F430179

General Info

Members Datasets Scaffolds Average Seq Length
385 193 770 319

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10031895|Ga0105245_100318952
Length 360
Sequence MTQSGHLLDYFALAARPQNASFQGVDETCSSGGQMQRREFIKAIVGSAVVWPLAAKAQQPAMPLIGFLSATSQNTAVEQQSKFHAGLSEAGFVQGKNVAIEYHWADGQYDRLPAMAAVLVRRPVSLIVAQGPPAALAAKAATTTIPIVFVVGFDPIAGGLVESLNRPGGNATGMTLLTGPLGQKRIEQVRELVPKAVTVAMLANPVSPDAVPEIRDVQIAAQANSLQLRMYNASTRAELDDAFSAIAAQRPDALLVGSDPFYVVRRDDFVAFAARYKIPAIYPFREFADAGGLVSYGTNIANAYRQAGIYAGQILKGAKPSELPVVRPTKIELIINLRTAKSLGIDIPPTLHVRSDDVIE

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 21.04
Rhizosphere 78.44
Stem 0
Stem Tuber 0
Unclassified 14.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10031895 3300009098 Bacteria 4666
2 Ga0065712_10159697 3300005290 Bacteria 1311
3 Ga0070676_10249041 3300005328 Unclassified 1185
4 Ga0070680_100066179 3300005336 Bacteria 2963
5 Ga0070682_100019888 3300005337 Bacteria 3944
6 Ga0070682_100044228 3300005337 Bacteria 2757
7 Ga0070682_100115004 3300005337 Unclassified 1799
8 Ga0070671_100039721 3300005355 Bacteria 3906
9 Ga0070674_100146122 3300005356 Bacteria 1780
10 Ga0070667_100207509 3300005367 Unclassified 1740
11 Ga0070709_10035239 3300005434 Bacteria 3041
12 Ga0070709_10063616 3300005434 Bacteria 2357
13 Ga0070714_100339542 3300005435 Bacteria 1408
14 Ga0070714_100342885 3300005435 Bacteria 1402
15 Ga0070713_100015590 3300005436 Bacteria 5691
16 Ga0070713_100051772 3300005436 Bacteria 3397
17 Ga0070713_100268764 3300005436 Bacteria 1561
18 Ga0070710_10010511 3300005437 Bacteria 4549
19 Ga0070710_10081014 3300005437 Unclassified 1895
20 Ga0070711_100032872 3300005439 Bacteria 3452
21 Ga0070711_100043744 3300005439 Bacteria 3035
22 Ga0070708_100030969 3300005445 Bacteria 4628
23 Ga0070663_100004506 3300005455 Bacteria 8202
24 Ga0070663_100141312 3300005455 Bacteria 1838
25 Ga0070678_100011090 3300005456 Bacteria 5541
26 Ga0070678_100026105 3300005456 Bacteria 3943
27 Ga0070678_100055999 3300005456 Bacteria 2881
28 Ga0070662_100015719 3300005457 Bacteria 5073
29 Ga0070662_100160224 3300005457 Bacteria 1759
30 Ga0070681_10015654 3300005458 Bacteria 7555
31 Ga0068867_100061375 3300005459 Unclassified 2791
32 Ga0070698_100095802 3300005471 Bacteria 2945
33 Ga0070699_100039702 3300005518 Bacteria 4075
34 Ga0070699_100270564 3300005518 Bacteria 1520
35 Ga0070679_100256850 3300005530 Unclassified 1703
36 Ga0070684_100004789 3300005535 Bacteria 10338
37 Ga0070697_100123097 3300005536 Bacteria 2170
38 Ga0070695_100127093 3300005545 Bacteria 1752
39 Ga0070696_100335613 3300005546 Bacteria 1167
40 Ga0070665_100078761 3300005548 Bacteria 3302
41 Ga0070665_100118287 3300005548 Bacteria 2652
42 Ga0070664_100015052 3300005564 Bacteria 6315
43 Ga0068856_100362057 3300005614 Bacteria 1469
44 Ga0070702_100101934 3300005615 Bacteria 1763
45 Ga0070702_100115163 3300005615 Unclassified 1674
46 Ga0068859_100531180 3300005617 Bacteria 1271
47 Ga0068864_100010094 3300005618 Bacteria 7797
48 Ga0068864_100274910 3300005618 Bacteria 1571
49 Ga0068861_100090757 3300005719 Bacteria 2411
50 Ga0068861_100185260 3300005719 Unclassified 1736
51 Ga0068863_100060849 3300005841 Bacteria 3571
52 Ga0068863_100156697 3300005841 Bacteria 2180
53 Ga0068858_100315815 3300005842 Bacteria 1492
54 Ga0068860_100169389 3300005843 Bacteria 2109
55 Ga0068860_100261806 3300005843 Bacteria 1686
56 Ga0068860_100297784 3300005843 Bacteria 1580
57 Ga0081455_10017478 3300005937 Bacteria 6872
58 Ga0081455_10031140 3300005937 Bacteria 4832
59 Ga0081455_10063317 3300005937 Bacteria 3104
60 Ga0081540_1000143 3300005983 Bacteria 74581
61 Ga0070717_10358278 3300006028 Unclassified 1305
62 Ga0075365_10029450 3300006038 Bacteria 3510
63 Ga0070715_10013370 3300006163 Bacteria 3013
64 Ga0070716_100007428 3300006173 Bacteria 5397
65 Ga0070712_100031683 3300006175 Bacteria 3564
66 Ga0070712_100073601 3300006175 Bacteria 2451
67 Ga0070712_100202128 3300006175 Bacteria 1562
68 Ga0097621_100012250 3300006237 Bacteria 6347
69 Ga0097621_100060892 3300006237 Bacteria 3095
70 Ga0097621_100102484 3300006237 Bacteria 2410
71 Ga0097621_100334942 3300006237 Bacteria 1343
72 Ga0068871_100012261 3300006358 Bacteria 6313
73 Ga0068871_100029057 3300006358 Bacteria 4340
74 Ga0068871_100144368 3300006358 Bacteria 2025
75 Ga0075428_100366420 3300006844 Unclassified 1545
76 Ga0075428_100488634 3300006844 Bacteria 1317
77 Ga0075428_100657380 3300006844 Bacteria 1118
78 Ga0075430_100323097 3300006846 Bacteria 1275
79 Ga0075431_100245956 3300006847 Unclassified 1818
80 Ga0075429_100394600 3300006880 Bacteria 1211
81 Ga0075436_100060144 3300006914 Unclassified 2624
82 Ga0097620_100531087 3300006931 Bacteria 1271
83 Ga0075435_100011316 3300007076 Bacteria 6558
84 Ga0111539_10215346 3300009094 Bacteria 2237
85 Ga0111539_10620835 3300009094 Unclassified 1259
86 Ga0105245_10019203 3300009098 Bacteria 5986
87 Ga0105245_10041272 3300009098 Bacteria 4113
88 Ga0105245_10434674 3300009098 Unclassified 1318
89 Ga0105247_10050134 3300009101 Bacteria 2568
90 Ga0114129_10244282 3300009147 Bacteria 2412
91 Ga0114129_10272819 3300009147 Unclassified 2262
92 Ga0114129_10303475 3300009147 Bacteria 2127
93 Ga0114129_10498697 3300009147 Bacteria 1590
94 Ga0105242_10038781 3300009176 Bacteria 3833
95 Ga0105248_10044158 3300009177 Bacteria 4998
96 Ga0105248_10113109 3300009177 Bacteria 3061
97 Ga0105237_10068003 3300009545 Bacteria 3556
98 Ga0105237_10190127 3300009545 Bacteria 2053
99 Ga0105238_10440864 3300009551 Unclassified 1299
100 Ga0105238_10457315 3300009551 Bacteria 1274
101 Ga0105239_10032139 3300010375 Bacteria 5768
102 Ga0105239_10168445 3300010375 Bacteria 2449
103 Ga0105246_10346997 3300011119 Unclassified 1215
104 Ga0157374_10055337 3300013296 Bacteria 3702
105 Ga0157374_10138862 3300013296 Bacteria 2358
106 Ga0157374_10167208 3300013296 Bacteria 2144
107 Ga0157378_10016856 3300013297 Bacteria 6405
108 Ga0157378_10085045 3300013297 Bacteria 2865
109 Ga0157378_10139866 3300013297 Bacteria 2247
110 Ga0163162_10031664 3300013306 Bacteria 5246
111 Ga0163162_10052774 3300013306 Bacteria 4084
112 Ga0163162_10402880 3300013306 Bacteria 1501
113 Ga0163162_10467730 3300013306 Unclassified 1392
114 Ga0157375_10021913 3300013308 Bacteria 5872
115 Ga0157375_10032953 3300013308 Bacteria 4918
116 Ga0157375_10304076 3300013308 Bacteria 1758
117 Ga0163163_10146738 3300014325 Bacteria 2403
118 Ga0182008_10067473 3300014497 Bacteria 1760
119 Ga0157379_10033729 3300014968 Bacteria 4566
120 Ga0157379_10134790 3300014968 Bacteria 2224
121 Ga0157379_10219430 3300014968 Bacteria 1723
122 Ga0157376_10023598 3300014969 Unclassified 4816
123 Ga0157376_10025854 3300014969 Bacteria 4629
124 Ga0157376_10119363 3300014969 Bacteria 2335
125 Ga0157376_10194591 3300014969 Bacteria 1861
126 Ga0163161_10335996 3300017792 Unclassified 1197
127 Ga0207692_10059468 3300025898 Unclassified 1974
128 Ga0207710_10005082 3300025900 Bacteria 5693
129 Ga0207710_10015061 3300025900 Bacteria 3267
130 Ga0207710_10059602 3300025900 Unclassified 1728
131 Ga0207680_10033135 3300025903 Bacteria 2944
132 Ga0207699_10062319 3300025906 Bacteria 2248
133 Ga0207671_10128002 3300025914 Bacteria 1947
134 Ga0207671_10199734 3300025914 Bacteria 1561
135 Ga0207693_10330543 3300025915 Bacteria 1193
136 Ga0207663_10045274 3300025916 Bacteria 2705
137 Ga0207663_10056403 3300025916 Bacteria 2470
138 Ga0207660_10137094 3300025917 Unclassified 1868
139 Ga0207652_10070125 3300025921 Unclassified 3044
140 Ga0207646_10284364 3300025922 Bacteria 1495
141 Ga0207694_10305845 3300025924 Unclassified 1310
142 Ga0207700_10006571 3300025928 Bacteria 7040
143 Ga0207700_10045658 3300025928 Bacteria 3234
144 Ga0207664_10086261 3300025929 Bacteria 2564
145 Ga0207664_10232168 3300025929 Bacteria 1604
146 Ga0207644_10261019 3300025931 Unclassified 1385
147 Ga0207706_10014893 3300025933 Bacteria 7044
148 Ga0207706_10018165 3300025933 Bacteria 6326
149 Ga0207686_10004314 3300025934 Bacteria 7625
150 Ga0207669_10112618 3300025937 Unclassified 1827
151 Ga0207704_10070217 3300025938 Bacteria 2217
152 Ga0207665_10007504 3300025939 Bacteria 7207
153 Ga0207665_10416830 3300025939 Bacteria 1025
154 Ga0207711_10047617 3300025941 Bacteria 3666
155 Ga0207711_10142872 3300025941 Unclassified 2154
156 Ga0207661_10048431 3300025944 Bacteria 3378
157 Ga0207658_10134791 3300025986 Bacteria 1989
158 Ga0207677_10019470 3300026023 Bacteria 4099
159 Ga0207678_10050821 3300026067 Bacteria 3581
160 Ga0207678_10150217 3300026067 Bacteria 1989
161 Ga0207702_10389860 3300026078 Bacteria 1341
162 Ga0207641_10098200 3300026088 Bacteria 2575
163 Ga0207648_10115992 3300026089 Unclassified 2354
164 Ga0207676_10432071 3300026095 Bacteria 1237
165 Ga0207675_100099611 3300026118 Bacteria 2737
166 Ga0207683_10027128 3300026121 Bacteria 4950
167 Ga0207683_10032020 3300026121 Bacteria 4566
168 Ga0207683_10057115 3300026121 Bacteria 3426
169 Ga0207683_10087508 3300026121 Bacteria 2771
170 Ga0209966_1016734 3300027695 Unclassified 1390
171 Ga0209974_10017060 3300027876 Unclassified 2409
172 Ga0268266_10002111 3300028379 Bacteria 21955
173 Ga0268266_10203350 3300028379 Bacteria 1813
174 Ga0268264_10260523 3300028381 Bacteria 1615
175 Ga0268264_10360173 3300028381 Bacteria 1387
176 Ga0373944_0040953 3300035089 Bacteria 1432
177 Ga0373945_0006469 3300035116 Bacteria 3780
178 Ga0373943_0013794 3300035170 Bacteria 3653
179 Ga0373943_0089492 3300035170 Bacteria 1592
180 Ga0373943_0225372 3300035170 Bacteria 1045
181 Ga0373946_0016321 3300035171 Bacteria 2828
182 Ga0373946_0080243 3300035171 Bacteria 1427
183 Ga0373955_0009598 3300035172 Bacteria 4541
184 Ga0373924_0102511 3300035410 Unclassified 1232
185 Ga0373935_0036023 3300035692 Bacteria 3091
186 Ga0373935_0040767 3300035692 Bacteria 2915
187 Ga0373935_0195801 3300035692 Bacteria 1394
188 Ga0373927_0068423 3300035695 Unclassified 2297
189 Ga0373927_0230633 3300035695 Bacteria 1216
190 Ga0373933_0011156 3300035724 Bacteria 4944
191 Ga0373947_0028429 3300035725 Bacteria 3278
192 Ga0373947_0095335 3300035725 Bacteria 1862
193 Ga0373947_0176083 3300035725 Bacteria 1390
194 Ga0373937_0030667 3300036401 Bacteria 4869
195 Ga0373937_0073434 3300036401 Bacteria 3155
196 Ga0373925_0031729 3300037068 Bacteria 3885
197 Ga0373925_0272830 3300037068 Unclassified 1361
198 Ga0395901_0187812 3300038443 Bacteria 2167
199 Ga0395901_0441517 3300038443 Bacteria 1332
200 Ga0436361_1042918 3300039447 Unclassified 958
201 Ga0466967_0014676 3300045976 Bacteria 6115
202 Ga0495592_0008031 3300046454 Bacteria 7923
203 Ga0495603_0144089 3300046455 Bacteria 1385
204 Ga0495603_0188779 3300046455 Bacteria 1192
205 Ga0495629_0060658 3300046459 Bacteria 2643
206 Ga0495629_0098474 3300046459 Bacteria 2040
207 Ga0495651_0032256 3300046462 Bacteria 4087
208 Ga0495653_0039635 3300046463 Bacteria 3689
209 Ga0495653_0076210 3300046463 Bacteria 2494
210 Ga0495662_0123154 3300046476 Bacteria 1273
211 Ga0495662_0144915 3300046476 Bacteria 1169
212 Ga0495664_0039352 3300046477 Bacteria 2793
213 Ga0495664_0159003 3300046477 Bacteria 1371
214 Ga0495585_0014762 3300046492 Bacteria 4544
215 Ga0495594_0023495 3300046499 Bacteria 3304
216 Ga0495594_0107851 3300046499 Unclassified 1569
217 Ga0495608_0006451 3300046511 Bacteria 8332
218 Ga0495608_0056954 3300046511 Bacteria 2580
219 Ga0495618_0004663 3300046514 Bacteria 8384
220 Ga0495618_0076348 3300046514 Bacteria 2135
221 Ga0495618_0284592 3300046514 Bacteria 1030
222 Ga0495628_0015490 3300046516 Bacteria 6367
223 Ga0495630_0073494 3300046517 Bacteria 2575
224 Ga0495666_0012079 3300046526 Bacteria 4311
225 Ga0495666_0085150 3300046526 Unclassified 1493
226 Ga0495652_0022342 3300046529 Bacteria 5613
227 Ga0495665_0160179 3300046531 Bacteria 1173
228 Ga0495640_0005310 3300046533 Bacteria 10236
229 Ga0495640_0037985 3300046533 Bacteria 3391
230 Ga0495640_0118921 3300046533 Bacteria 1719
231 Ga0495587_0006697 3300046536 Bacteria 7504
232 Ga0495621_0096960 3300046539 Unclassified 1118
233 Ga0495645_0089434 3300046543 Bacteria 2202
234 Ga0495645_0123185 3300046543 Bacteria 1823
235 Ga0495667_0000614 3300046559 Bacteria 22753
236 Ga0495667_0091248 3300046559 Bacteria 1973
237 Ga0495656_0053772 3300046615 Bacteria 1731
238 Ga0495634_0011692 3300046642 Bacteria 6384
239 Ga0495634_0174255 3300046642 Bacteria 1350
240 Ga0495635_0037769 3300046663 Bacteria 3343
241 Ga0495635_0179545 3300046663 Bacteria 1439
242 Ga0495635_0265833 3300046663 Bacteria 1154
243 Ga0495659_0010341 3300046664 Bacteria 2990
244 Ga0495588_0135409 3300046674 Bacteria 1300
245 Ga0495657_0012696 3300046675 Bacteria 6245
246 Ga0495599_0018043 3300046678 Bacteria 4395
247 Ga0495599_0134170 3300046678 Bacteria 1537
248 Ga0495623_0025525 3300046679 Bacteria 3806
249 Ga0495646_0031141 3300046680 Bacteria 3327
250 Ga0495647_0036266 3300046681 Bacteria 1855
251 Ga0495658_0051225 3300046683 Bacteria 2338
252 Ga0495613_0030976 3300046689 Bacteria 3973
253 Ga0495613_0257973 3300046689 Bacteria 1215
254 Ga0495613_0340114 3300046689 Bacteria 1032
255 Ga0495624_0175603 3300046690 Bacteria 1306
256 Ga0495624_0186225 3300046690 Unclassified 1263
257 Ga0495670_0045824 3300046691 Bacteria 2183
258 Ga0495600_0036947 3300046809 Unclassified 3175
259 Ga0495604_0004310 3300047317 Bacteria 11260
260 Ga0495674_0036020 3300047319 Bacteria 4458
261 Ga0495674_0090614 3300047319 Bacteria 2612
262 Ga0495674_0103416 3300047319 Bacteria 2421
263 Ga0495674_0192207 3300047319 Bacteria 1696
264 Ga0495674_0224601 3300047319 Bacteria 1551
265 Ga0495676_0037365 3300047321 Bacteria 4042
266 Ga0495676_0044564 3300047321 Bacteria 3620
267 Ga0495676_0077465 3300047321 Unclassified 2535
268 Ga0495676_0096001 3300047321 Bacteria 2205
269 Ga0495680_0015121 3300047322 Bacteria 6664
270 Ga0495680_0177101 3300047322 Bacteria 1541
271 Ga0495675_0050287 3300047444 Bacteria 2649
272 Ga0495684_0021832 3300047471 Bacteria 4927
273 Ga0495684_0077325 3300047471 Bacteria 2527
274 Ga0495593_0142440 3300047673 Unclassified 1214
275 Ga0495602_0024271 3300048088 Bacteria 5884
276 Ga0496100_0040092 3300048903 Bacteria 2977
277 Ga0496100_0088999 3300048903 Bacteria 2102
278 Ga0496100_0094217 3300048903 Bacteria 2050
279 Ga0496100_0095979 3300048903 Bacteria 2033
280 Ga0496101_0003701 3300048904 Bacteria 9535
281 Ga0496101_0039696 3300048904 Bacteria 3350
282 Ga0496101_0075854 3300048904 Bacteria 2475
283 Ga0496101_0109397 3300048904 Bacteria 2079
284 Ga0496101_0161120 3300048904 Bacteria 1720
285 Ga0496102_0011798 3300048905 Bacteria 7541
286 Ga0496102_0017457 3300048905 Bacteria 6285
287 Ga0496102_0018456 3300048905 Bacteria 6130
288 Ga0496102_0019986 3300048905 Bacteria 5908
289 Ga0496102_0032455 3300048905 Bacteria 4689
290 Ga0496102_0257431 3300048905 Bacteria 1645
291 Ga0496103_0020859 3300048906 Bacteria 3940
292 Ga0496103_0096275 3300048906 Bacteria 1871
293 Ga0496103_0113611 3300048906 Bacteria 1721
294 Ga0496104_0008141 3300048907 Bacteria 9302
295 Ga0496104_0010175 3300048907 Bacteria 8395
296 Ga0496104_0010673 3300048907 Bacteria 8211
297 Ga0496104_0014310 3300048907 Bacteria 7164
298 Ga0496104_0016391 3300048907 Bacteria 6731
299 Ga0496104_0075543 3300048907 Bacteria 3208
300 Ga0496104_0250707 3300048907 Bacteria 1683
301 Ga0496104_0433342 3300048907 Bacteria 1226
302 Ga0496104_0639947 3300048907 Unclassified 972
303 Ga0496105_0007097 3300048908 Bacteria 8639
304 Ga0496105_0013015 3300048908 Bacteria 6593
305 Ga0496105_0032548 3300048908 Bacteria 4280
306 Ga0496105_0038745 3300048908 Unclassified 3927
307 Ga0496105_0044365 3300048908 Bacteria 3667
308 Ga0496105_0090062 3300048908 Bacteria 2534
309 Ga0496105_0211789 3300048908 Bacteria 1580
310 Ga0496106_0004225 3300048909 Bacteria 10690
311 Ga0496106_0014754 3300048909 Bacteria 5776
312 Ga0496106_0018037 3300048909 Bacteria 5218
313 Ga0496106_0032448 3300048909 Bacteria 3893
314 Ga0496106_0039395 3300048909 Bacteria 3539
315 Ga0496107_0010248 3300048910 Bacteria 6505
316 Ga0496107_0020092 3300048910 Bacteria 4716
317 Ga0496107_0061661 3300048910 Bacteria 2715
318 Ga0496107_0298249 3300048910 Unclassified 1199
319 Ga0496108_0015548 3300048911 Bacteria 6206
320 Ga0496108_0049231 3300048911 Bacteria 3524
321 Ga0496108_0194002 3300048911 Unclassified 1761
322 Ga0496108_0206403 3300048911 Bacteria 1705
323 Ga0496108_0371163 3300048911 Bacteria 1249
324 Ga0496109_0008627 3300048912 Bacteria 8676
325 Ga0496109_0010031 3300048912 Bacteria 8086
326 Ga0496109_0036600 3300048912 Bacteria 4430
327 Ga0496109_0122153 3300048912 Bacteria 2427
328 Ga0496110_0003153 3300048913 Bacteria 12538
329 Ga0496110_0031055 3300048913 Bacteria 4607
330 Ga0496111_0005934 3300048914 Bacteria 7879
331 Ga0496111_0056598 3300048914 Bacteria 2837
332 Ga0496111_0067798 3300048914 Bacteria 2592
333 Ga0496112_0010490 3300048915 Bacteria 8404
334 Ga0496112_0030372 3300048915 Bacteria 5229
335 Ga0496112_0084597 3300048915 Bacteria 3137
336 Ga0496112_0253573 3300048915 Bacteria 1710
337 Ga0496113_0015645 3300048916 Bacteria 5223
338 Ga0496113_0059798 3300048916 Bacteria 2871
339 Ga0496113_0079281 3300048916 Bacteria 2514
340 Ga0496113_0120845 3300048916 Unclassified 2048
341 Ga0496113_0135753 3300048916 Unclassified 1933
342 Ga0496113_0243715 3300048916 Bacteria 1434
343 Ga0496114_0016319 3300048917 Bacteria 5981
344 Ga0496114_0022725 3300048917 Bacteria 5111
345 Ga0496114_0058366 3300048917 Bacteria 3222
346 Ga0496114_0080572 3300048917 Bacteria 2750
347 Ga0496114_0570689 3300048917 Bacteria 999
348 Ga0496115_0005104 3300048918 Bacteria 9545
349 Ga0496115_0006373 3300048918 Bacteria 8644
350 Ga0496115_0008103 3300048918 Bacteria 7763
351 Ga0496115_0041595 3300048918 Bacteria 3658
352 Ga0496115_0084282 3300048918 Bacteria 2591
353 Ga0496115_0096499 3300048918 Bacteria 2420
354 Ga0496115_0152696 3300048918 Bacteria 1907
355 Ga0496115_0261706 3300048918 Unclassified 1422
356 Ga0496115_0301481 3300048918 Bacteria 1313
357 Ga0501072_0233912 3300049588 Bacteria 1464
358 nmdc:mga0yw44_57177_c1 3300050492 Bacteria 2379
359 nmdc:mga05p37_134135_c1 3300050507 Bacteria 3037
360 nmdc:mga05p37_206501_c1 3300050507 Bacteria 2376
361 nmdc:mga05p37_369490_c1 3300050507 Unclassified 1684
362 nmdc:mga05p37_458933_c1 3300050507 Bacteria 1473
363 nmdc:mga09592_426356_c1 3300050508 Bacteria 1145
364 nmdc:mga0qj67_134482_c1 3300050509 Bacteria 2003
365 nmdc:mga06r32_285414_c1 3300050510 Bacteria 1637
366 nmdc:mga06r32_363024_c1 3300050510 Unclassified 1432
367 nmdc:mga08y16_432832_c1 3300050511 Bacteria 1343
368 nmdc:mga0n895_159491_c1 3300050512 Bacteria 2287
369 nmdc:mga0n895_315801_c1 3300050512 Bacteria 1583
370 nmdc:mga0rr50_142752_c1 3300050513 Unclassified 1928
371 nmdc:mga0rr50_74451_c1 3300050513 Bacteria 2599
372 nmdc:mga08x19_96724_c1 3300050514 Bacteria 1954
373 Ga0495601_0015836 3300053077 Bacteria 4563
374 Ga0495601_0024626 3300053077 Bacteria 3707
375 Ga0495601_0027794 3300053077 Bacteria 3499
376 Ga0495601_0028522 3300053077 Bacteria 3458
377 Ga0495601_0063174 3300053077 Unclassified 2353
378 Ga0495601_0162747 3300053077 Bacteria 1458
379 Ga0495612_0001751 3300053078 Bacteria 8895
380 Ga0495612_0002197 3300053078 Bacteria 8022
381 Ga0495612_0045557 3300053078 Bacteria 1795
382 Ga0495595_0018884 3300053084 Unclassified 2984
383 Ga0495619_0001809 3300053085 Bacteria 14227
384 Ga0495619_0084633 3300053085 Bacteria 2140
385 Ga0495619_0133282 3300053085 Bacteria 1708
386 Ga0105245_10031895
387 Ga0065712_10159697
388 Ga0070676_10249041
389 Ga0070680_100066179
390 Ga0070682_100019888
391 Ga0070682_100044228
392 Ga0070682_100115004
393 Ga0070671_100039721
394 Ga0070674_100146122
395 Ga0070667_100207509
396 Ga0070709_10035239
397 Ga0070709_10063616
398 Ga0070714_100339542
399 Ga0070714_100342885
400 Ga0070713_100015590
401 Ga0070713_100051772
402 Ga0070713_100268764
403 Ga0070710_10010511
404 Ga0070710_10081014
405 Ga0070711_100032872
406 Ga0070711_100043744
407 Ga0070708_100030969
408 Ga0070663_100004506
409 Ga0070663_100141312
410 Ga0070678_100011090
411 Ga0070678_100026105
412 Ga0070678_100055999
413 Ga0070662_100015719
414 Ga0070662_100160224
415 Ga0070681_10015654
416 Ga0068867_100061375
417 Ga0070698_100095802
418 Ga0070699_100039702
419 Ga0070699_100270564
420 Ga0070679_100256850
421 Ga0070684_100004789
422 Ga0070697_100123097
423 Ga0070695_100127093
424 Ga0070696_100335613
425 Ga0070665_100078761
426 Ga0070665_100118287
427 Ga0070664_100015052
428 Ga0068856_100362057
429 Ga0070702_100101934
430 Ga0070702_100115163
431 Ga0068859_100531180
432 Ga0068864_100010094
433 Ga0068864_100274910
434 Ga0068861_100090757
435 Ga0068861_100185260
436 Ga0068863_100060849
437 Ga0068863_100156697
438 Ga0068858_100315815
439 Ga0068860_100169389
440 Ga0068860_100261806
441 Ga0068860_100297784
442 Ga0081455_10017478
443 Ga0081455_10031140
444 Ga0081455_10063317
445 Ga0081540_1000143
446 Ga0070717_10358278
447 Ga0075365_10029450
448 Ga0070715_10013370
449 Ga0070716_100007428
450 Ga0070712_100031683
451 Ga0070712_100073601
452 Ga0070712_100202128
453 Ga0097621_100012250
454 Ga0097621_100060892
455 Ga0097621_100102484
456 Ga0097621_100334942
457 Ga0068871_100012261
458 Ga0068871_100029057
459 Ga0068871_100144368
460 Ga0075428_100366420
461 Ga0075428_100488634
462 Ga0075428_100657380
463 Ga0075430_100323097
464 Ga0075431_100245956
465 Ga0075429_100394600
466 Ga0075436_100060144
467 Ga0097620_100531087
468 Ga0075435_100011316
469 Ga0111539_10215346
470 Ga0111539_10620835
471 Ga0105245_10019203
472 Ga0105245_10041272
473 Ga0105245_10434674
474 Ga0105247_10050134
475 Ga0114129_10244282
476 Ga0114129_10272819
477 Ga0114129_10303475
478 Ga0114129_10498697
479 Ga0105242_10038781
480 Ga0105248_10044158
481 Ga0105248_10113109
482 Ga0105237_10068003
483 Ga0105237_10190127
484 Ga0105238_10440864
485 Ga0105238_10457315
486 Ga0105239_10032139
487 Ga0105239_10168445
488 Ga0105246_10346997
489 Ga0157374_10055337
490 Ga0157374_10138862
491 Ga0157374_10167208
492 Ga0157378_10016856
493 Ga0157378_10085045
494 Ga0157378_10139866
495 Ga0163162_10031664
496 Ga0163162_10052774
497 Ga0163162_10402880
498 Ga0163162_10467730
499 Ga0157375_10021913
500 Ga0157375_10032953
501 Ga0157375_10304076
502 Ga0163163_10146738
503 Ga0182008_10067473
504 Ga0157379_10033729
505 Ga0157379_10134790
506 Ga0157379_10219430
507 Ga0157376_10023598
508 Ga0157376_10025854
509 Ga0157376_10119363
510 Ga0157376_10194591
511 Ga0163161_10335996
512 Ga0207692_10059468
513 Ga0207710_10005082
514 Ga0207710_10015061
515 Ga0207710_10059602
516 Ga0207680_10033135
517 Ga0207699_10062319
518 Ga0207671_10128002
519 Ga0207671_10199734
520 Ga0207693_10330543
521 Ga0207663_10045274
522 Ga0207663_10056403
523 Ga0207660_10137094
524 Ga0207652_10070125
525 Ga0207646_10284364
526 Ga0207694_10305845
527 Ga0207700_10006571
528 Ga0207700_10045658
529 Ga0207664_10086261
530 Ga0207664_10232168
531 Ga0207644_10261019
532 Ga0207706_10014893
533 Ga0207706_10018165
534 Ga0207686_10004314
535 Ga0207669_10112618
536 Ga0207704_10070217
537 Ga0207665_10007504
538 Ga0207665_10416830
539 Ga0207711_10047617
540 Ga0207711_10142872
541 Ga0207661_10048431
542 Ga0207658_10134791
543 Ga0207677_10019470
544 Ga0207678_10050821
545 Ga0207678_10150217
546 Ga0207702_10389860
547 Ga0207641_10098200
548 Ga0207648_10115992
549 Ga0207676_10432071
550 Ga0207675_100099611
551 Ga0207683_10027128
552 Ga0207683_10032020
553 Ga0207683_10057115
554 Ga0207683_10087508
555 Ga0209966_1016734
556 Ga0209974_10017060
557 Ga0268266_10002111
558 Ga0268266_10203350
559 Ga0268264_10260523
560 Ga0268264_10360173
561 Ga0373944_0040953
562 Ga0373945_0006469
563 Ga0373943_0013794
564 Ga0373943_0089492
565 Ga0373943_0225372
566 Ga0373946_0016321
567 Ga0373946_0080243
568 Ga0373955_0009598
569 Ga0373924_0102511
570 Ga0373935_0036023
571 Ga0373935_0040767
572 Ga0373935_0195801
573 Ga0373927_0068423
574 Ga0373927_0230633
575 Ga0373933_0011156
576 Ga0373947_0028429
577 Ga0373947_0095335
578 Ga0373947_0176083
579 Ga0373937_0030667
580 Ga0373937_0073434
581 Ga0373925_0031729
582 Ga0373925_0272830
583 Ga0395901_0187812
584 Ga0395901_0441517
585 Ga0436361_1042918
586 Ga0466967_0014676
587 Ga0495592_0008031
588 Ga0495603_0144089
589 Ga0495603_0188779
590 Ga0495629_0060658
591 Ga0495629_0098474
592 Ga0495651_0032256
593 Ga0495653_0039635
594 Ga0495653_0076210
595 Ga0495662_0123154
596 Ga0495662_0144915
597 Ga0495664_0039352
598 Ga0495664_0159003
599 Ga0495585_0014762
600 Ga0495594_0023495
601 Ga0495594_0107851
602 Ga0495608_0006451
603 Ga0495608_0056954
604 Ga0495618_0004663
605 Ga0495618_0076348
606 Ga0495618_0284592
607 Ga0495628_0015490
608 Ga0495630_0073494
609 Ga0495666_0012079
610 Ga0495666_0085150
611 Ga0495652_0022342
612 Ga0495665_0160179
613 Ga0495640_0005310
614 Ga0495640_0037985
615 Ga0495640_0118921
616 Ga0495587_0006697
617 Ga0495621_0096960
618 Ga0495645_0089434
619 Ga0495645_0123185
620 Ga0495667_0000614
621 Ga0495667_0091248
622 Ga0495656_0053772
623 Ga0495634_0011692
624 Ga0495634_0174255
625 Ga0495635_0037769
626 Ga0495635_0179545
627 Ga0495635_0265833
628 Ga0495659_0010341
629 Ga0495588_0135409
630 Ga0495657_0012696
631 Ga0495599_0018043
632 Ga0495599_0134170
633 Ga0495623_0025525
634 Ga0495646_0031141
635 Ga0495647_0036266
636 Ga0495658_0051225
637 Ga0495613_0030976
638 Ga0495613_0257973
639 Ga0495613_0340114
640 Ga0495624_0175603
641 Ga0495624_0186225
642 Ga0495670_0045824
643 Ga0495600_0036947
644 Ga0495604_0004310
645 Ga0495674_0036020
646 Ga0495674_0090614
647 Ga0495674_0103416
648 Ga0495674_0192207
649 Ga0495674_0224601
650 Ga0495676_0037365
651 Ga0495676_0044564
652 Ga0495676_0077465
653 Ga0495676_0096001
654 Ga0495680_0015121
655 Ga0495680_0177101
656 Ga0495675_0050287
657 Ga0495684_0021832
658 Ga0495684_0077325
659 Ga0495593_0142440
660 Ga0495602_0024271
661 Ga0496100_0040092
662 Ga0496100_0088999
663 Ga0496100_0094217
664 Ga0496100_0095979
665 Ga0496101_0003701
666 Ga0496101_0039696
667 Ga0496101_0075854
668 Ga0496101_0109397
669 Ga0496101_0161120
670 Ga0496102_0011798
671 Ga0496102_0017457
672 Ga0496102_0018456
673 Ga0496102_0019986
674 Ga0496102_0032455
675 Ga0496102_0257431
676 Ga0496103_0020859
677 Ga0496103_0096275
678 Ga0496103_0113611
679 Ga0496104_0008141
680 Ga0496104_0010175
681 Ga0496104_0010673
682 Ga0496104_0014310
683 Ga0496104_0016391
684 Ga0496104_0075543
685 Ga0496104_0250707
686 Ga0496104_0433342
687 Ga0496104_0639947
688 Ga0496105_0007097
689 Ga0496105_0013015
690 Ga0496105_0032548
691 Ga0496105_0038745
692 Ga0496105_0044365
693 Ga0496105_0090062
694 Ga0496105_0211789
695 Ga0496106_0004225
696 Ga0496106_0014754
697 Ga0496106_0018037
698 Ga0496106_0032448
699 Ga0496106_0039395
700 Ga0496107_0010248
701 Ga0496107_0020092
702 Ga0496107_0061661
703 Ga0496107_0298249
704 Ga0496108_0015548
705 Ga0496108_0049231
706 Ga0496108_0194002
707 Ga0496108_0206403
708 Ga0496108_0371163
709 Ga0496109_0008627
710 Ga0496109_0010031
711 Ga0496109_0036600
712 Ga0496109_0122153
713 Ga0496110_0003153
714 Ga0496110_0031055
715 Ga0496111_0005934
716 Ga0496111_0056598
717 Ga0496111_0067798
718 Ga0496112_0010490
719 Ga0496112_0030372
720 Ga0496112_0084597
721 Ga0496112_0253573
722 Ga0496113_0015645
723 Ga0496113_0059798
724 Ga0496113_0079281
725 Ga0496113_0120845
726 Ga0496113_0135753
727 Ga0496113_0243715
728 Ga0496114_0016319
729 Ga0496114_0022725
730 Ga0496114_0058366
731 Ga0496114_0080572
732 Ga0496114_0570689
733 Ga0496115_0005104
734 Ga0496115_0006373
735 Ga0496115_0008103
736 Ga0496115_0041595
737 Ga0496115_0084282
738 Ga0496115_0096499
739 Ga0496115_0152696
740 Ga0496115_0261706
741 Ga0496115_0301481
742 Ga0501072_0233912
743 nmdc:mga0yw44_57177_c1
744 nmdc:mga05p37_134135_c1
745 nmdc:mga05p37_206501_c1
746 nmdc:mga05p37_369490_c1
747 nmdc:mga05p37_458933_c1
748 nmdc:mga09592_426356_c1
749 nmdc:mga0qj67_134482_c1
750 nmdc:mga06r32_285414_c1
751 nmdc:mga06r32_363024_c1
752 nmdc:mga08y16_432832_c1
753 nmdc:mga0n895_159491_c1
754 nmdc:mga0n895_315801_c1
755 nmdc:mga0rr50_142752_c1
756 nmdc:mga0rr50_74451_c1
757 nmdc:mga08x19_96724_c1
758 Ga0495601_0015836
759 Ga0495601_0024626
760 Ga0495601_0027794
761 Ga0495601_0028522
762 Ga0495601_0063174
763 Ga0495601_0162747
764 Ga0495612_0001751
765 Ga0495612_0002197
766 Ga0495612_0045557
767 Ga0495595_0018884
768 Ga0495619_0001809
769 Ga0495619_0084633
770 Ga0495619_0133282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

65

359

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9287 28 324
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9219 29 325
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9203 31 325
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9198 28 324
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9143 31 325
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9052 148 325 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9021 148 324 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8876 148 325 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8787 148 324 3.40.50.2300
af_P02924_26_131_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8239 164 248 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1N6H715-F1-model_v4 deleted 0.9863 76 322
AF-A0A317GWG2-F1-model_v4 ABC transporter substrate-binding protein 0.973 28 326
AF-A0A536TI46-F1-model_v4 ABC transporter substrate-binding protein 0.9689 54 326 GO:0016020
AF-A0A840MUP0-F1-model_v4 Putative ABC transport system substrate-binding protein 0.9689 92 326
AF-A0A023XHF2-F1-model_v4 deleted 0.9675 44 326

Map