F430207

General Info

Members Datasets Scaffolds Average Seq Length
385 227 770 193

Family's Representative Sequence

Representative Sequence 3300025885|Ga0207653_10030670|Ga0207653_100306702
Length 233
Sequence VTSGKPRRTSRAGAPWRKRALVGREARAALRSVGLRSQDRDLNIVGLLLAAGSATRFGSDKLSHRLPHGVPIAVQAARHLRAVVPNVFAVVKPGTGNLIPVLEKEGCRIVVCEQAAEGMGASLACGARAAGQAEGYLVALADMPFVRTASIAAVRDALAAGAPLAAPYWRARRGHPVGISGVFFERLLACGGDEGAKGLLTENEKRLVKIPVGDPGVLRDIDTPGDLAPPLNV

Samples

Sample ID Description Type Environment
1 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
168 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
172 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.74
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207653_10030670 3300025885 Bacteria 1735
2 Ga0070676_10306036 3300005328 Bacteria 1079
3 Ga0070676_10606591 3300005328 Bacteria 790
4 Ga0070683_100033494 3300005329 Bacteria 4685
5 Ga0070690_100000156 3300005330 Bacteria 34929
6 Ga0070690_100009992 3300005330 Bacteria 5510
7 Ga0068869_100000023 3300005334 Bacteria 64701
8 Ga0068869_100018077 3300005334 Bacteria 4792
9 Ga0068869_100083739 3300005334 Bacteria 2386
10 Ga0070680_100001770 3300005336 Bacteria 15858
11 Ga0070682_100008351 3300005337 Bacteria 5839
12 Ga0068868_100004876 3300005338 Bacteria 9418
13 Ga0070689_100001214 3300005340 Bacteria 16335
14 Ga0070691_10014079 3300005341 Bacteria 3668
15 Ga0070687_100000137 3300005343 Bacteria 25207
16 Ga0070687_100338688 3300005343 Bacteria 967
17 Ga0070692_10006200 3300005345 Bacteria 5173
18 Ga0070692_10149373 3300005345 Bacteria 1329
19 Ga0070692_10545747 3300005345 Bacteria 758
20 Ga0070668_100008846 3300005347 Bacteria 7475
21 Ga0070669_100016082 3300005353 Bacteria 5336
22 Ga0070675_100045463 3300005354 Bacteria 3593
23 Ga0070675_100059954 3300005354 Bacteria 3141
24 Ga0070671_100440507 3300005355 Bacteria 1117
25 Ga0070674_100081562 3300005356 Bacteria 2312
26 Ga0070674_100211756 3300005356 Bacteria 1502
27 Ga0070674_100223324 3300005356 Bacteria 1466
28 Ga0070673_100053543 3300005364 Bacteria 3170
29 Ga0070703_10036201 3300005406 Bacteria 1515
30 Ga0070703_10120870 3300005406 Bacteria 950
31 Ga0070710_10077905 3300005437 Bacteria 1927
32 Ga0070701_10002554 3300005438 Bacteria 7046
33 Ga0070705_100000063 3300005440 Bacteria 56043
34 Ga0070705_100034411 3300005440 Bacteria 2832
35 Ga0070700_100001074 3300005441 Bacteria 13564
36 Ga0070700_100007241 3300005441 Bacteria 5980
37 Ga0070694_100002576 3300005444 Bacteria 10712
38 Ga0070694_100009787 3300005444 Bacteria 5888
39 Ga0070694_100086239 3300005444 Bacteria 2193
40 Ga0070694_100481693 3300005444 Bacteria 985
41 Ga0070681_10002398 3300005458 Bacteria 17121
42 Ga0070681_10075193 3300005458 Bacteria 3338
43 Ga0068867_100003670 3300005459 Bacteria 10803
44 Ga0068867_100005122 3300005459 Bacteria 9262
45 Ga0068867_100051124 3300005459 Bacteria 3047
46 Ga0068867_100116709 3300005459 Bacteria 2057
47 Ga0070706_100294258 3300005467 Unclassified 1515
48 Ga0070707_101104612 3300005468 Bacteria 759
49 Ga0070698_100374130 3300005471 Bacteria 1357
50 Ga0070679_100002398 3300005530 Bacteria 16988
51 Ga0070679_100111806 3300005530 Bacteria 2718
52 Ga0070684_100009357 3300005535 Bacteria 7714
53 Ga0070697_100587873 3300005536 Bacteria 978
54 Ga0068853_100620185 3300005539 Bacteria 1028
55 Ga0070686_100001234 3300005544 Bacteria 14535
56 Ga0070695_100000807 3300005545 Bacteria 16832
57 Ga0070695_100040414 3300005545 Bacteria 2952
58 Ga0070695_100151991 3300005545 Bacteria 1616
59 Ga0070696_100001092 3300005546 Bacteria 17534
60 Ga0070696_100001215 3300005546 Bacteria 16730
61 Ga0070696_100038587 3300005546 Bacteria 3297
62 Ga0070693_100000094 3300005547 Bacteria 38543
63 Ga0070704_100000025 3300005549 Bacteria 49670
64 Ga0070704_100002799 3300005549 Bacteria 9872
65 Ga0070704_100540714 3300005549 Bacteria 1017
66 Ga0070704_100700513 3300005549 Bacteria 898
67 Ga0068855_100001759 3300005563 Bacteria 27056
68 Ga0068855_100613682 3300005563 Bacteria 1172
69 Ga0068854_100002888 3300005578 Bacteria 10690
70 Ga0068856_100059932 3300005614 Bacteria 3760
71 Ga0068856_100161453 3300005614 Bacteria 2251
72 Ga0070702_100000044 3300005615 Bacteria 33777
73 Ga0070702_100352484 3300005615 Bacteria 1037
74 Ga0068859_100014121 3300005617 Bacteria 8010
75 Ga0068859_100060880 3300005617 Bacteria 3804
76 Ga0068866_10000751 3300005718 Bacteria 14635
77 Ga0068861_100003380 3300005719 Bacteria 10581
78 Ga0068861_100005136 3300005719 Bacteria 8826
79 Ga0068863_100265061 3300005841 Bacteria 1662
80 Ga0068863_100641385 3300005841 Bacteria 1053
81 Ga0068858_100005037 3300005842 Bacteria 12950
82 Ga0068858_100593498 3300005842 Bacteria 1074
83 Ga0068860_100048893 3300005843 Bacteria 4030
84 Ga0068860_100164045 3300005843 Bacteria 2144
85 Ga0068860_100411845 3300005843 Bacteria 1339
86 Ga0068862_100000320 3300005844 Bacteria 52171
87 Ga0068862_100034361 3300005844 Bacteria 4289
88 Ga0068862_100330469 3300005844 Bacteria 1409
89 Ga0068862_100746949 3300005844 Bacteria 951
90 Ga0097621_100000206 3300006237 Bacteria 38579
91 Ga0097621_100020478 3300006237 Bacteria 5096
92 Ga0068871_100005497 3300006358 Bacteria 8889
93 Ga0075428_100000107 3300006844 Bacteria 70381
94 Ga0075428_100316123 3300006844 Bacteria 1678
95 Ga0075428_100417950 3300006844 Bacteria 1437
96 Ga0075430_100060804 3300006846 Bacteria 3175
97 Ga0075430_100135689 3300006846 Bacteria 2050
98 Ga0075430_100322976 3300006846 Bacteria 1276
99 Ga0075431_100220018 3300006847 Bacteria 1937
100 Ga0075433_10004334 3300006852 Bacteria 11023
101 Ga0075434_100000151 3300006871 Bacteria 42872
102 Ga0075434_100668015 3300006871 Bacteria 1057
103 Ga0075429_100204201 3300006880 Bacteria 1731
104 Ga0075429_100431272 3300006880 Bacteria 1155
105 Ga0075429_100622749 3300006880 Bacteria 945
106 Ga0068865_100003493 3300006881 Bacteria 9420
107 Ga0068865_100007796 3300006881 Bacteria 6603
108 Ga0068865_100033324 3300006881 Bacteria 3448
109 Ga0075436_100008982 3300006914 Bacteria 6840
110 Ga0097620_100014121 3300006931 Bacteria 8010
111 Ga0097620_100060879 3300006931 Bacteria 3804
112 Ga0075435_100000229 3300007076 Bacteria 34254
113 Ga0075435_100223627 3300007076 Bacteria 1599
114 Ga0075435_100364157 3300007076 Bacteria 1240
115 Ga0075435_100481106 3300007076 Bacteria 1072
116 Ga0099794_10006708 3300007265 Bacteria 4678
117 Ga0099794_10021789 3300007265 Bacteria 2915
118 Ga0099794_10041539 3300007265 Bacteria 2190
119 Ga0111539_10011453 3300009094 Bacteria 11134
120 Ga0111539_10763700 3300009094 Bacteria 1125
121 Ga0111539_11074374 3300009094 Bacteria 935
122 Ga0105245_10000224 3300009098 Bacteria 53847
123 Ga0105245_10060498 3300009098 Bacteria 3411
124 Ga0114129_10001717 3300009147 Bacteria 29906
125 Ga0114129_10236757 3300009147 Bacteria 2456
126 Ga0105243_10000035 3300009148 Bacteria 177598
127 Ga0105243_10017734 3300009148 Bacteria 5385
128 Ga0105243_10173073 3300009148 Bacteria 1872
129 Ga0105241_10209465 3300009174 Bacteria 1632
130 Ga0105242_10000300 3300009176 Bacteria 39346
131 Ga0105242_10034839 3300009176 Bacteria 4036
132 Ga0105249_10000877 3300009553 Bacteria 26734
133 Ga0105249_10032793 3300009553 Bacteria 4700
134 Ga0105239_10028938 3300010375 Bacteria 6090
135 Ga0105246_10378990 3300011119 Bacteria 1168
136 Ga0157371_10234870 3300013102 Bacteria 1318
137 Ga0157378_10003260 3300013297 Bacteria 14423
138 Ga0157378_10711513 3300013297 Bacteria 1024
139 Ga0157372_10428171 3300013307 Bacteria 1542
140 Ga0157380_10008430 3300014326 Bacteria 7359
141 Ga0157380_10046070 3300014326 Bacteria 3424
142 Ga0157380_10047571 3300014326 Bacteria 3375
143 Ga0157379_10818057 3300014968 Bacteria 880
144 Ga0157376_10000899 3300014969 Bacteria 19451
145 Ga0213872_10002418 3300021361 Bacteria 10998
146 Ga0207653_10121885 3300025885 Bacteria 939
147 Ga0207692_10033279 3300025898 Bacteria 2485
148 Ga0207642_10000856 3300025899 Bacteria 9474
149 Ga0207688_10214244 3300025901 Bacteria 1158
150 Ga0207645_10103737 3300025907 Bacteria 1836
151 Ga0207654_10119013 3300025911 Bacteria 1655
152 Ga0207707_10015075 3300025912 Bacteria 6730
153 Ga0207707_10061550 3300025912 Bacteria 3266
154 Ga0207707_10342239 3300025912 Bacteria 1289
155 Ga0207693_10241696 3300025915 Bacteria 1417
156 Ga0207663_10688707 3300025916 Bacteria 809
157 Ga0207660_10058463 3300025917 Bacteria 2765
158 Ga0207660_10105767 3300025917 Bacteria 2109
159 Ga0207660_10501542 3300025917 Bacteria 985
160 Ga0207662_10000091 3300025918 Bacteria 42710
161 Ga0207662_10085324 3300025918 Bacteria 1934
162 Ga0207662_10340156 3300025918 Bacteria 1005
163 Ga0207652_10012141 3300025921 Bacteria 6959
164 Ga0207652_10088809 3300025921 Bacteria 2713
165 Ga0207646_10106435 3300025922 Bacteria 2516
166 Ga0207646_10405148 3300025922 Bacteria 1232
167 Ga0207681_10006306 3300025923 Bacteria 7280
168 Ga0207650_10553796 3300025925 Bacteria 964
169 Ga0207659_10097194 3300025926 Bacteria 2212
170 Ga0207687_10004403 3300025927 Bacteria 9398
171 Ga0207687_10387159 3300025927 Bacteria 1147
172 Ga0207644_10333792 3300025931 Bacteria 1228
173 Ga0207706_10597793 3300025933 Bacteria 948
174 Ga0207686_10003028 3300025934 Bacteria 9055
175 Ga0207686_10040527 3300025934 Bacteria 2832
176 Ga0207709_10006117 3300025935 Bacteria 6782
177 Ga0207709_10013923 3300025935 Bacteria 4442
178 Ga0207709_10181998 3300025935 Bacteria 1485
179 Ga0207670_10017405 3300025936 Bacteria 4345
180 Ga0207669_10049377 3300025937 Bacteria 2507
181 Ga0207704_10001173 3300025938 Bacteria 11687
182 Ga0207704_10008927 3300025938 Bacteria 4816
183 Ga0207704_10311400 3300025938 Bacteria 1210
184 Ga0207665_10491857 3300025939 Bacteria 946
185 Ga0207691_10144535 3300025940 Bacteria 2094
186 Ga0207711_11148544 3300025941 Bacteria 718
187 Ga0207689_10000024 3300025942 Bacteria 107574
188 Ga0207689_10018938 3300025942 Bacteria 5806
189 Ga0207689_10525019 3300025942 Bacteria 993
190 Ga0207689_10678778 3300025942 Bacteria 868
191 Ga0207661_10228554 3300025944 Bacteria 1647
192 Ga0207667_10020847 3300025949 Bacteria 7278
193 Ga0207667_10470582 3300025949 Bacteria 1276
194 Ga0207651_10172059 3300025960 Bacteria 1709
195 Ga0207712_10001857 3300025961 Bacteria 13902
196 Ga0207712_10004271 3300025961 Bacteria 9016
197 Ga0207668_10008668 3300025972 Bacteria 6072
198 Ga0207640_10007902 3300025981 Bacteria 5870
199 Ga0207677_10000435 3300026023 Bacteria 28214
200 Ga0207703_10008804 3300026035 Bacteria 7958
201 Ga0207703_10131556 3300026035 Bacteria 2161
202 Ga0207639_10172970 3300026041 Bacteria 1831
203 Ga0207639_10442871 3300026041 Unclassified 1178
204 Ga0207708_10002905 3300026075 Bacteria 12633
205 Ga0207708_10009209 3300026075 Bacteria 7308
206 Ga0207708_10106765 3300026075 Bacteria 2171
207 Ga0207702_10043286 3300026078 Bacteria 3780
208 Ga0207702_10184178 3300026078 Bacteria 1925
209 Ga0207641_10240573 3300026088 Bacteria 1686
210 Ga0207641_10285453 3300026088 Bacteria 1554
211 Ga0207648_10002933 3300026089 Bacteria 18061
212 Ga0207648_10005811 3300026089 Bacteria 12355
213 Ga0207648_10008390 3300026089 Bacteria 10009
214 Ga0207648_10359338 3300026089 Bacteria 1314
215 Ga0207676_10091797 3300026095 Bacteria 2496
216 Ga0207674_10274836 3300026116 Bacteria 1632
217 Ga0207675_100000017 3300026118 Bacteria 124338
218 Ga0207675_100024546 3300026118 Bacteria 5604
219 Ga0207675_100307132 3300026118 Bacteria 1546
220 Ga0207683_10012894 3300026121 Bacteria 7135
221 Ga0207683_10176872 3300026121 Bacteria 1934
222 Ga0209967_1002642 3300027364 Bacteria 2331
223 Ga0209981_1001259 3300027378 Bacteria 3211
224 Ga0209588_1014885 3300027671 Bacteria 2388
225 Ga0209588_1057168 3300027671 Bacteria 1261
226 Ga0209971_1026813 3300027682 Bacteria 1377
227 Ga0209966_1004264 3300027695 Bacteria 2421
228 Ga0207428_10000179 3300027907 Bacteria 88854
229 Ga0207428_10048882 3300027907 Bacteria 3391
230 Ga0207428_10062644 3300027907 Bacteria 2940
231 Ga0268265_10005706 3300028380 Bacteria 8500
232 Ga0268265_10027003 3300028380 Bacteria 4091
233 Ga0268265_10438231 3300028380 Bacteria 1217
234 Ga0268265_10664145 3300028380 Bacteria 1003
235 Ga0268264_10000894 3300028381 Bacteria 31375
236 Ga0268264_10175761 3300028381 Bacteria 1940
237 Ga0268264_10311008 3300028381 Bacteria 1486
238 Ga0307408_100153062 3300031548 Bacteria 1823
239 Ga0307408_100565004 3300031548 Unclassified 1006
240 Ga0307410_10876959 3300031852 Unclassified 768
241 Ga0307407_10036282 3300031903 Bacteria 2716
242 Ga0307412_10130894 3300031911 Bacteria 1822
243 Ga0307412_10230462 3300031911 Bacteria 1426
244 Ga0307411_10128965 3300032005 Bacteria 1845
245 Ga0307411_10354808 3300032005 Unclassified 1197
246 Ga0373930_0047072 3300034816 Bacteria 932
247 Ga0373948_0016925 3300034817 Bacteria 1353
248 Ga0373958_0026442 3300034819 Bacteria 1111
249 Ga0373938_0032867 3300034957 Bacteria 1119
250 Ga0373926_0005750 3300035083 Bacteria 4095
251 Ga0373928_0031249 3300035084 Bacteria 1181
252 Ga0373928_0108066 3300035084 Bacteria 733
253 Ga0373929_0017412 3300035085 Bacteria 1418
254 Ga0373934_0091249 3300035086 Bacteria 1228
255 Ga0373934_0131223 3300035086 Bacteria 1022
256 Ga0373940_0010044 3300035088 Bacteria 2215
257 Ga0373940_0021087 3300035088 Bacteria 1662
258 Ga0373944_0003144 3300035089 Bacteria 4244
259 Ga0373949_0019816 3300035090 Bacteria 1535
260 Ga0373951_0036619 3300035091 Bacteria 1171
261 Ga0373932_0003870 3300035112 Bacteria 3570
262 Ga0373936_0000551 3300035113 Bacteria 12863
263 Ga0373939_0037577 3300035114 Bacteria 1439
264 Ga0373939_0046192 3300035114 Bacteria 1332
265 Ga0373939_0068850 3300035114 Bacteria 1147
266 Ga0373941_0002006 3300035115 Bacteria 4412
267 Ga0373941_0072122 3300035115 Bacteria 1148
268 Ga0373941_0120362 3300035115 Unclassified 935
269 Ga0373945_0003209 3300035116 Bacteria 5127
270 Ga0373953_0063918 3300035117 Bacteria 1509
271 Ga0373946_0001349 3300035171 Bacteria 8495
272 Ga0373955_0058214 3300035172 Bacteria 2126
273 Ga0373942_0007110 3300035207 Bacteria 2589
274 Ga0373961_0005047 3300035241 Bacteria 3175
275 Ga0373961_0014166 3300035241 Bacteria 2022
276 Ga0373961_0070076 3300035241 Bacteria 1083
277 Ga0373961_0088089 3300035241 Bacteria 987
278 Ga0373962_0037502 3300035242 Bacteria 1354
279 Ga0373931_0001025 3300035691 Bacteria 11791
280 Ga0373931_0002166 3300035691 Bacteria 8654
281 Ga0373931_0003140 3300035691 Bacteria 7377
282 Ga0373931_0017626 3300035691 Bacteria 3535
283 Ga0373931_0030800 3300035691 Bacteria 2765
284 Ga0373935_0064462 3300035692 Bacteria 2349
285 Ga0373935_0147667 3300035692 Bacteria 1593
286 Ga0373927_0041769 3300035695 Bacteria 2973
287 Ga0373927_0199350 3300035695 Bacteria 1314
288 Ga0373927_0274749 3300035695 Bacteria 1108
289 Ga0373933_0053574 3300035724 Bacteria 2416
290 Ga0373947_0053632 3300035725 Bacteria 2431
291 Ga0373937_0005626 3300036401 Bacteria 10759
292 Ga0373937_0028311 3300036401 Bacteria 5069
293 Ga0373925_0102538 3300037068 Bacteria 2201
294 Ga0436361_0013073 3300039447 Bacteria 17617
295 Ga0439461_0013925 3300041410 Bacteria 1523
296 Ga0451839_0973392 3300041496 Bacteria 957
297 Ga0439434_0035202 3300042435 Bacteria 1530
298 Ga0439435_0004051 3300042436 Bacteria 3119
299 Ga0439444_0000207 3300042437 Bacteria 5613
300 Ga0439460_0003723 3300042461 Bacteria 3693
301 Ga0451577_0145462 3300042876 Bacteria 2131
302 Ga0466963_0041708 3300044694 Unclassified 3011
303 Ga0451576_0003447 3300045051 Bacteria 21698
304 Ga0451576_0063690 3300045051 Bacteria 3842
305 Ga0466967_0004294 3300045976 Bacteria 9587
306 Ga0495580_0000780 3300046472 Bacteria 27419
307 Ga0495639_0006906 3300046475 Bacteria 4875
308 Ga0495586_0013749 3300046535 Bacteria 4295
309 Ga0495598_0099195 3300046537 Bacteria 961
310 Ga0495621_0122234 3300046539 Bacteria 1007
311 Ga0495588_0002876 3300046674 Bacteria 7415
312 Ga0495647_0000522 3300046681 Bacteria 11238
313 Ga0495658_0000592 3300046683 Bacteria 19845
314 Ga0495669_0007000 3300046684 Bacteria 4722
315 Ga0495669_0079335 3300046684 Bacteria 1505
316 Ga0495636_0101640 3300047318 Bacteria 1258
317 Ga0495674_0152996 3300047319 Bacteria 1934
318 Ga0495676_0010800 3300047321 Bacteria 8263
319 Ga0495675_0333095 3300047444 Bacteria 896
320 Ga0501033_0005095 3300049570 Bacteria 10454
321 Ga0501036_0003156 3300049572 Bacteria 13146
322 Ga0501037_0071454 3300049573 Bacteria 2524
323 Ga0501038_0003952 3300049574 Bacteria 13778
324 Ga0501040_0004484 3300049576 Bacteria 9067
325 Ga0501040_0255835 3300049576 Bacteria 1249
326 Ga0501041_0000061 3300049577 Bacteria 40487
327 Ga0501041_0029834 3300049577 Bacteria 3291
328 Ga0501042_0000680 3300049578 Bacteria 18368
329 Ga0501042_0541305 3300049578 Bacteria 846
330 Ga0501043_0010879 3300049579 Bacteria 7124
331 Ga0501043_0138685 3300049579 Bacteria 1905
332 Ga0501046_0005797 3300049580 Bacteria 11022
333 Ga0501048_0000204 3300049582 Bacteria 38757
334 Ga0501069_0106386 3300049585 Bacteria 1595
335 Ga0501070_0076681 3300049586 Bacteria 2767
336 Ga0501072_0002784 3300049588 Bacteria 13146
337 Ga0501072_0704966 3300049588 Bacteria 793
338 Ga0501073_0109225 3300049589 Bacteria 1919
339 Ga0501073_0122724 3300049589 Bacteria 1801
340 Ga0501073_0355291 3300049589 Bacteria 1012
341 Ga0501074_0045033 3300049590 Bacteria 3192
342 Ga0501075_0000818 3300049591 Bacteria 19511
343 Ga0501075_0559982 3300049591 Bacteria 872
344 Ga0501077_0003967 3300049593 Bacteria 8923
345 Ga0501079_0016491 3300049741 Bacteria 5642
346 Ga0501080_0006269 3300049742 Bacteria 10674
347 Ga0501081_0000061 3300049743 Bacteria 42076
348 Ga0501081_0066439 3300049743 Bacteria 2508
349 Ga0501083_0031747 3300049744 Bacteria 3625
350 Ga0501083_0165444 3300049744 Bacteria 1446
351 Ga0501035_0027271 3300049822 Bacteria 5221
352 Ga0501045_0001049 3300049824 Bacteria 18186
353 Ga0501045_0380690 3300049824 Unclassified 1050
354 nmdc:mga05p37_1021841_c1 3300050507 Unclassified 875
355 nmdc:mga05p37_3934_c1 3300050507 Bacteria 17397
356 nmdc:mga05p37_570460_c1 3300050507 Bacteria 1284
357 nmdc:mga09592_296971_c1 3300050508 Bacteria 1401
358 nmdc:mga09592_320_c1 3300050508 Bacteria 35151
359 nmdc:mga09592_347446_c1 3300050508 Unclassified 1284
360 nmdc:mga09592_526308_c1 3300050508 Bacteria 1017
361 nmdc:mga0qj67_107046_c1 3300050509 Bacteria 2256
362 nmdc:mga0qj67_11487_c1 3300050509 Bacteria 6635
363 nmdc:mga0qj67_690864_c1 3300050509 Bacteria 812
364 nmdc:mga0qj67_731557_c1 3300050509 Bacteria 786
365 nmdc:mga0qj67_91654_c1 3300050509 Bacteria 2443
366 nmdc:mga06r32_191149_c1 3300050510 Bacteria 2035
367 nmdc:mga06r32_472346_c1 3300050510 Bacteria 1233
368 nmdc:mga06r32_570235_c1 3300050510 Bacteria 1105
369 nmdc:mga08y16_1159_c1 3300050511 Bacteria 25985
370 nmdc:mga08y16_2408_c1 3300050511 Bacteria 10310
371 nmdc:mga08y16_32391_c1 3300050511 Bacteria 5496
372 nmdc:mga0n895_272_c1 3300050512 Bacteria 33829
373 nmdc:mga0n895_311776_c1 3300050512 Bacteria 1594
374 nmdc:mga0n895_869055_c1 3300050512 Unclassified 889
375 nmdc:mga0rr50_192682_c1 3300050513 Bacteria 1671
376 nmdc:mga0rr50_65_c1 3300050513 Bacteria 62915
377 nmdc:mga0rr50_87556_c1 3300050513 Bacteria 2418
378 nmdc:mga08x19_9184_c1 3300050514 Bacteria 5902
379 nmdc:mga0a205_38_c1 3300050515 Bacteria 73135
380 Ga0501084_0000706 3300054114 Bacteria 25545
381 Ga0590071_015031 3300059421 Bacteria 1815
382 Ga0590074_012653 3300059423 Bacteria 1421
383 Ga0590077_013198 3300059426 Bacteria 1717
384 Ga0501082_0001451 3300060353 Bacteria 20822
385 Ga0530510_0000887 3300061734 Bacteria 19738
386 Ga0207653_10030670
387 Ga0070676_10306036
388 Ga0070676_10606591
389 Ga0070683_100033494
390 Ga0070690_100000156
391 Ga0070690_100009992
392 Ga0068869_100000023
393 Ga0068869_100018077
394 Ga0068869_100083739
395 Ga0070680_100001770
396 Ga0070682_100008351
397 Ga0068868_100004876
398 Ga0070689_100001214
399 Ga0070691_10014079
400 Ga0070687_100000137
401 Ga0070687_100338688
402 Ga0070692_10006200
403 Ga0070692_10149373
404 Ga0070692_10545747
405 Ga0070668_100008846
406 Ga0070669_100016082
407 Ga0070675_100045463
408 Ga0070675_100059954
409 Ga0070671_100440507
410 Ga0070674_100081562
411 Ga0070674_100211756
412 Ga0070674_100223324
413 Ga0070673_100053543
414 Ga0070703_10036201
415 Ga0070703_10120870
416 Ga0070710_10077905
417 Ga0070701_10002554
418 Ga0070705_100000063
419 Ga0070705_100034411
420 Ga0070700_100001074
421 Ga0070700_100007241
422 Ga0070694_100002576
423 Ga0070694_100009787
424 Ga0070694_100086239
425 Ga0070694_100481693
426 Ga0070681_10002398
427 Ga0070681_10075193
428 Ga0068867_100003670
429 Ga0068867_100005122
430 Ga0068867_100051124
431 Ga0068867_100116709
432 Ga0070706_100294258
433 Ga0070707_101104612
434 Ga0070698_100374130
435 Ga0070679_100002398
436 Ga0070679_100111806
437 Ga0070684_100009357
438 Ga0070697_100587873
439 Ga0068853_100620185
440 Ga0070686_100001234
441 Ga0070695_100000807
442 Ga0070695_100040414
443 Ga0070695_100151991
444 Ga0070696_100001092
445 Ga0070696_100001215
446 Ga0070696_100038587
447 Ga0070693_100000094
448 Ga0070704_100000025
449 Ga0070704_100002799
450 Ga0070704_100540714
451 Ga0070704_100700513
452 Ga0068855_100001759
453 Ga0068855_100613682
454 Ga0068854_100002888
455 Ga0068856_100059932
456 Ga0068856_100161453
457 Ga0070702_100000044
458 Ga0070702_100352484
459 Ga0068859_100014121
460 Ga0068859_100060880
461 Ga0068866_10000751
462 Ga0068861_100003380
463 Ga0068861_100005136
464 Ga0068863_100265061
465 Ga0068863_100641385
466 Ga0068858_100005037
467 Ga0068858_100593498
468 Ga0068860_100048893
469 Ga0068860_100164045
470 Ga0068860_100411845
471 Ga0068862_100000320
472 Ga0068862_100034361
473 Ga0068862_100330469
474 Ga0068862_100746949
475 Ga0097621_100000206
476 Ga0097621_100020478
477 Ga0068871_100005497
478 Ga0075428_100000107
479 Ga0075428_100316123
480 Ga0075428_100417950
481 Ga0075430_100060804
482 Ga0075430_100135689
483 Ga0075430_100322976
484 Ga0075431_100220018
485 Ga0075433_10004334
486 Ga0075434_100000151
487 Ga0075434_100668015
488 Ga0075429_100204201
489 Ga0075429_100431272
490 Ga0075429_100622749
491 Ga0068865_100003493
492 Ga0068865_100007796
493 Ga0068865_100033324
494 Ga0075436_100008982
495 Ga0097620_100014121
496 Ga0097620_100060879
497 Ga0075435_100000229
498 Ga0075435_100223627
499 Ga0075435_100364157
500 Ga0075435_100481106
501 Ga0099794_10006708
502 Ga0099794_10021789
503 Ga0099794_10041539
504 Ga0111539_10011453
505 Ga0111539_10763700
506 Ga0111539_11074374
507 Ga0105245_10000224
508 Ga0105245_10060498
509 Ga0114129_10001717
510 Ga0114129_10236757
511 Ga0105243_10000035
512 Ga0105243_10017734
513 Ga0105243_10173073
514 Ga0105241_10209465
515 Ga0105242_10000300
516 Ga0105242_10034839
517 Ga0105249_10000877
518 Ga0105249_10032793
519 Ga0105239_10028938
520 Ga0105246_10378990
521 Ga0157371_10234870
522 Ga0157378_10003260
523 Ga0157378_10711513
524 Ga0157372_10428171
525 Ga0157380_10008430
526 Ga0157380_10046070
527 Ga0157380_10047571
528 Ga0157379_10818057
529 Ga0157376_10000899
530 Ga0213872_10002418
531 Ga0207653_10121885
532 Ga0207692_10033279
533 Ga0207642_10000856
534 Ga0207688_10214244
535 Ga0207645_10103737
536 Ga0207654_10119013
537 Ga0207707_10015075
538 Ga0207707_10061550
539 Ga0207707_10342239
540 Ga0207693_10241696
541 Ga0207663_10688707
542 Ga0207660_10058463
543 Ga0207660_10105767
544 Ga0207660_10501542
545 Ga0207662_10000091
546 Ga0207662_10085324
547 Ga0207662_10340156
548 Ga0207652_10012141
549 Ga0207652_10088809
550 Ga0207646_10106435
551 Ga0207646_10405148
552 Ga0207681_10006306
553 Ga0207650_10553796
554 Ga0207659_10097194
555 Ga0207687_10004403
556 Ga0207687_10387159
557 Ga0207644_10333792
558 Ga0207706_10597793
559 Ga0207686_10003028
560 Ga0207686_10040527
561 Ga0207709_10006117
562 Ga0207709_10013923
563 Ga0207709_10181998
564 Ga0207670_10017405
565 Ga0207669_10049377
566 Ga0207704_10001173
567 Ga0207704_10008927
568 Ga0207704_10311400
569 Ga0207665_10491857
570 Ga0207691_10144535
571 Ga0207711_11148544
572 Ga0207689_10000024
573 Ga0207689_10018938
574 Ga0207689_10525019
575 Ga0207689_10678778
576 Ga0207661_10228554
577 Ga0207667_10020847
578 Ga0207667_10470582
579 Ga0207651_10172059
580 Ga0207712_10001857
581 Ga0207712_10004271
582 Ga0207668_10008668
583 Ga0207640_10007902
584 Ga0207677_10000435
585 Ga0207703_10008804
586 Ga0207703_10131556
587 Ga0207639_10172970
588 Ga0207639_10442871
589 Ga0207708_10002905
590 Ga0207708_10009209
591 Ga0207708_10106765
592 Ga0207702_10043286
593 Ga0207702_10184178
594 Ga0207641_10240573
595 Ga0207641_10285453
596 Ga0207648_10002933
597 Ga0207648_10005811
598 Ga0207648_10008390
599 Ga0207648_10359338
600 Ga0207676_10091797
601 Ga0207674_10274836
602 Ga0207675_100000017
603 Ga0207675_100024546
604 Ga0207675_100307132
605 Ga0207683_10012894
606 Ga0207683_10176872
607 Ga0209967_1002642
608 Ga0209981_1001259
609 Ga0209588_1014885
610 Ga0209588_1057168
611 Ga0209971_1026813
612 Ga0209966_1004264
613 Ga0207428_10000179
614 Ga0207428_10048882
615 Ga0207428_10062644
616 Ga0268265_10005706
617 Ga0268265_10027003
618 Ga0268265_10438231
619 Ga0268265_10664145
620 Ga0268264_10000894
621 Ga0268264_10175761
622 Ga0268264_10311008
623 Ga0307408_100153062
624 Ga0307408_100565004
625 Ga0307410_10876959
626 Ga0307407_10036282
627 Ga0307412_10130894
628 Ga0307412_10230462
629 Ga0307411_10128965
630 Ga0307411_10354808
631 Ga0373930_0047072
632 Ga0373948_0016925
633 Ga0373958_0026442
634 Ga0373938_0032867
635 Ga0373926_0005750
636 Ga0373928_0031249
637 Ga0373928_0108066
638 Ga0373929_0017412
639 Ga0373934_0091249
640 Ga0373934_0131223
641 Ga0373940_0010044
642 Ga0373940_0021087
643 Ga0373944_0003144
644 Ga0373949_0019816
645 Ga0373951_0036619
646 Ga0373932_0003870
647 Ga0373936_0000551
648 Ga0373939_0037577
649 Ga0373939_0046192
650 Ga0373939_0068850
651 Ga0373941_0002006
652 Ga0373941_0072122
653 Ga0373941_0120362
654 Ga0373945_0003209
655 Ga0373953_0063918
656 Ga0373946_0001349
657 Ga0373955_0058214
658 Ga0373942_0007110
659 Ga0373961_0005047
660 Ga0373961_0014166
661 Ga0373961_0070076
662 Ga0373961_0088089
663 Ga0373962_0037502
664 Ga0373931_0001025
665 Ga0373931_0002166
666 Ga0373931_0003140
667 Ga0373931_0017626
668 Ga0373931_0030800
669 Ga0373935_0064462
670 Ga0373935_0147667
671 Ga0373927_0041769
672 Ga0373927_0199350
673 Ga0373927_0274749
674 Ga0373933_0053574
675 Ga0373947_0053632
676 Ga0373937_0005626
677 Ga0373937_0028311
678 Ga0373925_0102538
679 Ga0436361_0013073
680 Ga0439461_0013925
681 Ga0451839_0973392
682 Ga0439434_0035202
683 Ga0439435_0004051
684 Ga0439444_0000207
685 Ga0439460_0003723
686 Ga0451577_0145462
687 Ga0466963_0041708
688 Ga0451576_0003447
689 Ga0451576_0063690
690 Ga0466967_0004294
691 Ga0495580_0000780
692 Ga0495639_0006906
693 Ga0495586_0013749
694 Ga0495598_0099195
695 Ga0495621_0122234
696 Ga0495588_0002876
697 Ga0495647_0000522
698 Ga0495658_0000592
699 Ga0495669_0007000
700 Ga0495669_0079335
701 Ga0495636_0101640
702 Ga0495674_0152996
703 Ga0495676_0010800
704 Ga0495675_0333095
705 Ga0501033_0005095
706 Ga0501036_0003156
707 Ga0501037_0071454
708 Ga0501038_0003952
709 Ga0501040_0004484
710 Ga0501040_0255835
711 Ga0501041_0000061
712 Ga0501041_0029834
713 Ga0501042_0000680
714 Ga0501042_0541305
715 Ga0501043_0010879
716 Ga0501043_0138685
717 Ga0501046_0005797
718 Ga0501048_0000204
719 Ga0501069_0106386
720 Ga0501070_0076681
721 Ga0501072_0002784
722 Ga0501072_0704966
723 Ga0501073_0109225
724 Ga0501073_0122724
725 Ga0501073_0355291
726 Ga0501074_0045033
727 Ga0501075_0000818
728 Ga0501075_0559982
729 Ga0501077_0003967
730 Ga0501079_0016491
731 Ga0501080_0006269
732 Ga0501081_0000061
733 Ga0501081_0066439
734 Ga0501083_0031747
735 Ga0501083_0165444
736 Ga0501035_0027271
737 Ga0501045_0001049
738 Ga0501045_0380690
739 nmdc:mga05p37_1021841_c1
740 nmdc:mga05p37_3934_c1
741 nmdc:mga05p37_570460_c1
742 nmdc:mga09592_296971_c1
743 nmdc:mga09592_320_c1
744 nmdc:mga09592_347446_c1
745 nmdc:mga09592_526308_c1
746 nmdc:mga0qj67_107046_c1
747 nmdc:mga0qj67_11487_c1
748 nmdc:mga0qj67_690864_c1
749 nmdc:mga0qj67_731557_c1
750 nmdc:mga0qj67_91654_c1
751 nmdc:mga06r32_191149_c1
752 nmdc:mga06r32_472346_c1
753 nmdc:mga06r32_570235_c1
754 nmdc:mga08y16_1159_c1
755 nmdc:mga08y16_2408_c1
756 nmdc:mga08y16_32391_c1
757 nmdc:mga0n895_272_c1
758 nmdc:mga0n895_311776_c1
759 nmdc:mga0n895_869055_c1
760 nmdc:mga0rr50_192682_c1
761 nmdc:mga0rr50_65_c1
762 nmdc:mga0rr50_87556_c1
763 nmdc:mga08x19_9184_c1
764 nmdc:mga0a205_38_c1
765 Ga0501084_0000706
766 Ga0590071_015031
767 Ga0590074_012653
768 Ga0590077_013198
769 Ga0501082_0001451
770 Ga0530510_0000887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

46

207

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.8493 38 77
5u1p-assembly1.cif.gz_A-2 crystal structure of nadp-dependent carbonyl reductase from burkholderia multivorans in complex with nadp 0.8253 42 78
5idq-assembly1.cif.gz_B crystal structure of a short-chain dehydrogenase/reductase (sdr)from burkholderia vietnamiensis at 1.55 a resolution 0.8171 42 78
1dz3-assembly1.cif.gz_A-2 domain-swapping in the sporulation response regulator spo0a 0.8083 52 78
4cpd-assembly2.cif.gz_B alcohol dehydrogenase tadh from thermus sp. atn1 0.8018 38 77
ID Description Score Start End Superfamily
af_O53977_3_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8413 54 79 3.40.50.1010
5idqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8172 42 78 3.40.50.720
af_Q652S1_5_166_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8077 39 76 3.40.50.720
af_Q2G2C5_144_285_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7862 38 76 3.40.50.720
1dckB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7723 39 77 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1F4AZ11-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.8969 2 168 GO:0016779
AF-A0A6N9R8T8-F1-model_v4 NTP transferase domain-containing protein 0.894 103 168 GO:0016779
AF-A0A831LKV0-F1-model_v4 Nucleotidyltransferase family protein 0.8934 82 168 GO:0016779
AF-X1LVN5-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.8928 85 165 GO:0016779
AF-A0A1F6UXY7-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.8907 81 168 GO:0016779

Map