006569 GO:0009435 GO:0030170 GO:0030429 |
| AF-A0A3B0RAL8-F1-model_v4 | Cysteine desulfurase | 0.9828 | 292 | 385 |
GO:0005737
GO:0006569 GO:0009435 GO:0030170 GO:0030429 |
| AF-A0A6J4TR59-F1-model_v4 | Aminotransferase class V-fold PLP-dependent enzyme | 0.9818 | 265 | 385 |
GO:0005737
GO:0006569 GO:0009435 GO:0030170 GO:0030429 |
| AF-A0A519KQ54-F1-model_v4 | Aminotransferase class V-fold PLP-dependent enzyme | 0.9537 | 1 | 237 |
GO:0008483
|
| AF-A0A519KQ54-F1-model_v4 | Aminotransferase class V-fold PLP-dependent enzyme | 0.9498 | 1 | 237 |
GO:0008483
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar