F430191

General Info

Members Datasets Scaffolds Average Seq Length
385 192 382 427

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10113055|Ga0157373_101130551
Length 478
Sequence LEFGILNLKFKLIDMAIKVVIVGAGFAGLRLARKLNNKAGFEVLLIDKFNYHQFQPLFYQVATAALDASNISFPLRKAFHNSKNVRIRVEEVKQIVPEQNKIITESEALGYDILVLAMGADTNFFGNQNLTANAFPMKSTVEALQIRHRLVQNFEDALLAKDPLEYQKLMNIVITGGGPTGVEVAGALADMKRYVLPKDYPEHDFSKMNIYLLEGGPRTLGPMSEKSSEDSCRYLTKMGVTIMTNSLVKDYDGEQVLLGDGKTIPTKMVIWAAGIKGNVPEGIDKSLIVRGNRIKVDRHCKVEGTDNVYVLGDLAYMETQKYPKGHPQVASVAIAQADVLAKNLRLMESKSNRIYEFEYHDKGSMATVGRNLAVVDIPKPKLHFNGFFAWFIWMSLHLFLILGVKNKLMTFINWIYNYFTYDQNLRLIFKEFYRPKKSAPAVQSSQPEARPSQDRLPVKPVEQKNDDDDLRQAASFNR

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
176 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 0.52
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10002642 3300002077 Bacteria 3657
2 rootL2_10340936 3300003322 Bacteria 2722
3 Ga0065704_10132426 3300005289 Bacteria 1613
4 Ga0065712_10127910 3300005290 Unclassified 1585
5 Ga0070676_10002090 3300005328 Bacteria 10157
6 Ga0070676_10029292 3300005328 Unclassified 3131
7 Ga0070683_100028042 3300005329 Bacteria 5085
8 Ga0070670_100072136 3300005331 Bacteria 2965
9 Ga0070670_100283406 3300005331 Unclassified 1447
10 Ga0068869_100053707 3300005334 Unclassified 2930
11 Ga0068869_100104319 3300005334 Bacteria 2149
12 Ga0070666_10000042 3300005335 Bacteria 112296
13 Ga0070666_10032628 3300005335 Bacteria 3441
14 Ga0070680_100027225 3300005336 Bacteria 4578
15 Ga0070682_100000124 3300005337 Bacteria 67529
16 Ga0068868_100002150 3300005338 Bacteria 13616
17 Ga0068868_100129699 3300005338 Bacteria 2062
18 Ga0068868_100186210 3300005338 Bacteria 1725
19 Ga0070661_100005681 3300005344 Bacteria 8592
20 Ga0070661_100122703 3300005344 Bacteria 1947
21 Ga0070668_100087609 3300005347 Unclassified 2450
22 Ga0070675_100165197 3300005354 Bacteria 1906
23 Ga0070671_100001926 3300005355 Bacteria 15908
24 Ga0070671_100013574 3300005355 Bacteria 6569
25 Ga0070674_100016436 3300005356 Bacteria 4637
26 Ga0070673_100263036 3300005364 Unclassified 1508
27 Ga0070659_100006626 3300005366 Bacteria 8368
28 Ga0070667_100001632 3300005367 Bacteria 20064
29 Ga0070667_100005157 3300005367 Bacteria 10931
30 Ga0070667_100026373 3300005367 Bacteria 4834
31 Ga0070667_100028621 3300005367 Bacteria 4639
32 Ga0070667_100111976 3300005367 Bacteria 2367
33 Ga0070667_100145211 3300005367 Bacteria 2080
34 Ga0070667_100205942 3300005367 Bacteria 1747
35 Ga0070663_100028012 3300005455 Bacteria 3831
36 Ga0070678_100017614 3300005456 Bacteria 4607
37 Ga0070678_100074018 3300005456 Bacteria 2558
38 Ga0070678_100156535 3300005456 Bacteria 1841
39 Ga0070662_100007916 3300005457 Bacteria 6910
40 Ga0070681_10140701 3300005458 Unclassified 2343
41 Ga0068867_100019440 3300005459 Bacteria 4840
42 Ga0068867_100057514 3300005459 Bacteria 2880
43 Ga0070685_10036760 3300005466 Bacteria 2770
44 Ga0070698_100001722 3300005471 Bacteria 24392
45 Ga0070698_100038718 3300005471 Bacteria 4912
46 Ga0070679_100005964 3300005530 Bacteria 11323
47 Ga0070679_100157394 3300005530 Unclassified 2246
48 Ga0070684_100002706 3300005535 Bacteria 13093
49 Ga0070684_100004020 3300005535 Bacteria 11128
50 Ga0070684_100023094 3300005535 Bacteria 5194
51 Ga0070684_100059698 3300005535 Bacteria 3335
52 Ga0070684_100184866 3300005535 Bacteria 1895
53 Ga0068853_100011059 3300005539 Bacteria 7320
54 Ga0068853_100134922 3300005539 Bacteria 2212
55 Ga0070665_100011209 3300005548 Bacteria 9064
56 Ga0068855_100106339 3300005563 Bacteria 3225
57 Ga0068855_100290164 3300005563 Bacteria 1814
58 Ga0068855_100430569 3300005563 Bacteria 1442
59 Ga0070664_100003473 3300005564 Bacteria 12721
60 Ga0070664_100097612 3300005564 Bacteria 2551
61 Ga0070664_100168742 3300005564 Bacteria 1940
62 Ga0068857_100001120 3300005577 Bacteria 20847
63 Ga0068857_100042981 3300005577 Bacteria 4009
64 Ga0068857_100051539 3300005577 Bacteria 3652
65 Ga0068857_100105244 3300005577 Bacteria 2533
66 Ga0068854_100009879 3300005578 Bacteria 6172
67 Ga0068854_100050648 3300005578 Bacteria 2973
68 Ga0068854_100150288 3300005578 Bacteria 1795
69 Ga0068856_100071023 3300005614 Bacteria 3446
70 Ga0068856_100076222 3300005614 Bacteria 3323
71 Ga0068852_100001468 3300005616 Bacteria 15943
72 Ga0068852_100029345 3300005616 Bacteria 4518
73 Ga0068852_100051305 3300005616 Bacteria 3539
74 Ga0068852_100086593 3300005616 Bacteria 2793
75 Ga0068852_100304484 3300005616 Bacteria 1543
76 Ga0068859_100000200 3300005617 Bacteria 58644
77 Ga0068859_100053343 3300005617 Bacteria 4067
78 Ga0068859_100091525 3300005617 Bacteria 3092
79 Ga0068859_100397716 3300005617 Bacteria 1473
80 Ga0068864_100016496 3300005618 Bacteria 6147
81 Ga0068864_100034372 3300005618 Bacteria 4312
82 Ga0068864_100123494 3300005618 Unclassified 2318
83 Ga0068864_100135122 3300005618 Bacteria 2220
84 Ga0068851_10012528 3300005834 Unclassified 3999
85 Ga0068863_100028336 3300005841 Bacteria 5347
86 Ga0068863_100030624 3300005841 Bacteria 5137
87 Ga0068863_100042277 3300005841 Bacteria 4330
88 Ga0068863_100096507 3300005841 Unclassified 2806
89 Ga0068858_100133394 3300005842 Bacteria 2329
90 Ga0068860_100000855 3300005843 Bacteria 33982
91 Ga0068860_100009032 3300005843 Bacteria 9922
92 Ga0068860_100009630 3300005843 Bacteria 9601
93 Ga0068860_100019426 3300005843 Bacteria 6590
94 Ga0068860_100085362 3300005843 Unclassified 3004
95 Ga0068860_100141415 3300005843 Bacteria 2313
96 Ga0068862_100025450 3300005844 Bacteria 4969
97 Ga0081539_10036867 3300005985 Bacteria 2919
98 Ga0070715_10040430 3300006163 Bacteria 1949
99 Ga0070715_10052008 3300006163 Bacteria 1766
100 Ga0075366_10005879 3300006195 Bacteria 6672
101 Ga0097621_100001776 3300006237 Bacteria 14790
102 Ga0097621_100002030 3300006237 Bacteria 13854
103 Ga0097621_100138344 3300006237 Bacteria 2079
104 Ga0097621_100282420 3300006237 Bacteria 1461
105 Ga0068871_100000063 3300006358 Bacteria 58377
106 Ga0068871_100011416 3300006358 Bacteria 6515
107 Ga0068871_100017181 3300006358 Bacteria 5469
108 Ga0068871_100117165 3300006358 Bacteria 2246
109 Ga0068871_100128299 3300006358 Bacteria 2148
110 Ga0075428_100006924 3300006844 Bacteria 12593
111 Ga0075428_100016828 3300006844 Bacteria 8075
112 Ga0075430_100155589 3300006846 Unclassified 1903
113 Ga0075431_100057528 3300006847 Unclassified 4010
114 Ga0075429_100011429 3300006880 Bacteria 7692
115 Ga0068865_100002013 3300006881 Bacteria 11995
116 Ga0068865_100170139 3300006881 Bacteria 1670
117 Ga0097620_100000200 3300006931 Bacteria 58644
118 Ga0097620_100053343 3300006931 Bacteria 4067
119 Ga0097620_100091528 3300006931 Bacteria 3092
120 Ga0097620_100397733 3300006931 Bacteria 1473
121 Ga0105240_10000037 3300009093 Bacteria 270462
122 Ga0105240_10190363 3300009093 Unclassified 2413
123 Ga0105245_10058466 3300009098 Bacteria 3470
124 Ga0105245_10081101 3300009098 Bacteria 2965
125 Ga0105247_10003739 3300009101 Bacteria 9872
126 Ga0105247_10004596 3300009101 Bacteria 8799
127 Ga0114129_10081161 3300009147 Bacteria 4508
128 Ga0105241_10008352 3300009174 Bacteria 7625
129 Ga0105241_10026934 3300009174 Bacteria 4279
130 Ga0105241_10110185 3300009174 Bacteria 2202
131 Ga0105242_10002236 3300009176 Bacteria 15267
132 Ga0105242_10033141 3300009176 Bacteria 4135
133 Ga0105237_10032263 3300009545 Bacteria 5303
134 Ga0105237_10075501 3300009545 Bacteria 3362
135 Ga0105237_10092000 3300009545 Bacteria 3023
136 Ga0105237_10246844 3300009545 Bacteria 1787
137 Ga0105249_10010845 3300009553 Bacteria 8007
138 Ga0105249_10040315 3300009553 Bacteria 4241
139 Ga0105249_10046190 3300009553 Bacteria 3963
140 Ga0105239_10005001 3300010375 Bacteria 15651
141 Ga0105239_10060996 3300010375 Bacteria 4139
142 Ga0105239_10121771 3300010375 Bacteria 2898
143 Ga0105246_10011283 3300011119 Bacteria 5544
144 Ga0105246_10102153 3300011119 Bacteria 2090
145 Ga0157373_10015569 3300013100 Bacteria 5559
146 Ga0157373_10080696 3300013100 Bacteria 2294
147 Ga0157373_10113055 3300013100 Bacteria 1908
148 Ga0157371_10029224 3300013102 Unclassified 3989
149 Ga0157371_10042128 3300013102 Unclassified 3255
150 Ga0157371_10046424 3300013102 Bacteria 3089
151 Ga0157369_10071352 3300013105 Bacteria 3729
152 Ga0157369_10267329 3300013105 Unclassified 1783
153 Ga0157374_10075460 3300013296 Bacteria 3186
154 Ga0157374_10145703 3300013296 Bacteria 2300
155 Ga0157374_10161759 3300013296 Bacteria 2180
156 Ga0157378_10007682 3300013297 Bacteria 9409
157 Ga0157378_10010308 3300013297 Bacteria 8159
158 Ga0157378_10037371 3300013297 Bacteria 4300
159 Ga0157378_10044230 3300013297 Unclassified 3954
160 Ga0157378_10051544 3300013297 Bacteria 3662
161 Ga0157378_10079881 3300013297 Bacteria 2954
162 Ga0157378_10133515 3300013297 Unclassified 2300
163 Ga0157378_10257480 3300013297 Bacteria 1673
164 Ga0163162_10002273 3300013306 Bacteria 18036
165 Ga0163162_10004720 3300013306 Bacteria 13145
166 Ga0163162_10005320 3300013306 Bacteria 12421
167 Ga0163162_10005904 3300013306 Bacteria 11844
168 Ga0163162_10066579 3300013306 Unclassified 3651
169 Ga0163162_10142890 3300013306 Bacteria 2507
170 Ga0163162_10240411 3300013306 Bacteria 1942
171 Ga0157372_10042000 3300013307 Bacteria 5056
172 Ga0157372_10072654 3300013307 Bacteria 3877
173 Ga0157372_10091002 3300013307 Unclassified 3469
174 Ga0157372_10122507 3300013307 Bacteria 2988
175 Ga0157375_10001429 3300013308 Bacteria 20544
176 Ga0157375_10009468 3300013308 Bacteria 8553
177 Ga0157375_10109649 3300013308 Bacteria 2857
178 Ga0157375_10156072 3300013308 Bacteria 2421
179 Ga0163163_10000078 3300014325 Bacteria 107017
180 Ga0163163_10010037 3300014325 Bacteria 8494
181 Ga0163163_10034455 3300014325 Bacteria 4904
182 Ga0163163_10088287 3300014325 Bacteria 3112
183 Ga0163163_10324520 3300014325 Unclassified 1593
184 Ga0157377_10042879 3300014745 Unclassified 2515
185 Ga0157377_10062799 3300014745 Bacteria 2126
186 Ga0157376_10000481 3300014969 Bacteria 25767
187 Ga0157376_10010591 3300014969 Bacteria 6752
188 Ga0157376_10112929 3300014969 Bacteria 2395
189 Ga0163161_10010918 3300017792 Bacteria 6296
190 Ga0163161_10017765 3300017792 Bacteria 4984
191 Ga0213876_10003829 3300021384 Bacteria 8521
192 Ga0207642_10007803 3300025899 Bacteria 3631
193 Ga0207710_10004545 3300025900 Bacteria 6029
194 Ga0207688_10066933 3300025901 Bacteria 2033
195 Ga0207680_10000448 3300025903 Bacteria 19470
196 Ga0207680_10050601 3300025903 Bacteria 2480
197 Ga0207680_10068412 3300025903 Bacteria 2191
198 Ga0207647_10000094 3300025904 Bacteria 68043
199 Ga0207645_10017806 3300025907 Bacteria 4683
200 Ga0207645_10029115 3300025907 Bacteria 3561
201 Ga0207645_10036081 3300025907 Unclassified 3174
202 Ga0207643_10001857 3300025908 Bacteria 11679
203 Ga0207705_10045264 3300025909 Bacteria 3163
204 Ga0207654_10059584 3300025911 Bacteria 2227
205 Ga0207654_10117923 3300025911 Bacteria 1662
206 Ga0207695_10000092 3300025913 Bacteria 270514
207 Ga0207671_10006273 3300025914 Bacteria 10633
208 Ga0207660_10051677 3300025917 Unclassified 2923
209 Ga0207662_10076203 3300025918 Bacteria 2038
210 Ga0207662_10101209 3300025918 Bacteria 1785
211 Ga0207649_10028442 3300025920 Bacteria 3291
212 Ga0207649_10036474 3300025920 Bacteria 2961
213 Ga0207652_10067615 3300025921 Unclassified 3099
214 Ga0207650_10011124 3300025925 Bacteria 6188
215 Ga0207650_10031763 3300025925 Bacteria 3815
216 Ga0207650_10061518 3300025925 Unclassified 2804
217 Ga0207687_10088808 3300025927 Bacteria 2249
218 Ga0207687_10163931 3300025927 Bacteria 1708
219 Ga0207644_10019615 3300025931 Bacteria 4590
220 Ga0207644_10209036 3300025931 Bacteria 1542
221 Ga0207644_10246493 3300025931 Unclassified 1424
222 Ga0207690_10018594 3300025932 Bacteria 4263
223 Ga0207690_10019288 3300025932 Unclassified 4197
224 Ga0207706_10004992 3300025933 Bacteria 12392
225 Ga0207686_10001617 3300025934 Bacteria 12610
226 Ga0207686_10028123 3300025934 Bacteria 3301
227 Ga0207704_10012451 3300025938 Bacteria 4222
228 Ga0207691_10010443 3300025940 Bacteria 8907
229 Ga0207691_10031091 3300025940 Bacteria 4986
230 Ga0207691_10037661 3300025940 Bacteria 4478
231 Ga0207691_10046152 3300025940 Bacteria 4006
232 Ga0207689_10004594 3300025942 Bacteria 12492
233 Ga0207689_10018782 3300025942 Bacteria 5830
234 Ga0207689_10019465 3300025942 Bacteria 5721
235 Ga0207689_10036519 3300025942 Bacteria 4078
236 Ga0207689_10083907 3300025942 Bacteria 2619
237 Ga0207689_10115480 3300025942 Bacteria 2207
238 Ga0207661_10015703 3300025944 Bacteria 5578
239 Ga0207661_10096154 3300025944 Bacteria 2478
240 Ga0207679_10000550 3300025945 Bacteria 25168
241 Ga0207679_10015256 3300025945 Bacteria 5070
242 Ga0207679_10022602 3300025945 Bacteria 4285
243 Ga0207679_10032980 3300025945 Bacteria 3641
244 Ga0207667_10085974 3300025949 Bacteria 3255
245 Ga0207651_10039470 3300025960 Bacteria 3114
246 Ga0207712_10025420 3300025961 Bacteria 3934
247 Ga0207712_10028830 3300025961 Bacteria 3717
248 Ga0207712_10034253 3300025961 Bacteria 3440
249 Ga0207712_10141964 3300025961 Bacteria 1844
250 Ga0207640_10032814 3300025981 Unclassified 3223
251 Ga0207640_10137646 3300025981 Bacteria 1775
252 Ga0207640_10160415 3300025981 Bacteria 1663
253 Ga0207658_10074813 3300025986 Bacteria 2575
254 Ga0207658_10084852 3300025986 Bacteria 2438
255 Ga0207658_10088697 3300025986 Bacteria 2392
256 Ga0207658_10095999 3300025986 Bacteria 2311
257 Ga0207658_10121851 3300025986 Bacteria 2081
258 Ga0207677_10003096 3300026023 Bacteria 8772
259 Ga0207677_10022812 3300026023 Bacteria 3854
260 Ga0207677_10032028 3300026023 Bacteria 3375
261 Ga0207703_10006148 3300026035 Bacteria 9608
262 Ga0207639_10002438 3300026041 Bacteria 12502
263 Ga0207639_10055889 3300026041 Bacteria 3023
264 Ga0207702_10054885 3300026078 Bacteria 3377
265 Ga0207641_10000200 3300026088 Bacteria 80556
266 Ga0207641_10000418 3300026088 Bacteria 49680
267 Ga0207641_10014181 3300026088 Bacteria 6531
268 Ga0207641_10133272 3300026088 Bacteria 2234
269 Ga0207641_10147434 3300026088 Bacteria 2129
270 Ga0207641_10204305 3300026088 Bacteria 1823
271 Ga0207648_10002836 3300026089 Bacteria 18380
272 Ga0207648_10003952 3300026089 Bacteria 15418
273 Ga0207648_10029717 3300026089 Bacteria 4846
274 Ga0207648_10040717 3300026089 Bacteria 4082
275 Ga0207676_10005337 3300026095 Bacteria 9102
276 Ga0207676_10104258 3300026095 Unclassified 2358
277 Ga0207674_10005175 3300026116 Bacteria 15536
278 Ga0207674_10019902 3300026116 Bacteria 7262
279 Ga0207674_10333074 3300026116 Bacteria 1468
280 Ga0207675_100042283 3300026118 Bacteria 4254
281 Ga0207675_100083918 3300026118 Unclassified 2989
282 Ga0207675_100119599 3300026118 Bacteria 2492
283 Ga0207675_100234608 3300026118 Bacteria 1771
284 Ga0207683_10037884 3300026121 Unclassified 4200
285 Ga0207683_10232144 3300026121 Bacteria 1683
286 Ga0207698_10006254 3300026142 Bacteria 7408
287 Ga0207698_10072396 3300026142 Bacteria 2740
288 Ga0207698_10117178 3300026142 Bacteria 2246
289 Ga0268266_10171266 3300028379 Unclassified 1971
290 Ga0268266_10336738 3300028379 Bacteria 1415
291 Ga0268265_10049535 3300028380 Bacteria 3160
292 Ga0268264_10001343 3300028381 Bacteria 23104
293 Ga0268264_10015418 3300028381 Bacteria 6267
294 Ga0268264_10017050 3300028381 Bacteria 5947
295 Ga0268264_10146911 3300028381 Unclassified 2109
296 Ga0265318_10016158 3300028577 Bacteria 3088
297 Ga0307515_10000002 3300028794 Bacteria 1231751
298 Ga0307515_10000074 3300028794 Bacteria 229874
299 Ga0265338_10000563 3300028800 Bacteria 65172
300 Ga0265338_10069336 3300028800 Bacteria 3030
301 Ga0265324_10003958 3300029957 Bacteria 6856
302 Ga0265328_10046794 3300031239 Bacteria 1590
303 Ga0265320_10052319 3300031240 Bacteria 1978
304 Ga0265327_10000385 3300031251 Bacteria 83048
305 Ga0265327_10000648 3300031251 Bacteria 56244
306 Ga0307509_10032929 3300031507 Bacteria 5708
307 Ga0307509_10170450 3300031507 Bacteria 2057
308 Ga0307408_100000130 3300031548 Bacteria 83482
309 Ga0307508_10000354 3300031616 Bacteria 55733
310 Ga0265314_10034278 3300031711 Bacteria 3712
311 Ga0307414_10000082 3300032004 Bacteria 87561
312 Ga0307414_10143547 3300032004 Bacteria 1872
313 Ga0307411_10003688 3300032005 Bacteria 7172
314 Ga0373955_0047394 3300035172 Bacteria 2327
315 Ga0395901_0005018 3300038443 Bacteria 13365
316 Ga0436365_0473715 3300039437 Bacteria 54513
317 Ga0451577_0019338 3300042876 Bacteria 6263
318 Ga0451577_0035444 3300042876 Bacteria 4495
319 Ga0466972_0000046 3300044658 Bacteria 127926
320 Ga0453683_0103148 3300044673 Bacteria 1791
321 Ga0453684_0012316 3300044712 Bacteria 14153
322 Ga0453684_0021588 3300044712 Bacteria 9606
323 Ga0453684_0029634 3300044712 Bacteria 7760
324 Ga0453684_0049322 3300044712 Bacteria 5554
325 Ga0453684_0093674 3300044712 Bacteria 3699
326 Ga0453684_0100853 3300044712 Bacteria 3533
327 Ga0453684_0323883 3300044712 Bacteria 1744
328 Ga0453684_0499028 3300044712 Unclassified 1348
329 Ga0466970_0029642 3300044765 Bacteria 2882
330 Ga0451576_0001299 3300045051 Bacteria 43263
331 Ga0451576_0010497 3300045051 Bacteria 10618
332 Ga0451576_0034940 3300045051 Bacteria 5335
333 Ga0495650_0019482 3300046471 Bacteria 3337
334 Ga0495628_0029489 3300046516 Bacteria 4447
335 Ga0495630_0064269 3300046517 Bacteria 2757
336 Ga0495643_0016475 3300046522 Bacteria 4341
337 Ga0495587_0030292 3300046536 Bacteria 3282
338 Ga0495667_0088669 3300046559 Bacteria 2005
339 Ga0495668_0001660 3300046616 Bacteria 20744
340 Ga0495634_0080292 3300046642 Bacteria 2135
341 Ga0495672_0026506 3300047320 Unclassified 3698
342 Ga0495672_0092231 3300047320 Unclassified 1661
343 Ga0495686_0000265 3300047472 Bacteria 93838
344 Ga0496101_0008092 3300048904 Bacteria 6858
345 Ga0496104_0356015 3300048907 Bacteria 1376
346 Ga0496124_0165502 3300048927 Bacteria 1719
347 Ga0501298_000638 3300049521 Bacteria 4824
348 Ga0501032_0000933 3300049569 Bacteria 23653
349 Ga0501034_0000043 3300049571 Bacteria 229049
350 Ga0501034_0134831 3300049571 Bacteria 2450
351 Ga0501036_0184569 3300049572 Bacteria 1755
352 Ga0501037_0008518 3300049573 Bacteria 7523
353 Ga0501038_0010723 3300049574 Bacteria 8377
354 Ga0501038_0057932 3300049574 Bacteria 3324
355 Ga0501043_0013687 3300049579 Bacteria 6350
356 Ga0501043_0021605 3300049579 Bacteria 5046
357 Ga0501046_0004351 3300049580 Bacteria 12892
358 Ga0501047_0028837 3300049581 Bacteria 5354
359 Ga0501068_0070659 3300049584 Bacteria 2130
360 Ga0501073_0000542 3300049589 Bacteria 26583
361 Ga0501074_0000668 3300049590 Bacteria 21402
362 Ga0501217_002334 3300049661 Bacteria 3722
363 Ga0501240_007862 3300049673 Unclassified 1352
364 Ga0501219_000086 3300049703 Bacteria 15961
365 Ga0501221_000438 3300049704 Bacteria 6465
366 Ga0501079_0096383 3300049741 Bacteria 2293
367 Ga0501035_0028023 3300049822 Bacteria 5144
368 Ga0501044_0078089 3300049823 Bacteria 3355
369 Ga0501284_00211 3300050005 Bacteria 3591
370 nmdc:mga0k408_36366_c1 3300050493 Bacteria 2826
371 nmdc:mga09592_5730_c1 3300050508 Bacteria 10128
372 nmdc:mga08y16_177269_c1 3300050511 Bacteria 2213
373 nmdc:mga08y16_278404_c1 3300050511 Bacteria 1726
374 Ga0495619_0130045 3300053085 Bacteria 1730
375 Ga0500641_0034137 3300053096 Bacteria 2023
376 Ga0500562_000096 3300053108 Bacteria 33894
377 Ga0500568_0001611 3300053139 Bacteria 14278
378 Ga0500588_0000493 3300053146 Bacteria 6269
379 Ga0500616_0014970 3300053153 Bacteria 4445
380 Ga0500616_0032481 3300053153 Unclassified 2854
381 Ga0500622_0000214 3300053156 Bacteria 61277
382 Ga0500611_000043 3300053727 Bacteria 58183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10333074 Ga0207674_103330741 361
2 3300049673 Ga0501240_007862 Ga0501240_007862_36_1298 375
3 3300025918 Ga0207662_10101209 Ga0207662_101012091 388
4 3300045051 Ga0451576_0001299 Ga0451576_0001299_37993_39234 396
5 3300005367 Ga0070667_100001632 Ga0070667_1000016323 403
6 3300005617 Ga0068859_100053343 Ga0068859_1000533432 403
7 3300005843 Ga0068860_100009032 Ga0068860_1000090323 403
8 3300006931 Ga0097620_100053343 Ga0097620_1000533432 403
9 3300009176 Ga0105242_10002236 Ga0105242_100022368 403
10 3300014969 Ga0157376_10112929 Ga0157376_101129293 403
11 3300025934 Ga0207686_10001617 Ga0207686_100016174 403
12 3300026088 Ga0207641_10204305 Ga0207641_102043052 403
13 3300005563 Ga0068855_100290164 Ga0068855_1002901641 404
14 3300044712 Ga0453684_0021588 Ga0453684_0021588_3080_4372 404
15 3300005331 Ga0070670_100072136 Ga0070670_1000721362 405
16 3300005841 Ga0068863_100096507 Ga0068863_1000965072 405
17 3300025925 Ga0207650_10031763 Ga0207650_100317632 405
18 3300026088 Ga0207641_10014181 Ga0207641_100141812 405
19 3300038443 Ga0395901_0005018 Ga0395901_0005018_2829_4073 405
20 3300046642 Ga0495634_0080292 Ga0495634_0080292_13_1266 410
21 3300013296 Ga0157374_10161759 Ga0157374_101617592 411
22 3300028800 Ga0265338_10000563 Ga0265338_1000056352 411
23 3300045051 Ga0451576_0034940 Ga0451576_0034940_636_1880 412
24 3300005614 Ga0068856_100071023 Ga0068856_1000710234 414
25 3300026078 Ga0207702_10054885 Ga0207702_100548854 414
26 3300028577 Ga0265318_10016158 Ga0265318_100161582 414
27 3300028800 Ga0265338_10069336 Ga0265338_100693363 414
28 3300029957 Ga0265324_10003958 Ga0265324_100039585 414
29 3300031239 Ga0265328_10046794 Ga0265328_100467942 414
30 3300031240 Ga0265320_10052319 Ga0265320_100523192 414
31 3300031711 Ga0265314_10034278 Ga0265314_100342783 414
32 3300042876 Ga0451577_0019338 Ga0451577_0019338_3808_5070 414
33 3300044712 Ga0453684_0049322 Ga0453684_0049322_766_2046 414
34 3300044712 Ga0453684_0499028 Ga0453684_0499028_58_1323 414
35 3300006163 Ga0070715_10040430 Ga0070715_100404302 415
36 3300031548 Ga0307408_100000130 Ga0307408_1000001305 416
37 3300044712 Ga0453684_0029634 Ga0453684_0029634_6226_7497 416
38 3300045051 Ga0451576_0010497 Ga0451576_0010497_4689_5981 416
39 3300005289 Ga0065704_10132426 Ga0065704_101324261 417
40 3300005577 Ga0068857_100105244 Ga0068857_1001052442 417
41 3300009093 Ga0105240_10000037 Ga0105240_10000037194 417
42 3300009545 Ga0105237_10092000 Ga0105237_100920002 417
43 3300010375 Ga0105239_10005001 Ga0105239_100050015 417
44 3300013297 Ga0157378_10044230 Ga0157378_100442302 417
45 3300025913 Ga0207695_10000092 Ga0207695_1000009252 417
46 3300025925 Ga0207650_10061518 Ga0207650_100615182 417
47 3300032005 Ga0307411_10003688 Ga0307411_100036882 417
48 3300042876 Ga0451577_0035444 Ga0451577_0035444_1897_3171 417
49 3300044712 Ga0453684_0012316 Ga0453684_0012316_11656_12939 417
50 3300044712 Ga0453684_0093674 Ga0453684_0093674_834_2096 417
51 3300044712 Ga0453684_0323883 Ga0453684_0323883_83_1357 417
52 3300047472 Ga0495686_0000265 Ga0495686_0000265_51125_52432 417
53 3300005338 Ga0068868_100002150 Ga0068868_1000021504 418
54 3300005355 Ga0070671_100001926 Ga0070671_1000019263 418
55 3300005367 Ga0070667_100005157 Ga0070667_1000051574 418
56 3300005456 Ga0070678_100156535 Ga0070678_1001565351 418
57 3300005563 Ga0068855_100430569 Ga0068855_1004305691 418
58 3300005843 Ga0068860_100000855 Ga0068860_10000085529 418
59 3300006237 Ga0097621_100002030 Ga0097621_1000020305 418
60 3300006358 Ga0068871_100000063 Ga0068871_10000006334 418
61 3300010375 Ga0105239_10121771 Ga0105239_101217713 418
62 3300013297 Ga0157378_10037371 Ga0157378_100373713 418
63 3300013306 Ga0163162_10002273 Ga0163162_100022737 418
64 3300017792 Ga0163161_10017765 Ga0163161_100177654 418
65 3300025931 Ga0207644_10019615 Ga0207644_100196155 418
66 3300026023 Ga0207677_10003096 Ga0207677_100030962 418
67 3300028381 Ga0268264_10001343 Ga0268264_100013437 418
68 3300032004 Ga0307414_10000082 Ga0307414_1000008210 418
69 3300032004 Ga0307414_10143547 Ga0307414_101435472 418
70 3300047320 Ga0495672_0092231 Ga0495672_0092231_25_1290 418
71 iso_pu_bacteria 2919692658 2919693552 418
72 3300009545 Ga0105237_10246844 Ga0105237_102468442 419
73 3300044673 Ga0453683_0103148 Ga0453683_0103148_364_1686 419
74 iso_pu_bacteria 2818991444 2819589083 419
75 iso_pu_bacteria 2929154850 2929156395 419
76 3300005290 Ga0065712_10127910 Ga0065712_101279101 420
77 3300005364 Ga0070673_100263036 Ga0070673_1002630361 420
78 3300005367 Ga0070667_100205942 Ga0070667_1002059421 420
79 3300005466 Ga0070685_10036760 Ga0070685_100367603 420
80 3300005841 Ga0068863_100028336 Ga0068863_1000283362 420
81 3300005843 Ga0068860_100141415 Ga0068860_1001414151 420
82 3300005985 Ga0081539_10036867 Ga0081539_100368674 420
83 3300011119 Ga0105246_10011283 Ga0105246_100112833 420
84 3300013297 Ga0157378_10007682 Ga0157378_100076826 420
85 3300013297 Ga0157378_10133515 Ga0157378_101335153 420
86 3300013297 Ga0157378_10257480 Ga0157378_102574801 420
87 3300013306 Ga0163162_10004720 Ga0163162_100047205 420
88 3300013306 Ga0163162_10005320 Ga0163162_100053208 420
89 3300013308 Ga0157375_10001429 Ga0157375_100014297 420
90 3300014325 Ga0163163_10010037 Ga0163163_100100376 420
91 3300014969 Ga0157376_10000481 Ga0157376_100004814 420
92 3300025908 Ga0207643_10001857 Ga0207643_100018577 420
93 3300025918 Ga0207662_10076203 Ga0207662_100762032 420
94 3300025925 Ga0207650_10011124 Ga0207650_100111244 420
95 3300025940 Ga0207691_10010443 Ga0207691_100104437 420
96 3300026088 Ga0207641_10000418 Ga0207641_100004185 420
97 3300048904 Ga0496101_0008092 Ga0496101_0008092_489_1751 420
98 3300048907 Ga0496104_0356015 Ga0496104_0356015_20_1282 420
99 3300050511 nmdc:mga08y16_177269_c1 nmdc:mga08y16_177269_c1_744_2006 420
100 3300053153 Ga0500616_0014970 Ga0500616_0014970_2278_3582 420
101 3300003322 rootL2_10340936 rootL2_103409362 421
102 3300005328 Ga0070676_10002090 Ga0070676_100020903 421
103 3300005329 Ga0070683_100028042 Ga0070683_1000280422 421
104 3300005331 Ga0070670_100283406 Ga0070670_1002834061 421
105 3300005334 Ga0068869_100053707 Ga0068869_1000537071 421
106 3300005334 Ga0068869_100104319 Ga0068869_1001043191 421
107 3300005335 Ga0070666_10032628 Ga0070666_100326282 421
108 3300005336 Ga0070680_100027225 Ga0070680_1000272253 421
109 3300005356 Ga0070674_100016436 Ga0070674_1000164363 421
110 3300005367 Ga0070667_100111976 Ga0070667_1001119761 421
111 3300005456 Ga0070678_100017614 Ga0070678_1000176142 421
112 3300005458 Ga0070681_10140701 Ga0070681_101407012 421
113 3300005459 Ga0068867_100057514 Ga0068867_1000575142 421
114 3300005471 Ga0070698_100001722 Ga0070698_10000172211 421
115 3300005471 Ga0070698_100038718 Ga0070698_1000387183 421
116 3300005530 Ga0070679_100005964 Ga0070679_1000059643 421
117 3300005535 Ga0070684_100023094 Ga0070684_1000230942 421
118 3300005535 Ga0070684_100184866 Ga0070684_1001848662 421
119 3300005548 Ga0070665_100011209 Ga0070665_1000112094 421
120 3300005563 Ga0068855_100106339 Ga0068855_1001063392 421
121 3300005564 Ga0070664_100003473 Ga0070664_1000034738 421
122 3300005614 Ga0068856_100076222 Ga0068856_1000762222 421
123 3300005616 Ga0068852_100029345 Ga0068852_1000293455 421
124 3300005616 Ga0068852_100304484 Ga0068852_1003044842 421
125 3300005617 Ga0068859_100397716 Ga0068859_1003977162 421
126 3300005834 Ga0068851_10012528 Ga0068851_100125283 421
127 3300005843 Ga0068860_100019426 Ga0068860_1000194263 421
128 3300006195 Ga0075366_10005879 Ga0075366_100058798 421
129 3300006358 Ga0068871_100017181 Ga0068871_1000171812 421
130 3300006844 Ga0075428_100016828 Ga0075428_1000168285 421
131 3300006880 Ga0075429_100011429 Ga0075429_1000114295 421
132 3300006881 Ga0068865_100002013 Ga0068865_1000020134 421
133 3300006931 Ga0097620_100397733 Ga0097620_1003977332 421
134 3300009093 Ga0105240_10190363 Ga0105240_101903633 421
135 3300009174 Ga0105241_10026934 Ga0105241_100269344 421
136 3300009174 Ga0105241_10110185 Ga0105241_101101852 421
137 3300009176 Ga0105242_10033141 Ga0105242_100331413 421
138 3300009545 Ga0105237_10075501 Ga0105237_100755012 421
139 3300009553 Ga0105249_10040315 Ga0105249_100403153 421
140 3300009553 Ga0105249_10046190 Ga0105249_100461901 421
141 3300010375 Ga0105239_10060996 Ga0105239_100609963 421
142 3300011119 Ga0105246_10102153 Ga0105246_101021532 421
143 3300013100 Ga0157373_10015569 Ga0157373_100155693 421
144 3300013102 Ga0157371_10029224 Ga0157371_100292243 421
145 3300013102 Ga0157371_10042128 Ga0157371_100421281 421
146 3300013102 Ga0157371_10046424 Ga0157371_100464243 421
147 3300013297 Ga0157378_10079881 Ga0157378_100798812 421
148 3300013306 Ga0163162_10005904 Ga0163162_100059043 421
149 3300013306 Ga0163162_10240411 Ga0163162_102404112 421
150 3300013307 Ga0157372_10122507 Ga0157372_101225072 421
151 3300014325 Ga0163163_10034455 Ga0163163_100344554 421
152 3300014745 Ga0157377_10042879 Ga0157377_100428791 421
153 3300014745 Ga0157377_10062799 Ga0157377_100627991 421
154 3300025901 Ga0207688_10066933 Ga0207688_100669331 421
155 3300025903 Ga0207680_10068412 Ga0207680_100684122 421
156 3300025907 Ga0207645_10017806 Ga0207645_100178061 421
157 3300025909 Ga0207705_10045264 Ga0207705_100452643 421
158 3300025911 Ga0207654_10117923 Ga0207654_101179231 421
159 3300025917 Ga0207660_10051677 Ga0207660_100516772 421
160 3300025921 Ga0207652_10067615 Ga0207652_100676151 421
161 3300025931 Ga0207644_10209036 Ga0207644_102090361 421
162 3300025934 Ga0207686_10028123 Ga0207686_100281233 421
163 3300025940 Ga0207691_10037661 Ga0207691_100376612 421
164 3300025940 Ga0207691_10046152 Ga0207691_100461523 421
165 3300025942 Ga0207689_10004594 Ga0207689_1000459412 421
166 3300025942 Ga0207689_10083907 Ga0207689_100839072 421
167 3300025942 Ga0207689_10115480 Ga0207689_101154802 421
168 3300025945 Ga0207679_10015256 Ga0207679_100152565 421
169 3300025945 Ga0207679_10022602 Ga0207679_100226022 421
170 3300025949 Ga0207667_10085974 Ga0207667_100859742 421
171 3300025960 Ga0207651_10039470 Ga0207651_100394702 421
172 3300025961 Ga0207712_10025420 Ga0207712_100254203 421
173 3300025981 Ga0207640_10160415 Ga0207640_101604152 421
174 3300025986 Ga0207658_10095999 Ga0207658_100959991 421
175 3300026023 Ga0207677_10032028 Ga0207677_100320282 421
176 3300026089 Ga0207648_10002836 Ga0207648_100028364 421
177 3300026118 Ga0207675_100042283 Ga0207675_1000422831 421
178 3300026118 Ga0207675_100083918 Ga0207675_1000839182 421
179 3300026142 Ga0207698_10072396 Ga0207698_100723962 421
180 3300026142 Ga0207698_10117178 Ga0207698_101171782 421
181 3300028379 Ga0268266_10336738 Ga0268266_103367381 421
182 3300028381 Ga0268264_10017050 Ga0268264_100170506 421
183 3300044712 Ga0453684_0100853 Ga0453684_0100853_532_1923 421
184 3300046471 Ga0495650_0019482 Ga0495650_0019482_922_2187 421
185 3300048927 Ga0496124_0165502 Ga0496124_0165502_66_1337 421
186 3300049571 Ga0501034_0000043 Ga0501034_0000043_156063_157364 421
187 3300050493 nmdc:mga0k408_36366_c1 nmdc:mga0k408_36366_c1_297_1583 421
188 3300050508 nmdc:mga09592_5730_c1 nmdc:mga09592_5730_c1_401_1666 421
189 3300050511 nmdc:mga08y16_278404_c1 nmdc:mga08y16_278404_c1_178_1443 421
190 3300005328 Ga0070676_10029292 Ga0070676_100292924 422
191 3300005335 Ga0070666_10000042 Ga0070666_100000423 422
192 3300005338 Ga0068868_100129699 Ga0068868_1001296991 422
193 3300005338 Ga0068868_100186210 Ga0068868_1001862101 422
194 3300005344 Ga0070661_100005681 Ga0070661_1000056818 422
195 3300005344 Ga0070661_100122703 Ga0070661_1001227032 422
196 3300005347 Ga0070668_100087609 Ga0070668_1000876092 422
197 3300005355 Ga0070671_100013574 Ga0070671_1000135742 422
198 3300005366 Ga0070659_100006626 Ga0070659_1000066265 422
199 3300005367 Ga0070667_100026373 Ga0070667_1000263733 422
200 3300005367 Ga0070667_100028621 Ga0070667_1000286213 422
201 3300005367 Ga0070667_100145211 Ga0070667_1001452112 422
202 3300005456 Ga0070678_100074018 Ga0070678_1000740182 422
203 3300005457 Ga0070662_100007916 Ga0070662_1000079165 422
204 3300005535 Ga0070684_100002706 Ga0070684_1000027064 422
205 3300005535 Ga0070684_100004020 Ga0070684_1000040205 422
206 3300005539 Ga0068853_100134922 Ga0068853_1001349221 422
207 3300005564 Ga0070664_100168742 Ga0070664_1001687423 422
208 3300005577 Ga0068857_100001120 Ga0068857_10000112022 422
209 3300005577 Ga0068857_100042981 Ga0068857_1000429814 422
210 3300005577 Ga0068857_100051539 Ga0068857_1000515395 422
211 3300005578 Ga0068854_100009879 Ga0068854_1000098795 422
212 3300005578 Ga0068854_100050648 Ga0068854_1000506482 422
213 3300005578 Ga0068854_100150288 Ga0068854_1001502882 422
214 3300005616 Ga0068852_100001468 Ga0068852_10000146810 422
215 3300005616 Ga0068852_100051305 Ga0068852_1000513053 422
216 3300005616 Ga0068852_100086593 Ga0068852_1000865931 422
217 3300005617 Ga0068859_100000200 Ga0068859_1000002003 422
218 3300005617 Ga0068859_100091525 Ga0068859_1000915253 422
219 3300005618 Ga0068864_100016496 Ga0068864_1000164963 422
220 3300005618 Ga0068864_100034372 Ga0068864_1000343722 422
221 3300005618 Ga0068864_100123494 Ga0068864_1001234941 422
222 3300005618 Ga0068864_100135122 Ga0068864_1001351223 422
223 3300005841 Ga0068863_100030624 Ga0068863_1000306242 422
224 3300005842 Ga0068858_100133394 Ga0068858_1001333943 422
225 3300005843 Ga0068860_100009630 Ga0068860_1000096309 422
226 3300005843 Ga0068860_100085362 Ga0068860_1000853622 422
227 3300005844 Ga0068862_100025450 Ga0068862_1000254503 422
228 3300006163 Ga0070715_10052008 Ga0070715_100520081 422
229 3300006237 Ga0097621_100138344 Ga0097621_1001383442 422
230 3300006237 Ga0097621_100282420 Ga0097621_1002824201 422
231 3300006358 Ga0068871_100011416 Ga0068871_1000114165 422
232 3300006358 Ga0068871_100128299 Ga0068871_1001282992 422
233 3300006844 Ga0075428_100006924 Ga0075428_1000069247 422
234 3300006846 Ga0075430_100155589 Ga0075430_1001555892 422
235 3300006847 Ga0075431_100057528 Ga0075431_1000575282 422
236 3300006881 Ga0068865_100170139 Ga0068865_1001701392 422
237 3300006931 Ga0097620_100000200 Ga0097620_1000002003 422
238 3300006931 Ga0097620_100091528 Ga0097620_1000915283 422
239 3300009098 Ga0105245_10081101 Ga0105245_100811013 422
240 3300009101 Ga0105247_10003739 Ga0105247_100037397 422
241 3300009101 Ga0105247_10004596 Ga0105247_100045964 422
242 3300009147 Ga0114129_10081161 Ga0114129_100811615 422
243 3300009174 Ga0105241_10008352 Ga0105241_100083525 422
244 3300009545 Ga0105237_10032263 Ga0105237_100322633 422
245 3300009553 Ga0105249_10010845 Ga0105249_100108454 422
246 3300013100 Ga0157373_10080696 Ga0157373_100806962 422
247 3300013100 Ga0157373_10113055 Ga0157373_101130551 422
248 3300013105 Ga0157369_10071352 Ga0157369_100713523 422
249 3300013296 Ga0157374_10075460 Ga0157374_100754602 422
250 3300013306 Ga0163162_10066579 Ga0163162_100665792 422
251 3300013306 Ga0163162_10142890 Ga0163162_101428903 422
252 3300013307 Ga0157372_10042000 Ga0157372_100420003 422
253 3300013307 Ga0157372_10072654 Ga0157372_100726543 422
254 3300013307 Ga0157372_10091002 Ga0157372_100910022 422
255 3300013308 Ga0157375_10009468 Ga0157375_100094685 422
256 3300013308 Ga0157375_10109649 Ga0157375_101096492 422
257 3300014325 Ga0163163_10000078 Ga0163163_1000007811 422
258 3300014325 Ga0163163_10088287 Ga0163163_100882873 422
259 3300014325 Ga0163163_10324520 Ga0163163_103245201 422
260 3300014969 Ga0157376_10010591 Ga0157376_100105913 422
261 3300017792 Ga0163161_10010918 Ga0163161_100109184 422
262 3300021384 Ga0213876_10003829 Ga0213876_1000382910 422
263 3300025899 Ga0207642_10007803 Ga0207642_100078033 422
264 3300025900 Ga0207710_10004545 Ga0207710_100045454 422
265 3300025903 Ga0207680_10000448 Ga0207680_100004483 422
266 3300025903 Ga0207680_10050601 Ga0207680_100506013 422
267 3300025904 Ga0207647_10000094 Ga0207647_1000009465 422
268 3300025907 Ga0207645_10029115 Ga0207645_100291153 422
269 3300025907 Ga0207645_10036081 Ga0207645_100360814 422
270 3300025911 Ga0207654_10059584 Ga0207654_100595842 422
271 3300025914 Ga0207671_10006273 Ga0207671_100062737 422
272 3300025920 Ga0207649_10028442 Ga0207649_100284422 422
273 3300025920 Ga0207649_10036474 Ga0207649_100364744 422
274 3300025927 Ga0207687_10088808 Ga0207687_100888082 422
275 3300025931 Ga0207644_10246493 Ga0207644_102464932 422
276 3300025932 Ga0207690_10018594 Ga0207690_100185942 422
277 3300025932 Ga0207690_10019288 Ga0207690_100192883 422
278 3300025933 Ga0207706_10004992 Ga0207706_100049927 422
279 3300025938 Ga0207704_10012451 Ga0207704_100124514 422
280 3300025940 Ga0207691_10031091 Ga0207691_100310913 422
281 3300025942 Ga0207689_10018782 Ga0207689_100187823 422
282 3300025942 Ga0207689_10019465 Ga0207689_100194655 422
283 3300025942 Ga0207689_10036519 Ga0207689_100365194 422
284 3300025944 Ga0207661_10015703 Ga0207661_100157034 422
285 3300025945 Ga0207679_10000550 Ga0207679_100005503 422
286 3300025945 Ga0207679_10032980 Ga0207679_100329802 422
287 3300025961 Ga0207712_10028830 Ga0207712_100288302 422
288 3300025961 Ga0207712_10034253 Ga0207712_100342531 422
289 3300025961 Ga0207712_10141964 Ga0207712_101419641 422
290 3300025981 Ga0207640_10032814 Ga0207640_100328142 422
291 3300025981 Ga0207640_10137646 Ga0207640_101376462 422
292 3300025986 Ga0207658_10074813 Ga0207658_100748131 422
293 3300025986 Ga0207658_10084852 Ga0207658_100848523 422
294 3300025986 Ga0207658_10088697 Ga0207658_100886972 422
295 3300025986 Ga0207658_10121851 Ga0207658_101218512 422
296 3300026023 Ga0207677_10022812 Ga0207677_100228122 422
297 3300026035 Ga0207703_10006148 Ga0207703_100061483 422
298 3300026041 Ga0207639_10002438 Ga0207639_1000243811 422
299 3300026088 Ga0207641_10000200 Ga0207641_1000020041 422
300 3300026088 Ga0207641_10133272 Ga0207641_101332722 422
301 3300026089 Ga0207648_10003952 Ga0207648_100039528 422
302 3300026089 Ga0207648_10040717 Ga0207648_100407173 422
303 3300026095 Ga0207676_10005337 Ga0207676_100053375 422
304 3300026095 Ga0207676_10104258 Ga0207676_101042582 422
305 3300026116 Ga0207674_10005175 Ga0207674_100051756 422
306 3300026116 Ga0207674_10019902 Ga0207674_100199025 422
307 3300026118 Ga0207675_100119599 Ga0207675_1001195993 422
308 3300026118 Ga0207675_100234608 Ga0207675_1002346082 422
309 3300026121 Ga0207683_10037884 Ga0207683_100378842 422
310 3300026121 Ga0207683_10232144 Ga0207683_102321442 422
311 3300026142 Ga0207698_10006254 Ga0207698_100062544 422
312 3300028379 Ga0268266_10171266 Ga0268266_101712662 422
313 3300028380 Ga0268265_10049535 Ga0268265_100495352 422
314 3300028381 Ga0268264_10015418 Ga0268264_100154185 422
315 3300028381 Ga0268264_10146911 Ga0268264_101469112 422
316 3300028794 Ga0307515_10000074 Ga0307515_1000007493 422
317 3300031507 Ga0307509_10032929 Ga0307509_100329292 422
318 3300031507 Ga0307509_10170450 Ga0307509_101704502 422
319 3300031616 Ga0307508_10000354 Ga0307508_1000035429 422
320 3300035172 Ga0373955_0047394 Ga0373955_0047394_678_1967 422
321 3300039437 Ga0436365_0473715 Ga0436365_0473715_13148_14416 422
322 3300044658 Ga0466972_0000046 Ga0466972_0000046_6290_7603 422
323 3300044765 Ga0466970_0029642 Ga0466970_0029642_1232_2545 422
324 3300046516 Ga0495628_0029489 Ga0495628_0029489_341_1630 422
325 3300046517 Ga0495630_0064269 Ga0495630_0064269_932_2221 422
326 3300046522 Ga0495643_0016475 Ga0495643_0016475_733_2001 422
327 3300046536 Ga0495587_0030292 Ga0495587_0030292_1312_2601 422
328 3300046559 Ga0495667_0088669 Ga0495667_0088669_43_1332 422
329 3300049521 Ga0501298_000638 Ga0501298_000638_518_1843 422
330 3300049569 Ga0501032_0000933 Ga0501032_0000933_18759_20027 422
331 3300049571 Ga0501034_0134831 Ga0501034_0134831_591_1859 422
332 3300049572 Ga0501036_0184569 Ga0501036_0184569_27_1295 422
333 3300049573 Ga0501037_0008518 Ga0501037_0008518_5483_6751 422
334 3300049574 Ga0501038_0010723 Ga0501038_0010723_1918_3186 422
335 3300049574 Ga0501038_0057932 Ga0501038_0057932_323_1591 422
336 3300049579 Ga0501043_0013687 Ga0501043_0013687_868_2136 422
337 3300049579 Ga0501043_0021605 Ga0501043_0021605_2421_3809 422
338 3300049580 Ga0501046_0004351 Ga0501046_0004351_10903_12171 422
339 3300049581 Ga0501047_0028837 Ga0501047_0028837_3811_5142 422
340 3300049584 Ga0501068_0070659 Ga0501068_0070659_839_2107 422
341 3300049589 Ga0501073_0000542 Ga0501073_0000542_3085_4353 422
342 3300049590 Ga0501074_0000668 Ga0501074_0000668_8170_9438 422
343 3300049661 Ga0501217_002334 Ga0501217_002334_309_1634 422
344 3300049704 Ga0501221_000438 Ga0501221_000438_98_1423 422
345 3300049741 Ga0501079_0096383 Ga0501079_0096383_451_1719 422
346 3300049822 Ga0501035_0028023 Ga0501035_0028023_571_1902 422
347 3300049823 Ga0501044_0078089 Ga0501044_0078089_1046_2314 422
348 3300053085 Ga0495619_0130045 Ga0495619_0130045_423_1712 422
349 3300053108 Ga0500562_000096 Ga0500562_000096_7631_8911 422
350 3300053139 Ga0500568_0001611 Ga0500568_0001611_11448_12782 422
351 3300053146 Ga0500588_0000493 Ga0500588_0000493_3325_4605 422
352 3300053153 Ga0500616_0032481 Ga0500616_0032481_436_1716 422
353 3300005354 Ga0070675_100165197 Ga0070675_1001651971 423
354 3300005455 Ga0070663_100028012 Ga0070663_1000280122 423
355 3300005530 Ga0070679_100157394 Ga0070679_1001573941 423
356 3300005535 Ga0070684_100059698 Ga0070684_1000596984 423
357 3300005564 Ga0070664_100097612 Ga0070664_1000976123 423
358 3300005841 Ga0068863_100042277 Ga0068863_1000422772 423
359 3300013296 Ga0157374_10145703 Ga0157374_101457032 423
360 3300013297 Ga0157378_10051544 Ga0157378_100515442 423
361 3300013308 Ga0157375_10156072 Ga0157375_101560722 423
362 3300025944 Ga0207661_10096154 Ga0207661_100961543 423
363 3300026088 Ga0207641_10147434 Ga0207641_101474341 423
364 3300031251 Ga0265327_10000385 Ga0265327_1000038551 423
365 3300031251 Ga0265327_10000648 Ga0265327_1000064830 423
366 3300047320 Ga0495672_0026506 Ga0495672_0026506_1456_2727 423
367 3300053096 Ga0500641_0034137 Ga0500641_0034137_432_1763 423
368 3300053156 Ga0500622_0000214 Ga0500622_0000214_2242_3531 423
369 3300005337 Ga0070682_100000124 Ga0070682_10000012424 424
370 3300005539 Ga0068853_100011059 Ga0068853_1000110596 424
371 3300006237 Ga0097621_100001776 Ga0097621_1000017765 424
372 3300006358 Ga0068871_100117165 Ga0068871_1001171653 424
373 3300009098 Ga0105245_10058466 Ga0105245_100584664 424
374 3300013105 Ga0157369_10267329 Ga0157369_102673292 424
375 3300013297 Ga0157378_10010308 Ga0157378_100103086 424
376 3300025927 Ga0207687_10163931 Ga0207687_101639311 424
377 3300026041 Ga0207639_10055889 Ga0207639_100558893 424
378 3300028794 Ga0307515_10000002 Ga0307515_10000002668 424
379 3300049703 Ga0501219_000086 Ga0501219_000086_13775_15100 424
380 3300050005 Ga0501284_00211 Ga0501284_00211_1483_2808 424
381 3300053727 Ga0500611_000043 Ga0500611_000043_34901_36181 424
382 3300002077 JGI24744J21845_10002642 JGI24744J21845_100026422 425
383 3300005459 Ga0068867_100019440 Ga0068867_1000194402 425
384 3300026089 Ga0207648_10029717 Ga0207648_100297172 425
385 3300046616 Ga0495668_0001660 Ga0495668_0001660_9642_10919 425

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

21

51

0.95

PF22366

NDH2_C

NDH2 C-terminal domain

361

421

0.95

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

17

337

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5na1-assembly1.cif.gz_A nadh:quinone oxidoreductase (ndh-ii) from staphylococcus aureus - holoprotein structure - 2.32 a resolution 0.9155 2 394
4nwz-assembly1.cif.gz_A structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution 0.9076 2 397
4g73-assembly1.cif.gz_B crystal structure of ndh with nadh and quinone 0.9064 2 412
5na4-assembly1.cif.gz_A nadh:quinone oxidoreductase (ndh-ii) from staphylococcus aureus - e172s mutant 0.9027 2 397
4g74-assembly1.cif.gz_A crystal structure of ndh with quinone 0.9002 2 412
ID Description Score Start End Superfamily
af_Q6YZ09_48_354_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9371 2 267 3.50.50.100
af_P95200_9_428_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9295 2 406 3.50.50.100
af_Q55CD9_31_450_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9291 2 405 3.50.50.100
af_Q54GF3_119_512_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9275 2 301 3.50.50.100
af_I1KLC9_45_406_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9246 2 302 3.50.50.100
ID Description Score Start End GO Terms
AF-A0A7C4Y5C3-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9946 1 266 GO:0003954
GO:0006116
AF-A0A4Q5WU76-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9934 1 213 GO:0003954
GO:0006116
AF-A0A3B9EVJ3-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9921 2 268 GO:0003954
GO:0006116
AF-A0A519TDB5-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.992 2 290 GO:0003954
GO:0006116
AF-A0A7C4Y5C3-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9909 1 266 GO:0003954
GO:0006116

Feature Viewer

pLDDT pTM Quality
87.81 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map