F430226

General Info

Members Datasets Scaffolds Average Seq Length
385 170 770 174

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10296162|Ga0265338_102961622
Length 195
Sequence MSTAATRSRPGRDLVADVHAPTVVVACGALALHVKAIAARRGWAVDVRPVPPELHNRPERIRGAVEAAAAGDDVVVAYAHCGADLAGFERLEGAHCYEVYGAEHEPATYFLTDFLVRSFDRVVWRGLGLDRYPELRDDYFGNYERVVWLAQEPTPELRAGAQRAAAKLGLPLEVRDTGDTGLERALERLLGGRTC

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.13
Rhizosphere 89.87
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10296162 3300028800 Bacteria 1177
2 Ga0070680_100035447 3300005336 Bacteria 4028
3 Ga0070680_100127351 3300005336 Bacteria 2128
4 Ga0070680_100162712 3300005336 Bacteria 1876
5 Ga0070680_100502821 3300005336 Bacteria 1037
6 Ga0070682_100045070 3300005337 Bacteria 2732
7 Ga0070660_100003171 3300005339 Bacteria 11295
8 Ga0070660_100013820 3300005339 Bacteria 5807
9 Ga0070660_100059626 3300005339 Bacteria 2959
10 Ga0070660_100579210 3300005339 Bacteria 937
11 Ga0070661_100022454 3300005344 Bacteria 4518
12 Ga0070661_100218677 3300005344 Bacteria 1460
13 Ga0070661_100802420 3300005344 Bacteria 772
14 Ga0070671_100062344 3300005355 Bacteria 3105
15 Ga0070659_100118356 3300005366 Bacteria 2143
16 Ga0070659_100180164 3300005366 Bacteria 1734
17 Ga0070659_100246583 3300005366 Bacteria 1479
18 Ga0070709_10062320 3300005434 Bacteria 2377
19 Ga0070714_100098784 3300005435 Bacteria 2568
20 Ga0070714_100099674 3300005435 Bacteria 2557
21 Ga0070714_100128474 3300005435 Bacteria 2262
22 Ga0070714_100349342 3300005435 Bacteria 1389
23 Ga0070714_100488128 3300005435 Bacteria 1173
24 Ga0070713_100064043 3300005436 Bacteria 3084
25 Ga0070713_100083479 3300005436 Bacteria 2731
26 Ga0070713_100231843 3300005436 Bacteria 1678
27 Ga0070713_101936464 3300005436 Bacteria 572
28 Ga0070711_100009385 3300005439 Bacteria 6026
29 Ga0070705_100220105 3300005440 Bacteria 1314
30 Ga0070681_10006949 3300005458 Bacteria 11019
31 Ga0070681_10019048 3300005458 Bacteria 6870
32 Ga0070681_10200715 3300005458 Bacteria 1912
33 Ga0070681_10811922 3300005458 Bacteria 853
34 Ga0070706_100947020 3300005467 Bacteria 795
35 Ga0070707_100001997 3300005468 Bacteria 19526
36 Ga0070698_100249615 3300005471 Bacteria 1707
37 Ga0070699_100361503 3300005518 Bacteria 1309
38 Ga0070679_100099511 3300005530 Bacteria 2895
39 Ga0070679_100105703 3300005530 Bacteria 2801
40 Ga0070679_100310883 3300005530 Bacteria 1526
41 Ga0070679_100446128 3300005530 Bacteria 1239
42 Ga0070684_100113111 3300005535 Bacteria 2436
43 Ga0070684_100172875 3300005535 Bacteria 1962
44 Ga0070684_100180462 3300005535 Bacteria 1919
45 Ga0070697_100344728 3300005536 Bacteria 1286
46 Ga0068853_100493858 3300005539 Bacteria 1155
47 Ga0068853_100511995 3300005539 Bacteria 1134
48 Ga0068853_100711018 3300005539 Bacteria 959
49 Ga0070695_100167219 3300005545 Bacteria 1549
50 Ga0070693_100640415 3300005547 Bacteria 772
51 Ga0068855_100098263 3300005563 Bacteria 3373
52 Ga0068855_100178354 3300005563 Bacteria 2403
53 Ga0068855_100268586 3300005563 Bacteria 1897
54 Ga0068855_100630278 3300005563 Bacteria 1153
55 Ga0068857_100090361 3300005577 Bacteria 2740
56 Ga0068856_100384179 3300005614 Bacteria 1423
57 Ga0068852_100040291 3300005616 Bacteria 3940
58 Ga0068852_101102215 3300005616 Bacteria 814
59 Ga0070717_10005007 3300006028 Bacteria 9642
60 Ga0070717_10012836 3300006028 Bacteria 6397
61 Ga0070717_10278716 3300006028 Bacteria 1482
62 Ga0070716_100006033 3300006173 Bacteria 5904
63 Ga0070716_100250233 3300006173 Bacteria 1207
64 Ga0070712_100083872 3300006175 Bacteria 2315
65 Ga0075436_100688849 3300006914 Bacteria 757
66 Ga0105240_11440954 3300009093 Bacteria 723
67 Ga0105241_10387920 3300009174 Bacteria 1222
68 Ga0105238_10242842 3300009551 Bacteria 1779
69 Ga0105238_10331775 3300009551 Bacteria 1508
70 Ga0105239_10113895 3300010375 Bacteria 2999
71 Ga0157373_10119552 3300013100 Bacteria 1852
72 Ga0157373_10213219 3300013100 Bacteria 1362
73 Ga0157371_10835161 3300013102 Bacteria 696
74 Ga0157370_10104874 3300013104 Bacteria 2646
75 Ga0157370_10172476 3300013104 Bacteria 2010
76 Ga0157370_11279400 3300013104 Bacteria 661
77 Ga0157369_10299120 3300013105 Bacteria 1674
78 Ga0157369_10800676 3300013105 Bacteria 968
79 Ga0157374_10034742 3300013296 Bacteria 4608
80 Ga0157374_10183260 3300013296 Bacteria 2046
81 Ga0157372_10063908 3300013307 Bacteria 4129
82 Ga0157372_10338558 3300013307 Bacteria 1752
83 Ga0157372_10388194 3300013307 Bacteria 1627
84 Ga0163163_12328524 3300014325 Bacteria 594
85 Ga0182008_10342398 3300014497 Bacteria 791
86 Ga0182007_10119040 3300015262 Bacteria 883
87 Ga0206354_11088011 3300020081 Bacteria 887
88 Ga0206353_10513730 3300020082 Bacteria 1060
89 Ga0213871_10078214 3300021441 Bacteria 944
90 Ga0207692_10012015 3300025898 Bacteria 3708
91 Ga0207699_10261151 3300025906 Bacteria 1197
92 Ga0207705_10069702 3300025909 Bacteria 2547
93 Ga0207707_10016204 3300025912 Bacteria 6503
94 Ga0207707_10017510 3300025912 Bacteria 6247
95 Ga0207707_10123249 3300025912 Bacteria 2266
96 Ga0207707_10175842 3300025912 Bacteria 1870
97 Ga0207707_10635788 3300025912 Bacteria 901
98 Ga0207671_10108082 3300025914 Bacteria 2114
99 Ga0207693_10529588 3300025915 Unclassified 919
100 Ga0207693_10530155 3300025915 Bacteria 919
101 Ga0207660_10026134 3300025917 Bacteria 3973
102 Ga0207660_10219265 3300025917 Bacteria 1492
103 Ga0207660_10236826 3300025917 Bacteria 1437
104 Ga0207660_10239330 3300025917 Bacteria 1429
105 Ga0207660_10403848 3300025917 Bacteria 1100
106 Ga0207657_10002713 3300025919 Bacteria 19068
107 Ga0207657_10007643 3300025919 Bacteria 11062
108 Ga0207657_10034016 3300025919 Bacteria 4588
109 Ga0207649_10394274 3300025920 Bacteria 1034
110 Ga0207652_10022225 3300025921 Bacteria 5244
111 Ga0207652_10028296 3300025921 Bacteria 4676
112 Ga0207652_10691086 3300025921 Bacteria 911
113 Ga0207646_10000129 3300025922 Bacteria 102411
114 Ga0207646_10583734 3300025922 Bacteria 1004
115 Ga0207646_10892237 3300025922 Bacteria 789
116 Ga0207646_11378812 3300025922 Bacteria 614
117 Ga0207694_10548981 3300025924 Bacteria 970
118 Ga0207700_10018995 3300025928 Bacteria 4634
119 Ga0207700_10022236 3300025928 Bacteria 4347
120 Ga0207700_10109889 3300025928 Bacteria 2216
121 Ga0207700_10666734 3300025928 Bacteria 928
122 Ga0207700_10780252 3300025928 Bacteria 854
123 Ga0207664_10011982 3300025929 Bacteria 6189
124 Ga0207664_10084965 3300025929 Bacteria 2582
125 Ga0207664_10107427 3300025929 Bacteria 2315
126 Ga0207664_10193441 3300025929 Bacteria 1752
127 Ga0207664_10194014 3300025929 Bacteria 1750
128 Ga0207664_10357924 3300025929 Bacteria 1293
129 Ga0207664_10602885 3300025929 Bacteria 986
130 Ga0207664_10607208 3300025929 Bacteria 982
131 Ga0207690_10010939 3300025932 Bacteria 5410
132 Ga0207690_10552003 3300025932 Bacteria 937
133 Ga0207690_10570389 3300025932 Bacteria 922
134 Ga0207665_10000716 3300025939 Bacteria 22500
135 Ga0207665_10480649 3300025939 Bacteria 957
136 Ga0207665_10520712 3300025939 Unclassified 921
137 Ga0207665_10574467 3300025939 Bacteria 878
138 Ga0207661_10610641 3300025944 Bacteria 1001
139 Ga0207667_10115923 3300025949 Bacteria 2761
140 Ga0207667_10189745 3300025949 Bacteria 2109
141 Ga0207667_10283691 3300025949 Bacteria 1692
142 Ga0207640_10382646 3300025981 Bacteria 1140
143 Ga0207640_10533165 3300025981 Bacteria 983
144 Ga0207640_10540255 3300025981 Bacteria 977
145 Ga0207639_10474344 3300026041 Bacteria 1139
146 Ga0207639_10479095 3300026041 Bacteria 1134
147 Ga0207639_10775745 3300026041 Bacteria 892
148 Ga0207702_10657473 3300026078 Bacteria 1031
149 Ga0207702_10982054 3300026078 Unclassified 838
150 Ga0207674_10269692 3300026116 Bacteria 1649
151 Ga0207683_10142225 3300026121 Bacteria 2162
152 Ga0265319_1002034 3300028563 Bacteria 11381
153 Ga0265334_10002672 3300028573 Bacteria 8242
154 Ga0265318_10000251 3300028577 Bacteria 46650
155 Ga0265338_10002952 3300028800 Bacteria 24672
156 Ga0265330_10002704 3300031235 Bacteria 9574
157 Ga0265330_10083668 3300031235 Bacteria 1373
158 Ga0265332_10002233 3300031238 Bacteria 9930
159 Ga0265328_10002014 3300031239 Bacteria 9209
160 Ga0265320_10004306 3300031240 Bacteria 9354
161 Ga0265325_10000789 3300031241 Bacteria 22904
162 Ga0265325_10065241 3300031241 Bacteria 1839
163 Ga0265329_10008735 3300031242 Bacteria 3822
164 Ga0265340_10005385 3300031247 Bacteria 7106
165 Ga0265340_10032679 3300031247 Bacteria 2597
166 Ga0265339_10028627 3300031249 Bacteria 3166
167 Ga0265331_10017879 3300031250 Bacteria 3689
168 Ga0265331_10113863 3300031250 Bacteria 1239
169 Ga0265327_10005191 3300031251 Bacteria 11012
170 Ga0265316_10005945 3300031344 Bacteria 11750
171 Ga0265313_10004496 3300031595 Bacteria 10670
172 Ga0265313_10043126 3300031595 Bacteria 2210
173 Ga0265314_10026850 3300031711 Bacteria 4320
174 Ga0265314_10126949 3300031711 Bacteria 1596
175 Ga0265342_10175745 3300031712 Bacteria 1175
176 Ga0373934_0129298 3300035086 Bacteria 1030
177 Ga0373956_0107075 3300035119 Bacteria 1300
178 Ga0373946_0458862 3300035171 Bacteria 650
179 Ga0373924_0088813 3300035410 Bacteria 1321
180 Ga0373931_0136471 3300035691 Bacteria 1417
181 Ga0373937_0022990 3300036401 Bacteria 5606
182 Ga0373937_0502408 3300036401 Bacteria 1152
183 Ga0395899_0032809 3300037312 Bacteria 3902
184 Ga0395899_0310571 3300037312 Bacteria 1065
185 Ga0395900_0013630 3300037418 Bacteria 8301
186 Ga0395900_0136861 3300037418 Bacteria 2509
187 Ga0395900_0239535 3300037418 Bacteria 1821
188 Ga0395898_0169885 3300037466 Bacteria 2084
189 Ga0395898_0551478 3300037466 Bacteria 1095
190 Ga0395905_0063089 3300037471 Bacteria 3466
191 Ga0395905_0177718 3300037471 Bacteria 1998
192 Ga0395901_0153682 3300038443 Bacteria 2417
193 Ga0395901_0178723 3300038443 Bacteria 2225
194 Ga0395901_0468254 3300038443 Bacteria 1287
195 Ga0436360_0155124 3300039438 Bacteria 969
196 Ga0466969_0032349 3300044656 Bacteria 2659
197 Ga0466965_0034713 3300044683 Bacteria 2468
198 Ga0466966_0099258 3300044684 Bacteria 1802
199 Ga0466966_0533225 3300044684 Unclassified 706
200 Ga0466961_0025449 3300044693 Bacteria 3805
201 Ga0466961_0058181 3300044693 Bacteria 2459
202 Ga0466961_0119714 3300044693 Bacteria 1653
203 Ga0466961_0474094 3300044693 Bacteria 757
204 Ga0466961_0501231 3300044693 Bacteria 733
205 Ga0466963_0000133 3300044694 Bacteria 28504
206 Ga0466963_0002053 3300044694 Bacteria 11101
207 Ga0466963_0003921 3300044694 Bacteria 8603
208 Ga0466963_0015407 3300044694 Bacteria 4733
209 Ga0466963_0039143 3300044694 Bacteria 3104
210 Ga0466963_0041324 3300044694 Bacteria 3024
211 Ga0466963_0047012 3300044694 Bacteria 2847
212 Ga0466963_0074597 3300044694 Bacteria 2288
213 Ga0466963_0079495 3300044694 Bacteria 2218
214 Ga0466963_0104653 3300044694 Bacteria 1939
215 Ga0466963_0478312 3300044694 Bacteria 879
216 Ga0466963_0587550 3300044694 Unclassified 786
217 Ga0466963_0824423 3300044694 Unclassified 654
218 Ga0466964_0002128 3300044706 Bacteria 6982
219 Ga0466964_0022245 3300044706 Bacteria 2458
220 Ga0466964_0041981 3300044706 Bacteria 1852
221 Ga0466964_0624572 3300044706 Bacteria 593
222 Ga0453684_1169913 3300044712 Unclassified 809
223 Ga0466971_0000495 3300044719 Bacteria 15481
224 Ga0466971_0004527 3300044719 Bacteria 6009
225 Ga0466971_0034863 3300044719 Bacteria 2256
226 Ga0466971_0040911 3300044719 Bacteria 2082
227 Ga0466968_0001536 3300044735 Bacteria 8296
228 Ga0466968_0004375 3300044735 Bacteria 5277
229 Ga0466968_0008147 3300044735 Bacteria 4007
230 Ga0466968_0040020 3300044735 Bacteria 1975
231 Ga0466968_0249600 3300044735 Bacteria 842
232 Ga0466968_0315798 3300044735 Unclassified 754
233 Ga0466970_0027654 3300044765 Bacteria 2976
234 Ga0466957_0000762 3300044842 Bacteria 16399
235 Ga0466957_0000936 3300044842 Bacteria 14934
236 Ga0466957_0005777 3300044842 Bacteria 6953
237 Ga0466957_0033011 3300044842 Bacteria 3103
238 Ga0466957_0035925 3300044842 Bacteria 2976
239 Ga0466957_0049275 3300044842 Bacteria 2561
240 Ga0466957_0531607 3300044842 Bacteria 818
241 Ga0466957_0591529 3300044842 Bacteria 776
242 Ga0466960_0069543 3300044901 Bacteria 1749
243 Ga0466960_0221425 3300044901 Bacteria 1042
244 Ga0466959_0002292 3300045049 Bacteria 12203
245 Ga0466959_0011933 3300045049 Bacteria 6263
246 Ga0466959_0060393 3300045049 Bacteria 2758
247 Ga0466959_0425549 3300045049 Bacteria 901
248 Ga0466958_0000461 3300045836 Bacteria 16966
249 Ga0466958_0002359 3300045836 Bacteria 9450
250 Ga0466958_0013532 3300045836 Bacteria 4646
251 Ga0466958_0079744 3300045836 Bacteria 2013
252 Ga0466958_0104887 3300045836 Bacteria 1761
253 Ga0466958_0157759 3300045836 Bacteria 1432
254 Ga0466958_0211896 3300045836 Bacteria 1235
255 Ga0466958_0251175 3300045836 Bacteria 1131
256 Ga0466958_0442922 3300045836 Bacteria 841
257 Ga0466967_0002499 3300045976 Bacteria 11484
258 Ga0466967_0008244 3300045976 Bacteria 7610
259 Ga0466967_0029742 3300045976 Bacteria 4576
260 Ga0466967_0047243 3300045976 Bacteria 3752
261 Ga0466967_0053356 3300045976 Bacteria 3552
262 Ga0466967_0062485 3300045976 Bacteria 3306
263 Ga0466967_0072109 3300045976 Bacteria 3095
264 Ga0466967_0094894 3300045976 Bacteria 2717
265 Ga0466967_0111929 3300045976 Bacteria 2509
266 Ga0466967_0118108 3300045976 Bacteria 2446
267 Ga0466967_0158272 3300045976 Bacteria 2124
268 Ga0466967_0183585 3300045976 Bacteria 1974
269 Ga0466967_0185982 3300045976 Bacteria 1961
270 Ga0466967_0222775 3300045976 Bacteria 1793
271 Ga0466967_0227031 3300045976 Bacteria 1776
272 Ga0466967_0251670 3300045976 Bacteria 1688
273 Ga0466967_0268029 3300045976 Bacteria 1635
274 Ga0466967_0778498 3300045976 Bacteria 949
275 Ga0495592_0182430 3300046454 Bacteria 1428
276 Ga0495592_0591344 3300046454 Bacteria 678
277 Ga0495629_0377986 3300046459 Bacteria 964
278 Ga0495629_0485235 3300046459 Bacteria 834
279 Ga0495641_0071031 3300046461 Bacteria 1563
280 Ga0495651_0223568 3300046462 Bacteria 1301
281 Ga0495653_0061989 3300046463 Bacteria 2827
282 Ga0495653_0106826 3300046463 Bacteria 2018
283 Ga0495653_0135818 3300046463 Bacteria 1735
284 Ga0495582_0099477 3300046473 Bacteria 1628
285 Ga0495664_0444547 3300046477 Unclassified 776
286 Ga0495608_0009612 3300046511 Bacteria 6749
287 Ga0495608_0093210 3300046511 Bacteria 1946
288 Ga0495608_0200239 3300046511 Bacteria 1258
289 Ga0495618_0229646 3300046514 Bacteria 1169
290 Ga0495618_0253514 3300046514 Bacteria 1103
291 Ga0495618_0382443 3300046514 Bacteria 863
292 Ga0495628_0060226 3300046516 Bacteria 2979
293 Ga0495630_0128017 3300046517 Bacteria 1927
294 Ga0495652_0183092 3300046529 Bacteria 1605
295 Ga0495652_0385324 3300046529 Bacteria 996
296 Ga0495640_0196417 3300046533 Bacteria 1281
297 Ga0495640_0636814 3300046533 Bacteria 642
298 Ga0495587_0115589 3300046536 Bacteria 1539
299 Ga0495645_0135582 3300046543 Bacteria 1722
300 Ga0495667_0023715 3300046559 Bacteria 4133
301 Ga0495667_0287492 3300046559 Bacteria 1043
302 Ga0495634_0081308 3300046642 Bacteria 2119
303 Ga0495635_0062828 3300046663 Bacteria 2550
304 Ga0495635_0099974 3300046663 Bacteria 1982
305 Ga0495657_0004405 3300046675 Bacteria 11240
306 Ga0495657_0072738 3300046675 Bacteria 2241
307 Ga0495599_0183341 3300046678 Bacteria 1289
308 Ga0495646_0263484 3300046680 Bacteria 920
309 Ga0495646_0276720 3300046680 Bacteria 893
310 Ga0495647_0226787 3300046681 Bacteria 826
311 Ga0495613_0182482 3300046689 Bacteria 1486
312 Ga0495613_0291002 3300046689 Bacteria 1132
313 Ga0495600_0064667 3300046809 Bacteria 2391
314 Ga0495604_0282461 3300047317 Bacteria 1121
315 Ga0495674_0222083 3300047319 Bacteria 1561
316 Ga0495674_0576178 3300047319 Bacteria 894
317 Ga0495674_0685175 3300047319 Bacteria 805
318 Ga0495676_0204140 3300047321 Bacteria 1372
319 Ga0495680_0024199 3300047322 Bacteria 5039
320 Ga0495680_0101610 3300047322 Bacteria 2142
321 Ga0495680_0117470 3300047322 Bacteria 1966
322 Ga0495675_0194000 3300047444 Bacteria 1239
323 Ga0495684_0228843 3300047471 Bacteria 1360
324 Ga0495684_0359530 3300047471 Bacteria 1031
325 Ga0495593_0052140 3300047673 Bacteria 2163
326 Ga0495602_0150776 3300048088 Bacteria 1828
327 Ga0495602_0229844 3300048088 Bacteria 1394
328 Ga0496100_0105489 3300048903 Bacteria 1949
329 Ga0496101_0443584 3300048904 Bacteria 1024
330 Ga0496101_0602244 3300048904 Archaea 869
331 Ga0496102_0012033 3300048905 Bacteria 7477
332 Ga0496102_0977389 3300048905 Bacteria 767
333 Ga0496102_1017639 3300048905 Bacteria 749
334 Ga0496104_0015678 3300048907 Bacteria 6872
335 Ga0496104_0194914 3300048907 Bacteria 1938
336 Ga0496104_0585092 3300048907 Bacteria 1026
337 Ga0496105_0016862 3300048908 Bacteria 5842
338 Ga0496106_0011653 3300048909 Bacteria 6497
339 Ga0496107_0594861 3300048910 Bacteria 818
340 Ga0496108_0041929 3300048911 Bacteria 3820
341 Ga0496108_0290861 3300048911 Bacteria 1422
342 Ga0496108_0506258 3300048911 Bacteria 1054
343 Ga0496108_0530861 3300048911 Bacteria 1027
344 Ga0496108_0656002 3300048911 Unclassified 912
345 Ga0496109_0010181 3300048912 Bacteria 8027
346 Ga0496109_0010930 3300048912 Bacteria 7777
347 Ga0496109_0539408 3300048912 Bacteria 1100
348 Ga0496109_0667073 3300048912 Bacteria 977
349 Ga0496110_0029151 3300048913 Bacteria 4747
350 Ga0496110_0265271 3300048913 Bacteria 1563
351 Ga0496110_0442086 3300048913 Bacteria 1185
352 Ga0496111_0027407 3300048914 Bacteria 4030
353 Ga0496111_0145194 3300048914 Bacteria 1759
354 Ga0496111_0314560 3300048914 Archaea 1160
355 Ga0496112_0039947 3300048915 Bacteria 4586
356 Ga0496112_0128175 3300048915 Bacteria 2508
357 Ga0496112_0148608 3300048915 Bacteria 2311
358 Ga0496112_0533649 3300048915 Bacteria 1108
359 Ga0496112_0717546 3300048915 Unclassified 927
360 Ga0496113_0277836 3300048916 Bacteria 1339
361 Ga0496113_0302587 3300048916 Bacteria 1280
362 Ga0496114_0003930 3300048917 Bacteria 11461
363 Ga0496114_0233892 3300048917 Bacteria 1615
364 Ga0496115_0008300 3300048918 Bacteria 7677
365 Ga0496115_0013039 3300048918 Bacteria 6274
366 Ga0496115_0276660 3300048918 Bacteria 1378
367 Ga0501067_0008981 3300049583 Bacteria 5540
368 Ga0501067_0192437 3300049583 Bacteria 1136
369 Ga0501069_0126945 3300049585 Bacteria 1459
370 Ga0501069_0168971 3300049585 Bacteria 1261
371 nmdc:mga08x19_509186_c1 3300050514 Bacteria 850
372 Ga0495601_0414657 3300053077 Bacteria 872
373 Ga0495601_0521663 3300053077 Unclassified 765
374 Ga0495612_0032220 3300053078 Bacteria 2117
375 Ga0495612_0040537 3300053078 Bacteria 1897
376 Ga0495595_0027304 3300053084 Bacteria 2543
377 Ga0495619_0008813 3300053085 Bacteria 6380
378 Ga0495619_0022963 3300053085 Bacteria 3994
379 Ga0495619_0203167 3300053085 Bacteria 1372
380 Ga0495619_0384873 3300053085 Bacteria 969
381 Ga0495619_0502314 3300053085 Bacteria 834
382 Ga0466962_0000151 3300061719 Bacteria 28962
383 Ga0466962_0002813 3300061719 Bacteria 8283
384 Ga0466962_0039951 3300061719 Bacteria 2246
385 Ga0530510_0666822 3300061734 Bacteria 792
386 Ga0265338_10296162
387 Ga0070680_100035447
388 Ga0070680_100127351
389 Ga0070680_100162712
390 Ga0070680_100502821
391 Ga0070682_100045070
392 Ga0070660_100003171
393 Ga0070660_100013820
394 Ga0070660_100059626
395 Ga0070660_100579210
396 Ga0070661_100022454
397 Ga0070661_100218677
398 Ga0070661_100802420
399 Ga0070671_100062344
400 Ga0070659_100118356
401 Ga0070659_100180164
402 Ga0070659_100246583
403 Ga0070709_10062320
404 Ga0070714_100098784
405 Ga0070714_100099674
406 Ga0070714_100128474
407 Ga0070714_100349342
408 Ga0070714_100488128
409 Ga0070713_100064043
410 Ga0070713_100083479
411 Ga0070713_100231843
412 Ga0070713_101936464
413 Ga0070711_100009385
414 Ga0070705_100220105
415 Ga0070681_10006949
416 Ga0070681_10019048
417 Ga0070681_10200715
418 Ga0070681_10811922
419 Ga0070706_100947020
420 Ga0070707_100001997
421 Ga0070698_100249615
422 Ga0070699_100361503
423 Ga0070679_100099511
424 Ga0070679_100105703
425 Ga0070679_100310883
426 Ga0070679_100446128
427 Ga0070684_100113111
428 Ga0070684_100172875
429 Ga0070684_100180462
430 Ga0070697_100344728
431 Ga0068853_100493858
432 Ga0068853_100511995
433 Ga0068853_100711018
434 Ga0070695_100167219
435 Ga0070693_100640415
436 Ga0068855_100098263
437 Ga0068855_100178354
438 Ga0068855_100268586
439 Ga0068855_100630278
440 Ga0068857_100090361
441 Ga0068856_100384179
442 Ga0068852_100040291
443 Ga0068852_101102215
444 Ga0070717_10005007
445 Ga0070717_10012836
446 Ga0070717_10278716
447 Ga0070716_100006033
448 Ga0070716_100250233
449 Ga0070712_100083872
450 Ga0075436_100688849
451 Ga0105240_11440954
452 Ga0105241_10387920
453 Ga0105238_10242842
454 Ga0105238_10331775
455 Ga0105239_10113895
456 Ga0157373_10119552
457 Ga0157373_10213219
458 Ga0157371_10835161
459 Ga0157370_10104874
460 Ga0157370_10172476
461 Ga0157370_11279400
462 Ga0157369_10299120
463 Ga0157369_10800676
464 Ga0157374_10034742
465 Ga0157374_10183260
466 Ga0157372_10063908
467 Ga0157372_10338558
468 Ga0157372_10388194
469 Ga0163163_12328524
470 Ga0182008_10342398
471 Ga0182007_10119040
472 Ga0206354_11088011
473 Ga0206353_10513730
474 Ga0213871_10078214
475 Ga0207692_10012015
476 Ga0207699_10261151
477 Ga0207705_10069702
478 Ga0207707_10016204
479 Ga0207707_10017510
480 Ga0207707_10123249
481 Ga0207707_10175842
482 Ga0207707_10635788
483 Ga0207671_10108082
484 Ga0207693_10529588
485 Ga0207693_10530155
486 Ga0207660_10026134
487 Ga0207660_10219265
488 Ga0207660_10236826
489 Ga0207660_10239330
490 Ga0207660_10403848
491 Ga0207657_10002713
492 Ga0207657_10007643
493 Ga0207657_10034016
494 Ga0207649_10394274
495 Ga0207652_10022225
496 Ga0207652_10028296
497 Ga0207652_10691086
498 Ga0207646_10000129
499 Ga0207646_10583734
500 Ga0207646_10892237
501 Ga0207646_11378812
502 Ga0207694_10548981
503 Ga0207700_10018995
504 Ga0207700_10022236
505 Ga0207700_10109889
506 Ga0207700_10666734
507 Ga0207700_10780252
508 Ga0207664_10011982
509 Ga0207664_10084965
510 Ga0207664_10107427
511 Ga0207664_10193441
512 Ga0207664_10194014
513 Ga0207664_10357924
514 Ga0207664_10602885
515 Ga0207664_10607208
516 Ga0207690_10010939
517 Ga0207690_10552003
518 Ga0207690_10570389
519 Ga0207665_10000716
520 Ga0207665_10480649
521 Ga0207665_10520712
522 Ga0207665_10574467
523 Ga0207661_10610641
524 Ga0207667_10115923
525 Ga0207667_10189745
526 Ga0207667_10283691
527 Ga0207640_10382646
528 Ga0207640_10533165
529 Ga0207640_10540255
530 Ga0207639_10474344
531 Ga0207639_10479095
532 Ga0207639_10775745
533 Ga0207702_10657473
534 Ga0207702_10982054
535 Ga0207674_10269692
536 Ga0207683_10142225
537 Ga0265319_1002034
538 Ga0265334_10002672
539 Ga0265318_10000251
540 Ga0265338_10002952
541 Ga0265330_10002704
542 Ga0265330_10083668
543 Ga0265332_10002233
544 Ga0265328_10002014
545 Ga0265320_10004306
546 Ga0265325_10000789
547 Ga0265325_10065241
548 Ga0265329_10008735
549 Ga0265340_10005385
550 Ga0265340_10032679
551 Ga0265339_10028627
552 Ga0265331_10017879
553 Ga0265331_10113863
554 Ga0265327_10005191
555 Ga0265316_10005945
556 Ga0265313_10004496
557 Ga0265313_10043126
558 Ga0265314_10026850
559 Ga0265314_10126949
560 Ga0265342_10175745
561 Ga0373934_0129298
562 Ga0373956_0107075
563 Ga0373946_0458862
564 Ga0373924_0088813
565 Ga0373931_0136471
566 Ga0373937_0022990
567 Ga0373937_0502408
568 Ga0395899_0032809
569 Ga0395899_0310571
570 Ga0395900_0013630
571 Ga0395900_0136861
572 Ga0395900_0239535
573 Ga0395898_0169885
574 Ga0395898_0551478
575 Ga0395905_0063089
576 Ga0395905_0177718
577 Ga0395901_0153682
578 Ga0395901_0178723
579 Ga0395901_0468254
580 Ga0436360_0155124
581 Ga0466969_0032349
582 Ga0466965_0034713
583 Ga0466966_0099258
584 Ga0466966_0533225
585 Ga0466961_0025449
586 Ga0466961_0058181
587 Ga0466961_0119714
588 Ga0466961_0474094
589 Ga0466961_0501231
590 Ga0466963_0000133
591 Ga0466963_0002053
592 Ga0466963_0003921
593 Ga0466963_0015407
594 Ga0466963_0039143
595 Ga0466963_0041324
596 Ga0466963_0047012
597 Ga0466963_0074597
598 Ga0466963_0079495
599 Ga0466963_0104653
600 Ga0466963_0478312
601 Ga0466963_0587550
602 Ga0466963_0824423
603 Ga0466964_0002128
604 Ga0466964_0022245
605 Ga0466964_0041981
606 Ga0466964_0624572
607 Ga0453684_1169913
608 Ga0466971_0000495
609 Ga0466971_0004527
610 Ga0466971_0034863
611 Ga0466971_0040911
612 Ga0466968_0001536
613 Ga0466968_0004375
614 Ga0466968_0008147
615 Ga0466968_0040020
616 Ga0466968_0249600
617 Ga0466968_0315798
618 Ga0466970_0027654
619 Ga0466957_0000762
620 Ga0466957_0000936
621 Ga0466957_0005777
622 Ga0466957_0033011
623 Ga0466957_0035925
624 Ga0466957_0049275
625 Ga0466957_0531607
626 Ga0466957_0591529
627 Ga0466960_0069543
628 Ga0466960_0221425
629 Ga0466959_0002292
630 Ga0466959_0011933
631 Ga0466959_0060393
632 Ga0466959_0425549
633 Ga0466958_0000461
634 Ga0466958_0002359
635 Ga0466958_0013532
636 Ga0466958_0079744
637 Ga0466958_0104887
638 Ga0466958_0157759
639 Ga0466958_0211896
640 Ga0466958_0251175
641 Ga0466958_0442922
642 Ga0466967_0002499
643 Ga0466967_0008244
644 Ga0466967_0029742
645 Ga0466967_0047243
646 Ga0466967_0053356
647 Ga0466967_0062485
648 Ga0466967_0072109
649 Ga0466967_0094894
650 Ga0466967_0111929
651 Ga0466967_0118108
652 Ga0466967_0158272
653 Ga0466967_0183585
654 Ga0466967_0185982
655 Ga0466967_0222775
656 Ga0466967_0227031
657 Ga0466967_0251670
658 Ga0466967_0268029
659 Ga0466967_0778498
660 Ga0495592_0182430
661 Ga0495592_0591344
662 Ga0495629_0377986
663 Ga0495629_0485235
664 Ga0495641_0071031
665 Ga0495651_0223568
666 Ga0495653_0061989
667 Ga0495653_0106826
668 Ga0495653_0135818
669 Ga0495582_0099477
670 Ga0495664_0444547
671 Ga0495608_0009612
672 Ga0495608_0093210
673 Ga0495608_0200239
674 Ga0495618_0229646
675 Ga0495618_0253514
676 Ga0495618_0382443
677 Ga0495628_0060226
678 Ga0495630_0128017
679 Ga0495652_0183092
680 Ga0495652_0385324
681 Ga0495640_0196417
682 Ga0495640_0636814
683 Ga0495587_0115589
684 Ga0495645_0135582
685 Ga0495667_0023715
686 Ga0495667_0287492
687 Ga0495634_0081308
688 Ga0495635_0062828
689 Ga0495635_0099974
690 Ga0495657_0004405
691 Ga0495657_0072738
692 Ga0495599_0183341
693 Ga0495646_0263484
694 Ga0495646_0276720
695 Ga0495647_0226787
696 Ga0495613_0182482
697 Ga0495613_0291002
698 Ga0495600_0064667
699 Ga0495604_0282461
700 Ga0495674_0222083
701 Ga0495674_0576178
702 Ga0495674_0685175
703 Ga0495676_0204140
704 Ga0495680_0024199
705 Ga0495680_0101610
706 Ga0495680_0117470
707 Ga0495675_0194000
708 Ga0495684_0228843
709 Ga0495684_0359530
710 Ga0495593_0052140
711 Ga0495602_0150776
712 Ga0495602_0229844
713 Ga0496100_0105489
714 Ga0496101_0443584
715 Ga0496101_0602244
716 Ga0496102_0012033
717 Ga0496102_0977389
718 Ga0496102_1017639
719 Ga0496104_0015678
720 Ga0496104_0194914
721 Ga0496104_0585092
722 Ga0496105_0016862
723 Ga0496106_0011653
724 Ga0496107_0594861
725 Ga0496108_0041929
726 Ga0496108_0290861
727 Ga0496108_0506258
728 Ga0496108_0530861
729 Ga0496108_0656002
730 Ga0496109_0010181
731 Ga0496109_0010930
732 Ga0496109_0539408
733 Ga0496109_0667073
734 Ga0496110_0029151
735 Ga0496110_0265271
736 Ga0496110_0442086
737 Ga0496111_0027407
738 Ga0496111_0145194
739 Ga0496111_0314560
740 Ga0496112_0039947
741 Ga0496112_0128175
742 Ga0496112_0148608
743 Ga0496112_0533649
744 Ga0496112_0717546
745 Ga0496113_0277836
746 Ga0496113_0302587
747 Ga0496114_0003930
748 Ga0496114_0233892
749 Ga0496115_0008300
750 Ga0496115_0013039
751 Ga0496115_0276660
752 Ga0501067_0008981
753 Ga0501067_0192437
754 Ga0501069_0126945
755 Ga0501069_0168971
756 nmdc:mga08x19_509186_c1
757 Ga0495601_0414657
758 Ga0495601_0521663
759 Ga0495612_0032220
760 Ga0495612_0040537
761 Ga0495595_0027304
762 Ga0495619_0008813
763 Ga0495619_0022963
764 Ga0495619_0203167
765 Ga0495619_0384873
766 Ga0495619_0502314
767 Ga0466962_0000151
768 Ga0466962_0002813
769 Ga0466962_0039951
770 Ga0530510_0666822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07796

DUF1638

Protein of unknown function (DUF1638)

49

186

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yqe-assembly1.cif.gz_A crystal structure of conserved protein of unknown function af0625 0.7204 119 150
4p4l-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis shikimate dehydrogenase 0.6744 115 151
7d73-assembly1.cif.gz_F cryo-em structure of gmppa/gmppb complex bound to gtp (state i) 0.6549 109 151
7d74-assembly1.cif.gz_G cryo-em structure of gmppa/gmppb complex bound to gtp (state ii) 0.6494 108 150
2wzg-assembly1.cif.gz_A legionella glucosyltransferase (lgt1) crystal structure 0.6449 110 150
ID Description Score Start End Superfamily
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.6699 108 152 3.90.550.10
af_P32961_18_309_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.6603 106 150 3.60.110.10
af_O74468_2_146_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6423 123 150 3.40.50.720
af_Q943F5_38_417_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6399 119 151 3.80.10.10
af_P9WGA9_216_390_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.613 122 156 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A527FEB8-F1-model_v4 DUF1638 domain-containing protein 0.9632 90 154
AF-A0A6N8W5L9-F1-model_v4 DUF1638 domain-containing protein 0.9317 64 170
AF-A0A536P5E2-F1-model_v4 DUF1638 domain-containing protein 0.9009 67 168
AF-A0A527FEB8-F1-model_v4 DUF1638 domain-containing protein 0.8967 90 154
AF-A0A7V9G0W7-F1-model_v4 DUF1638 domain-containing protein 0.8895 1 170

Map