F430180

General Info

Members Datasets Scaffolds Average Seq Length
385 278 770 253

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10003894|Ga0105247_100038945
Length 274
Sequence MVELKTAAEIDAMAAAGAVVSEALQAIVEHAKPGQPTAELNQVAADVLTRHGARSPFLNYHPRWAPTPFPAVLCVSVNDAVVHGIPNGEVLTDGDLVSVDFGAILKGWCGDAARSFIVGTPRAQDIALIEATDEALAAGIAAVRPGNTLGDVGHAIAAVARGAGYGLLADHGGHGIGRTMHEDPHVPNEGRPGKGMRLRPGLVIAIEPMLIADGTDDYTHDPDGWTLRTASGARAAHSEHSVAVTADGPRILTSWTVPRPNVPYRSIFRRFFER

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
171 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
172 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
173 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
259 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
260 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
263 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
264 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
265 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
266 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
267 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
268 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
269 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
270 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
271 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
272 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
273 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
274 2922554459 Rhodococcus sp. 66b Isolate Unclassified
275 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
276 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
277 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
278 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.06
Metatranscriptomes 0.52
Isolates 4.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.84
Nodule 0
Rhizoplane 8.83
Rhizosphere 68.83
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10003894 3300009101 Bacteria 9642
2 JGI24735J21928_10011343 3300002067 Bacteria 2828
3 JGI24750J21931_1005257 3300002070 Bacteria 1590
4 JGI24749J21850_1008318 3300002076 Bacteria 1445
5 JGI24744J21845_10002938 3300002077 Bacteria 3488
6 JGI24742J22300_10003157 3300002244 Bacteria 2664
7 rootH2_10116372 3300003320 Bacteria 2029
8 JGI25160J50197_1040096 3300003354 Bacteria 1089
9 Ga0055524_1000026 3300003775 Bacteria 214653
10 Ga0055524_1004658 3300003775 Bacteria 6289
11 Ga0070676_10067888 3300005328 Bacteria 2133
12 Ga0070690_100027475 3300005330 Bacteria 3518
13 Ga0068869_100006906 3300005334 Bacteria 7222
14 Ga0070666_10074630 3300005335 Bacteria 2312
15 Ga0070680_100068672 3300005336 Bacteria 2909
16 Ga0070682_100021463 3300005337 Bacteria 3811
17 Ga0070682_100157432 3300005337 Bacteria 1565
18 Ga0070682_100259315 3300005337 Bacteria 1257
19 Ga0070682_100267641 3300005337 Bacteria 1240
20 Ga0068868_100001152 3300005338 Bacteria 18110
21 Ga0068868_100056817 3300005338 Bacteria 3091
22 Ga0068868_100126961 3300005338 Bacteria 2084
23 Ga0068868_100583999 3300005338 Bacteria 988
24 Ga0070660_100140414 3300005339 Bacteria 1938
25 Ga0070689_100015037 3300005340 Bacteria 5635
26 Ga0070689_100106677 3300005340 Bacteria 2223
27 Ga0070691_10362061 3300005341 Bacteria 808
28 Ga0070692_10045106 3300005345 Bacteria 2273
29 Ga0070668_100001247 3300005347 Bacteria 18154
30 Ga0070669_100012938 3300005353 Bacteria 5927
31 Ga0070674_100000774 3300005356 Bacteria 16401
32 Ga0070688_100017784 3300005365 Bacteria 4087
33 Ga0070659_100132662 3300005366 Bacteria 2024
34 Ga0070667_100008383 3300005367 Bacteria 8570
35 Ga0070709_10097945 3300005434 Bacteria 1948
36 Ga0070713_100063152 3300005436 Bacteria 3104
37 Ga0070710_10001165 3300005437 Bacteria 12439
38 Ga0070711_100003228 3300005439 Bacteria 9466
39 Ga0070700_100043910 3300005441 Bacteria 2751
40 Ga0070694_100006643 3300005444 Bacteria 7027
41 Ga0070663_100011370 3300005455 Bacteria 5585
42 Ga0070663_100091969 3300005455 Bacteria 2249
43 Ga0070678_100001550 3300005456 Bacteria 12285
44 Ga0070662_100002860 3300005457 Bacteria 10699
45 Ga0068867_100057248 3300005459 Bacteria 2886
46 Ga0070685_10073371 3300005466 Bacteria 2034
47 Ga0070679_100000143 3300005530 Bacteria 57899
48 Ga0070684_100018371 3300005535 Bacteria 5760
49 Ga0068853_100077293 3300005539 Bacteria 2908
50 Ga0070672_100055495 3300005543 Bacteria 3104
51 Ga0070686_100564334 3300005544 Bacteria 892
52 Ga0070696_100007695 3300005546 Bacteria 7197
53 Ga0070693_100050489 3300005547 Bacteria 2378
54 Ga0070693_100153397 3300005547 Bacteria 1461
55 Ga0070704_100001308 3300005549 Bacteria 13171
56 Ga0068855_100062595 3300005563 Bacteria 4343
57 Ga0068855_100142002 3300005563 Bacteria 2736
58 Ga0068854_100001561 3300005578 Bacteria 13898
59 Ga0070702_100000774 3300005615 Bacteria 12140
60 Ga0068852_100278557 3300005616 Bacteria 1611
61 Ga0068852_100664989 3300005616 Bacteria 1050
62 Ga0068859_100027503 3300005617 Bacteria 5704
63 Ga0068859_100429280 3300005617 Bacteria 1418
64 Ga0068866_10000532 3300005718 Bacteria 17475
65 Ga0068861_100006879 3300005719 Bacteria 7766
66 Ga0068851_10212867 3300005834 Bacteria 1083
67 Ga0068863_100033461 3300005841 Bacteria 4897
68 Ga0068858_100003253 3300005842 Bacteria 16185
69 Ga0068858_100194478 3300005842 Bacteria 1917
70 Ga0068860_100004824 3300005843 Bacteria 13734
71 Ga0068862_100005540 3300005844 Bacteria 10545
72 Ga0075365_10042011 3300006038 Bacteria 2988
73 Ga0075365_10065400 3300006038 Bacteria 2437
74 Ga0075363_100000946 3300006048 Bacteria 10309
75 Ga0075363_100009101 3300006048 Bacteria 4662
76 Ga0075363_100014746 3300006048 Bacteria 3828
77 Ga0075363_100038274 3300006048 Bacteria 2522
78 Ga0075363_100065569 3300006048 Bacteria 1963
79 Ga0075364_10002322 3300006051 Bacteria 10666
80 Ga0075364_10010105 3300006051 Bacteria 5692
81 Ga0075364_10075085 3300006051 Bacteria 2230
82 Ga0075364_10087131 3300006051 Bacteria 2069
83 Ga0070715_10001772 3300006163 Bacteria 6421
84 Ga0070716_100004843 3300006173 Bacteria 6469
85 Ga0070712_100004354 3300006175 Bacteria 8728
86 Ga0075362_10055016 3300006177 Bacteria 1789
87 Ga0075362_10098477 3300006177 Bacteria 1365
88 Ga0075367_10014610 3300006178 Bacteria 4251
89 Ga0075367_10063631 3300006178 Bacteria 2206
90 Ga0075367_10262439 3300006178 Bacteria 1084
91 Ga0075369_10005190 3300006186 Bacteria 4853
92 Ga0075369_10037117 3300006186 Bacteria 2075
93 Ga0075369_10078364 3300006186 Bacteria 1463
94 Ga0075369_10131342 3300006186 Bacteria 1138
95 Ga0097621_100111797 3300006237 Bacteria 2309
96 Ga0075370_10017632 3300006353 Bacteria 3861
97 Ga0075370_10034462 3300006353 Bacteria 2838
98 Ga0075370_10086269 3300006353 Bacteria 1808
99 Ga0075370_10086952 3300006353 Bacteria 1801
100 Ga0068871_100065754 3300006358 Bacteria 2971
101 Ga0075428_100038014 3300006844 Bacteria 5297
102 Ga0075430_100077077 3300006846 Bacteria 2794
103 Ga0075431_100022180 3300006847 Bacteria 6493
104 Ga0068865_100005598 3300006881 Bacteria 7622
105 Ga0068865_100493132 3300006881 Bacteria 1020
106 Ga0097620_100027501 3300006931 Bacteria 5704
107 Ga0097620_100429298 3300006931 Bacteria 1418
108 Ga0105245_10009243 3300009098 Bacteria 8594
109 Ga0105245_10114190 3300009098 Bacteria 2515
110 Ga0105245_10358882 3300009098 Bacteria 1446
111 Ga0105243_10002311 3300009148 Bacteria 15967
112 Ga0105241_10008660 3300009174 Bacteria 7479
113 Ga0105242_10001581 3300009176 Bacteria 17906
114 Ga0105248_10016151 3300009177 Bacteria 8215
115 Ga0105237_10003987 3300009545 Bacteria 17256
116 Ga0105249_10002733 3300009553 Bacteria 15259
117 Ga0105249_10111705 3300009553 Bacteria 2584
118 Ga0105249_11035705 3300009553 Bacteria 890
119 Ga0105239_10003624 3300010375 Bacteria 18873
120 Ga0105239_10004797 3300010375 Bacteria 16049
121 Ga0157371_10068241 3300013102 Bacteria 2516
122 Ga0157374_10080662 3300013296 Bacteria 3086
123 Ga0157378_10005486 3300013297 Bacteria 11117
124 Ga0163162_10016058 3300013306 Bacteria 7317
125 Ga0157372_10009292 3300013307 Bacteria 10457
126 Ga0157375_10006258 3300013308 Bacteria 10369
127 Ga0157377_10025243 3300014745 Bacteria 3168
128 Ga0157379_10008810 3300014968 Bacteria 8799
129 Ga0157376_10249109 3300014969 Bacteria 1658
130 Ga0163161_10001477 3300017792 Bacteria 17348
131 Ga0197907_10805684 3300020069 Bacteria 1273
132 Ga0206353_11115675 3300020082 Bacteria 2060
133 Ga0207426_1006023 3300025302 Bacteria 5360
134 Ga0207426_1009519 3300025302 Bacteria 3836
135 Ga0207426_1014637 3300025302 Bacteria 2869
136 Ga0207426_1041576 3300025302 Bacteria 1424
137 Ga0207656_10130818 3300025321 Bacteria 1175
138 Ga0207656_10134303 3300025321 Bacteria 1162
139 Ga0207642_10007039 3300025899 Bacteria 3774
140 Ga0207688_10002232 3300025901 Bacteria 10441
141 Ga0207688_10034775 3300025901 Bacteria 2790
142 Ga0207680_10043885 3300025903 Bacteria 2625
143 Ga0207647_10130888 3300025904 Bacteria 1475
144 Ga0207685_10001634 3300025905 Bacteria 4807
145 Ga0207645_10022901 3300025907 Bacteria 4059
146 Ga0207643_10096207 3300025908 Bacteria 1731
147 Ga0207671_10017975 3300025914 Bacteria 5440
148 Ga0207693_10002029 3300025915 Bacteria 17764
149 Ga0207663_10045916 3300025916 Bacteria 2689
150 Ga0207660_10056313 3300025917 Bacteria 2813
151 Ga0207660_10213275 3300025917 Bacteria 1513
152 Ga0207662_10183070 3300025918 Bacteria 1349
153 Ga0207662_10198726 3300025918 Bacteria 1297
154 Ga0207657_10170216 3300025919 Bacteria 1765
155 Ga0207652_10002761 3300025921 Bacteria 14746
156 Ga0207681_10076021 3300025923 Bacteria 2357
157 Ga0207687_10000497 3300025927 Bacteria 26539
158 Ga0207644_10202345 3300025931 Bacteria 1567
159 Ga0207690_10036017 3300025932 Bacteria 3202
160 Ga0207706_10002228 3300025933 Bacteria 18929
161 Ga0207670_10075102 3300025936 Bacteria 2348
162 Ga0207669_10020196 3300025937 Bacteria 3486
163 Ga0207704_10000277 3300025938 Bacteria 24598
164 Ga0207665_10026184 3300025939 Bacteria 3849
165 Ga0207665_10237866 3300025939 Bacteria 1341
166 Ga0207711_10091935 3300025941 Bacteria 2669
167 Ga0207689_10012266 3300025942 Bacteria 7330
168 Ga0207679_10153096 3300025945 Bacteria 1879
169 Ga0207667_10162833 3300025949 Bacteria 2294
170 Ga0207712_10053616 3300025961 Bacteria 2830
171 Ga0207668_10005896 3300025972 Bacteria 7219
172 Ga0207668_10642017 3300025972 Bacteria 928
173 Ga0207640_10041731 3300025981 Bacteria 2920
174 Ga0207640_10056793 3300025981 Bacteria 2572
175 Ga0207658_10019443 3300025986 Bacteria 4697
176 Ga0207658_10262521 3300025986 Bacteria 1472
177 Ga0207677_10010031 3300026023 Bacteria 5345
178 Ga0207677_10034717 3300026023 Bacteria 3268
179 Ga0207703_10016678 3300026035 Bacteria 5730
180 Ga0207678_10003491 3300026067 Bacteria 14138
181 Ga0207678_10004848 3300026067 Bacteria 12086
182 Ga0207678_10036794 3300026067 Bacteria 4261
183 Ga0207708_10047389 3300026075 Bacteria 3272
184 Ga0207641_10126085 3300026088 Bacteria 2292
185 Ga0207648_10014744 3300026089 Bacteria 7212
186 Ga0207675_100002671 3300026118 Bacteria 17598
187 Ga0207675_100647786 3300026118 Bacteria 1062
188 Ga0207683_10001831 3300026121 Bacteria 18783
189 Ga0207683_10252801 3300026121 Bacteria 1609
190 Ga0207698_10039021 3300026142 Bacteria 3515
191 Ga0207698_10176091 3300026142 Bacteria 1889
192 Ga0209813_10048583 3300027866 Bacteria 1318
193 Ga0209813_10050644 3300027866 Bacteria 1297
194 Ga0268266_10124333 3300028379 Bacteria 2300
195 Ga0268266_10303731 3300028379 Bacteria 1489
196 Ga0268265_10007512 3300028380 Bacteria 7358
197 Ga0265318_10002124 3300028577 Bacteria 10787
198 Ga0265336_10004983 3300028666 Bacteria 4952
199 Ga0265330_10001295 3300031235 Bacteria 14638
200 Ga0265330_10050353 3300031235 Bacteria 1827
201 Ga0265332_10017959 3300031238 Bacteria 3118
202 Ga0265328_10003674 3300031239 Bacteria 6756
203 Ga0265320_10046635 3300031240 Bacteria 2123
204 Ga0265325_10000701 3300031241 Bacteria 24270
205 Ga0265325_10055282 3300031241 Bacteria 2030
206 Ga0265340_10043910 3300031247 Bacteria 2188
207 Ga0265340_10135232 3300031247 Bacteria 1129
208 Ga0265339_10006806 3300031249 Bacteria 7455
209 Ga0265339_10008004 3300031249 Bacteria 6776
210 Ga0265316_10066760 3300031344 Bacteria 2782
211 Ga0307509_10099119 3300031507 Bacteria 2956
212 Ga0265313_10001811 3300031595 Bacteria 19545
213 Ga0265313_10015270 3300031595 Bacteria 4485
214 Ga0265314_10003098 3300031711 Bacteria 16368
215 Ga0265342_10001748 3300031712 Bacteria 19819
216 Ga0307409_100380390 3300031995 Bacteria 1342
217 Ga0307416_100071438 3300032002 Bacteria 2883
218 Ga0307416_100403246 3300032002 Bacteria 1406
219 Ga0373930_0026538 3300034816 Unclassified 1168
220 Ga0373932_0110452 3300035112 Unclassified 905
221 Ga0373941_0110251 3300035115 Bacteria 969
222 Ga0373956_0225240 3300035119 Bacteria 890
223 Ga0373931_0002673 3300035691 Bacteria 7928
224 Ga0373931_0017516 3300035691 Bacteria 3546
225 Ga0373933_0100822 3300035724 Bacteria 1791
226 Ga0436364_0560506 3300037853 Bacteria 3247
227 Ga0395901_0351888 3300038443 Bacteria 1520
228 Ga0439466_0005344 3300041411 Bacteria 4910
229 Ga0439465_0001300 3300041413 Bacteria 8036
230 Ga0451789_0682440 3300041443 Bacteria 4297
231 Ga0451791_0815125 3300041451 Bacteria 3427
232 Ga0451797_0099212 3300041453 Bacteria 5840
233 Ga0451800_0126879 3300041459 Bacteria 875
234 Ga0451843_1167283 3300041509 Bacteria 2448
235 Ga0439442_000122 3300042002 Bacteria 19630
236 Ga0439463_058563 3300042016 Bacteria 985
237 Ga0439459_0021150 3300042438 Bacteria 1247
238 Ga0466969_0044600 3300044656 Bacteria 2204
239 Ga0466965_0043704 3300044683 Bacteria 2213
240 Ga0466965_0052443 3300044683 Bacteria 2026
241 Ga0466966_0025657 3300044684 Bacteria 3849
242 Ga0466966_0229049 3300044684 Bacteria 1121
243 Ga0466961_0238973 3300044693 Bacteria 1117
244 Ga0466971_0020419 3300044719 Bacteria 2945
245 Ga0466970_0004612 3300044765 Bacteria 6797
246 Ga0466970_0024576 3300044765 Bacteria 3151
247 Ga0466970_0042282 3300044765 Bacteria 2423
248 Ga0466960_0013433 3300044901 Bacteria 3479
249 Ga0466967_0364636 3300045976 Bacteria 1400
250 Ga0495592_0052998 3300046454 Bacteria 3009
251 Ga0495638_0024174 3300046460 Bacteria 3965
252 Ga0495638_0030484 3300046460 Bacteria 3471
253 Ga0495638_0095853 3300046460 Bacteria 1781
254 Ga0495651_0074193 3300046462 Bacteria 2581
255 Ga0495653_0028396 3300046463 Bacteria 4472
256 Ga0495583_0088861 3300046506 Bacteria 1333
257 Ga0495606_0044001 3300046507 Bacteria 2972
258 Ga0495608_0043659 3300046511 Bacteria 2994
259 Ga0495618_0026044 3300046514 Bacteria 3633
260 Ga0495648_0006141 3300046524 Bacteria 9846
261 Ga0495652_0063484 3300046529 Bacteria 3109
262 Ga0495587_0089448 3300046536 Bacteria 1779
263 Ga0495645_0115654 3300046543 Bacteria 1894
264 Ga0495668_0000819 3300046616 Bacteria 35709
265 Ga0495668_0070269 3300046616 Bacteria 1924
266 Ga0495611_0029453 3300046648 Bacteria 2408
267 Ga0495635_0023780 3300046663 Bacteria 4269
268 Ga0495657_0004273 3300046675 Bacteria 11411
269 Ga0495599_0066798 3300046678 Bacteria 2246
270 Ga0495649_0204661 3300046694 Bacteria 1024
271 Ga0495600_0012563 3300046809 Bacteria 5298
272 Ga0495604_0010169 3300047317 Bacteria 7451
273 Ga0495674_0059990 3300047319 Bacteria 3321
274 Ga0495672_0005662 3300047320 Bacteria 9859
275 Ga0495672_0062645 3300047320 Bacteria 2138
276 Ga0495675_0015863 3300047444 Bacteria 4764
277 Ga0495673_0000663 3300047469 Bacteria 33914
278 Ga0495684_0026833 3300047471 Bacteria 4426
279 Ga0495686_0020272 3300047472 Bacteria 4434
280 Ga0495602_0084066 3300048088 Bacteria 2663
281 Ga0496100_0000947 3300048903 Bacteria 13889
282 Ga0496101_0000395 3300048904 Bacteria 28467
283 Ga0496101_0002667 3300048904 Bacteria 10958
284 Ga0496101_0290141 3300048904 Bacteria 1280
285 Ga0496102_0000011 3300048905 Bacteria 321716
286 Ga0496102_0001057 3300048905 Bacteria 25502
287 Ga0496103_0000431 3300048906 Bacteria 36468
288 Ga0496103_0059270 3300048906 Bacteria 2378
289 Ga0496104_0249119 3300048907 Bacteria 1689
290 Ga0496104_0296064 3300048907 Bacteria 1531
291 Ga0496105_0105609 3300048908 Bacteria 2325
292 Ga0496106_0009007 3300048909 Bacteria 7377
293 Ga0496106_0027608 3300048909 Bacteria 4228
294 Ga0496107_0000852 3300048910 Bacteria 17893
295 Ga0496107_0121395 3300048910 Bacteria 1925
296 Ga0496108_0030717 3300048911 Bacteria 4452
297 Ga0496108_0037141 3300048911 Bacteria 4056
298 Ga0496109_0003905 3300048912 Bacteria 12456
299 Ga0496109_0044388 3300048912 Bacteria 4032
300 Ga0496110_0050653 3300048913 Bacteria 3647
301 Ga0496110_0300538 3300048913 Bacteria 1462
302 Ga0496111_0022329 3300048914 Bacteria 4429
303 Ga0496112_0010877 3300048915 Bacteria 8281
304 Ga0496112_0720924 3300048915 Bacteria 924
305 Ga0496113_0054994 3300048916 Bacteria 2982
306 Ga0496113_0142848 3300048916 Bacteria 1884
307 Ga0496114_0002087 3300048917 Bacteria 15196
308 Ga0496114_0007628 3300048917 Bacteria 8556
309 Ga0496115_0008030 3300048918 Bacteria 7789
310 Ga0496115_0020289 3300048918 Bacteria 5126
311 Ga0496116_0000072 3300048919 Bacteria 238158
312 Ga0496117_0000039 3300048920 Bacteria 322143
313 Ga0496118_0000035 3300048921 Bacteria 322143
314 Ga0496118_0086311 3300048921 Bacteria 2181
315 Ga0496119_0000517 3300048922 Bacteria 52595
316 Ga0496119_0133931 3300048922 Bacteria 1346
317 Ga0496119_0169955 3300048922 Bacteria 1152
318 Ga0496120_0000631 3300048923 Bacteria 52495
319 Ga0496121_0002639 3300048924 Bacteria 26992
320 Ga0496125_0015889 3300048928 Bacteria 7252
321 Ga0496126_0002073 3300048929 Bacteria 28106
322 Ga0501032_0002824 3300049569 Bacteria 13513
323 Ga0501034_0012468 3300049571 Bacteria 8780
324 Ga0501034_0202299 3300049571 Bacteria 1944
325 Ga0501036_0060070 3300049572 Bacteria 3220
326 Ga0501037_0000467 3300049573 Bacteria 32968
327 Ga0501038_0002171 3300049574 Bacteria 18232
328 Ga0501039_0000403 3300049575 Bacteria 31019
329 Ga0501043_0001115 3300049579 Bacteria 23577
330 Ga0501070_0007544 3300049586 Bacteria 9242
331 Ga0501073_0047430 3300049589 Bacteria 3019
332 Ga0501077_0074320 3300049593 Bacteria 2153
333 Ga0501279_001997 3300049775 Bacteria 2696
334 Ga0501279_015012 3300049775 Bacteria 1070
335 Ga0501044_0202197 3300049823 Bacteria 1944
336 nmdc:mga03n38_1476_c1 3300050490 Bacteria 6772
337 nmdc:mga03n38_203469_c1 3300050490 Bacteria 1026
338 nmdc:mga03n38_33557_c1 3300050490 Bacteria 2185
339 nmdc:mga03n38_59535_c1 3300050490 Bacteria 1734
340 nmdc:mga03n38_8443_c1 3300050490 Bacteria 3698
341 nmdc:mga00v17_58834_c1 3300050491 Bacteria 2356
342 nmdc:mga00v17_7546_c1 3300050491 Bacteria 5807
343 nmdc:mga00v17_9992_c1 3300050491 Bacteria 5162
344 nmdc:mga0yw44_163128_c1 3300050492 Bacteria 1460
345 nmdc:mga06z11_17042_c1 3300050494 Bacteria 3288
346 nmdc:mga06z11_49596_c1 3300050494 Bacteria 2142
347 nmdc:mga07m45_239323_c1 3300050496 Bacteria 1056
348 nmdc:mga07m45_374560_c1 3300050496 Bacteria 827
349 nmdc:mga07m45_43332_c1 3300050496 Bacteria 2523
350 nmdc:mga07m45_55376_c1 3300050496 Bacteria 2242
351 nmdc:mga05p37_8166_c1 3300050507 Bacteria 12370
352 nmdc:mga09592_361334_c1 3300050508 Bacteria 1256
353 nmdc:mga0qj67_83781_c1 3300050509 Bacteria 2556
354 nmdc:mga06r32_20424_c1 3300050510 Bacteria 6099
355 nmdc:mga0sz30_119755_c1 3300050516 Bacteria 1156
356 nmdc:mga0sz30_5786_c1 3300050516 Bacteria 4555
357 nmdc:mga0sz30_61422_c1 3300050516 Bacteria 1606
358 nmdc:mga0sz30_81967_c1 3300050516 Bacteria 1397
359 Ga0500610_0002713 3300053079 Bacteria 6603
360 Ga0495595_0095651 3300053084 Bacteria 1429
361 Ga0500643_004403 3300053087 Bacteria 6388
362 Ga0500556_0090897 3300053104 Bacteria 1165
363 Ga0500652_001325 3300053131 Bacteria 7787
364 Ga0500604_0044508 3300053151 Bacteria 1352
365 Ga0500616_0003726 3300053153 Bacteria 11375
366 Ga0500616_0030449 3300053153 Bacteria 2963
367 Ga0500616_0060134 3300053153 Bacteria 1971
368 Ga0500616_0094362 3300053153 Bacteria 1474
369 2566994640 2565956761 Bacteria 6601618
370 2739206861 2738543005 Bacteria 5278128
371 2812354739 2811994879 Bacteria 9313447
372 2884702576 2884693830 Bacteria 11273186
373 2895429355 2895427314 Bacteria 13147766
374 2895452076 2895442618 Bacteria 11027144
375 2902797365 2902792274 Bacteria 7270173
376 2904503349 2904501621 Bacteria 3401437
377 2904536168 2904535858 Bacteria 6308016
378 2908675474 2908674828 Bacteria 3382763
379 2909074532 2909074476 Bacteria 3436050
380 2919041456 2919039151 Bacteria 3391018
381 2922558093 2922554459 Bacteria 6683962
382 2928500459 2928500415 Bacteria 3384541
383 2939584983 2939582691 Bacteria 7088898
384 8056061110 8056060235 Bacteria 7259403
385 8057569101 8057568493 Bacteria 7221719
386 Ga0105247_10003894
387 JGI24735J21928_10011343
388 JGI24750J21931_1005257
389 JGI24749J21850_1008318
390 JGI24744J21845_10002938
391 JGI24742J22300_10003157
392 rootH2_10116372
393 JGI25160J50197_1040096
394 Ga0055524_1000026
395 Ga0055524_1004658
396 Ga0070676_10067888
397 Ga0070690_100027475
398 Ga0068869_100006906
399 Ga0070666_10074630
400 Ga0070680_100068672
401 Ga0070682_100021463
402 Ga0070682_100157432
403 Ga0070682_100259315
404 Ga0070682_100267641
405 Ga0068868_100001152
406 Ga0068868_100056817
407 Ga0068868_100126961
408 Ga0068868_100583999
409 Ga0070660_100140414
410 Ga0070689_100015037
411 Ga0070689_100106677
412 Ga0070691_10362061
413 Ga0070692_10045106
414 Ga0070668_100001247
415 Ga0070669_100012938
416 Ga0070674_100000774
417 Ga0070688_100017784
418 Ga0070659_100132662
419 Ga0070667_100008383
420 Ga0070709_10097945
421 Ga0070713_100063152
422 Ga0070710_10001165
423 Ga0070711_100003228
424 Ga0070700_100043910
425 Ga0070694_100006643
426 Ga0070663_100011370
427 Ga0070663_100091969
428 Ga0070678_100001550
429 Ga0070662_100002860
430 Ga0068867_100057248
431 Ga0070685_10073371
432 Ga0070679_100000143
433 Ga0070684_100018371
434 Ga0068853_100077293
435 Ga0070672_100055495
436 Ga0070686_100564334
437 Ga0070696_100007695
438 Ga0070693_100050489
439 Ga0070693_100153397
440 Ga0070704_100001308
441 Ga0068855_100062595
442 Ga0068855_100142002
443 Ga0068854_100001561
444 Ga0070702_100000774
445 Ga0068852_100278557
446 Ga0068852_100664989
447 Ga0068859_100027503
448 Ga0068859_100429280
449 Ga0068866_10000532
450 Ga0068861_100006879
451 Ga0068851_10212867
452 Ga0068863_100033461
453 Ga0068858_100003253
454 Ga0068858_100194478
455 Ga0068860_100004824
456 Ga0068862_100005540
457 Ga0075365_10042011
458 Ga0075365_10065400
459 Ga0075363_100000946
460 Ga0075363_100009101
461 Ga0075363_100014746
462 Ga0075363_100038274
463 Ga0075363_100065569
464 Ga0075364_10002322
465 Ga0075364_10010105
466 Ga0075364_10075085
467 Ga0075364_10087131
468 Ga0070715_10001772
469 Ga0070716_100004843
470 Ga0070712_100004354
471 Ga0075362_10055016
472 Ga0075362_10098477
473 Ga0075367_10014610
474 Ga0075367_10063631
475 Ga0075367_10262439
476 Ga0075369_10005190
477 Ga0075369_10037117
478 Ga0075369_10078364
479 Ga0075369_10131342
480 Ga0097621_100111797
481 Ga0075370_10017632
482 Ga0075370_10034462
483 Ga0075370_10086269
484 Ga0075370_10086952
485 Ga0068871_100065754
486 Ga0075428_100038014
487 Ga0075430_100077077
488 Ga0075431_100022180
489 Ga0068865_100005598
490 Ga0068865_100493132
491 Ga0097620_100027501
492 Ga0097620_100429298
493 Ga0105245_10009243
494 Ga0105245_10114190
495 Ga0105245_10358882
496 Ga0105243_10002311
497 Ga0105241_10008660
498 Ga0105242_10001581
499 Ga0105248_10016151
500 Ga0105237_10003987
501 Ga0105249_10002733
502 Ga0105249_10111705
503 Ga0105249_11035705
504 Ga0105239_10003624
505 Ga0105239_10004797
506 Ga0157371_10068241
507 Ga0157374_10080662
508 Ga0157378_10005486
509 Ga0163162_10016058
510 Ga0157372_10009292
511 Ga0157375_10006258
512 Ga0157377_10025243
513 Ga0157379_10008810
514 Ga0157376_10249109
515 Ga0163161_10001477
516 Ga0197907_10805684
517 Ga0206353_11115675
518 Ga0207426_1006023
519 Ga0207426_1009519
520 Ga0207426_1014637
521 Ga0207426_1041576
522 Ga0207656_10130818
523 Ga0207656_10134303
524 Ga0207642_10007039
525 Ga0207688_10002232
526 Ga0207688_10034775
527 Ga0207680_10043885
528 Ga0207647_10130888
529 Ga0207685_10001634
530 Ga0207645_10022901
531 Ga0207643_10096207
532 Ga0207671_10017975
533 Ga0207693_10002029
534 Ga0207663_10045916
535 Ga0207660_10056313
536 Ga0207660_10213275
537 Ga0207662_10183070
538 Ga0207662_10198726
539 Ga0207657_10170216
540 Ga0207652_10002761
541 Ga0207681_10076021
542 Ga0207687_10000497
543 Ga0207644_10202345
544 Ga0207690_10036017
545 Ga0207706_10002228
546 Ga0207670_10075102
547 Ga0207669_10020196
548 Ga0207704_10000277
549 Ga0207665_10026184
550 Ga0207665_10237866
551 Ga0207711_10091935
552 Ga0207689_10012266
553 Ga0207679_10153096
554 Ga0207667_10162833
555 Ga0207712_10053616
556 Ga0207668_10005896
557 Ga0207668_10642017
558 Ga0207640_10041731
559 Ga0207640_10056793
560 Ga0207658_10019443
561 Ga0207658_10262521
562 Ga0207677_10010031
563 Ga0207677_10034717
564 Ga0207703_10016678
565 Ga0207678_10003491
566 Ga0207678_10004848
567 Ga0207678_10036794
568 Ga0207708_10047389
569 Ga0207641_10126085
570 Ga0207648_10014744
571 Ga0207675_100002671
572 Ga0207675_100647786
573 Ga0207683_10001831
574 Ga0207683_10252801
575 Ga0207698_10039021
576 Ga0207698_10176091
577 Ga0209813_10048583
578 Ga0209813_10050644
579 Ga0268266_10124333
580 Ga0268266_10303731
581 Ga0268265_10007512
582 Ga0265318_10002124
583 Ga0265336_10004983
584 Ga0265330_10001295
585 Ga0265330_10050353
586 Ga0265332_10017959
587 Ga0265328_10003674
588 Ga0265320_10046635
589 Ga0265325_10000701
590 Ga0265325_10055282
591 Ga0265340_10043910
592 Ga0265340_10135232
593 Ga0265339_10006806
594 Ga0265339_10008004
595 Ga0265316_10066760
596 Ga0307509_10099119
597 Ga0265313_10001811
598 Ga0265313_10015270
599 Ga0265314_10003098
600 Ga0265342_10001748
601 Ga0307409_100380390
602 Ga0307416_100071438
603 Ga0307416_100403246
604 Ga0373930_0026538
605 Ga0373932_0110452
606 Ga0373941_0110251
607 Ga0373956_0225240
608 Ga0373931_0002673
609 Ga0373931_0017516
610 Ga0373933_0100822
611 Ga0436364_0560506
612 Ga0395901_0351888
613 Ga0439466_0005344
614 Ga0439465_0001300
615 Ga0451789_0682440
616 Ga0451791_0815125
617 Ga0451797_0099212
618 Ga0451800_0126879
619 Ga0451843_1167283
620 Ga0439442_000122
621 Ga0439463_058563
622 Ga0439459_0021150
623 Ga0466969_0044600
624 Ga0466965_0043704
625 Ga0466965_0052443
626 Ga0466966_0025657
627 Ga0466966_0229049
628 Ga0466961_0238973
629 Ga0466971_0020419
630 Ga0466970_0004612
631 Ga0466970_0024576
632 Ga0466970_0042282
633 Ga0466960_0013433
634 Ga0466967_0364636
635 Ga0495592_0052998
636 Ga0495638_0024174
637 Ga0495638_0030484
638 Ga0495638_0095853
639 Ga0495651_0074193
640 Ga0495653_0028396
641 Ga0495583_0088861
642 Ga0495606_0044001
643 Ga0495608_0043659
644 Ga0495618_0026044
645 Ga0495648_0006141
646 Ga0495652_0063484
647 Ga0495587_0089448
648 Ga0495645_0115654
649 Ga0495668_0000819
650 Ga0495668_0070269
651 Ga0495611_0029453
652 Ga0495635_0023780
653 Ga0495657_0004273
654 Ga0495599_0066798
655 Ga0495649_0204661
656 Ga0495600_0012563
657 Ga0495604_0010169
658 Ga0495674_0059990
659 Ga0495672_0005662
660 Ga0495672_0062645
661 Ga0495675_0015863
662 Ga0495673_0000663
663 Ga0495684_0026833
664 Ga0495686_0020272
665 Ga0495602_0084066
666 Ga0496100_0000947
667 Ga0496101_0000395
668 Ga0496101_0002667
669 Ga0496101_0290141
670 Ga0496102_0000011
671 Ga0496102_0001057
672 Ga0496103_0000431
673 Ga0496103_0059270
674 Ga0496104_0249119
675 Ga0496104_0296064
676 Ga0496105_0105609
677 Ga0496106_0009007
678 Ga0496106_0027608
679 Ga0496107_0000852
680 Ga0496107_0121395
681 Ga0496108_0030717
682 Ga0496108_0037141
683 Ga0496109_0003905
684 Ga0496109_0044388
685 Ga0496110_0050653
686 Ga0496110_0300538
687 Ga0496111_0022329
688 Ga0496112_0010877
689 Ga0496112_0720924
690 Ga0496113_0054994
691 Ga0496113_0142848
692 Ga0496114_0002087
693 Ga0496114_0007628
694 Ga0496115_0008030
695 Ga0496115_0020289
696 Ga0496116_0000072
697 Ga0496117_0000039
698 Ga0496118_0000035
699 Ga0496118_0086311
700 Ga0496119_0000517
701 Ga0496119_0133931
702 Ga0496119_0169955
703 Ga0496120_0000631
704 Ga0496121_0002639
705 Ga0496125_0015889
706 Ga0496126_0002073
707 Ga0501032_0002824
708 Ga0501034_0012468
709 Ga0501034_0202299
710 Ga0501036_0060070
711 Ga0501037_0000467
712 Ga0501038_0002171
713 Ga0501039_0000403
714 Ga0501043_0001115
715 Ga0501070_0007544
716 Ga0501073_0047430
717 Ga0501077_0074320
718 Ga0501279_001997
719 Ga0501279_015012
720 Ga0501044_0202197
721 nmdc:mga03n38_1476_c1
722 nmdc:mga03n38_203469_c1
723 nmdc:mga03n38_33557_c1
724 nmdc:mga03n38_59535_c1
725 nmdc:mga03n38_8443_c1
726 nmdc:mga00v17_58834_c1
727 nmdc:mga00v17_7546_c1
728 nmdc:mga00v17_9992_c1
729 nmdc:mga0yw44_163128_c1
730 nmdc:mga06z11_17042_c1
731 nmdc:mga06z11_49596_c1
732 nmdc:mga07m45_239323_c1
733 nmdc:mga07m45_374560_c1
734 nmdc:mga07m45_43332_c1
735 nmdc:mga07m45_55376_c1
736 nmdc:mga05p37_8166_c1
737 nmdc:mga09592_361334_c1
738 nmdc:mga0qj67_83781_c1
739 nmdc:mga06r32_20424_c1
740 nmdc:mga0sz30_119755_c1
741 nmdc:mga0sz30_5786_c1
742 nmdc:mga0sz30_61422_c1
743 nmdc:mga0sz30_81967_c1
744 Ga0500610_0002713
745 Ga0495595_0095651
746 Ga0500643_004403
747 Ga0500556_0090897
748 Ga0500652_001325
749 Ga0500604_0044508
750 Ga0500616_0003726
751 Ga0500616_0030449
752 Ga0500616_0060134
753 Ga0500616_0094362
754 2566994640
755 2739206861
756 2812354739
757 2884702576
758 2895429355
759 2895452076
760 2902797365
761 2904503349
762 2904536168
763 2908675474
764 2909074532
765 2919041456
766 2922558093
767 2928500459
768 2939584983
769 8056061110
770 8057569101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

246

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9815 1 254
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9775 1 254
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9756 1 254
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9736 1 254
5yxf-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105l mutant) in complex with methionine 0.9729 4 254
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9783 1 254 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9738 4 254 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9735 1 254 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9734 1 254 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9707 1 254 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A0K2RSB2-F1-model_v4 Methionine aminopeptidase 1 0.997 105 254 GO:0005829
GO:0070006
AF-A0A6B1P9B0-F1-model_v4 deleted 0.9962 1 214
AF-A0A7W3T825-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9953 67 254 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A6B1P9B0-F1-model_v4 deleted 0.9916 1 214
AF-A0A7C2P9M7-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9904 1 254 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Map