F430124

General Info

Members Datasets Scaffolds Average Seq Length
385 178 385 106

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10105727|Ga0070709_101057273
Length 119
Sequence MSRPQPETPSRRMIDAAQKRRAIEPREISQESNTRLQITWADDRVCEYEAAALRRACPCAQCVNEWTGERTLRPEAIANEVEINDLSVVGRYALNFRWSDGHETGIYSFQYLRDLCETE

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.86
Rhizosphere 96.88
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13121653 2162886012 Bacteria 987
2 JGI24034J14986_100191 3300001432 Unclassified 3203
3 JGI24748J21848_1000014 3300002074 Bacteria 147126
4 JGI24034J26672_10000012 3300002239 Bacteria 146139
5 JGI24742J22300_10007622 3300002244 Bacteria 1786
6 Ga0065704_10137052 3300005289 Bacteria 1559
7 Ga0065704_10304131 3300005289 Bacteria 880
8 Ga0065704_10599380 3300005289 Unclassified 599
9 Ga0065712_10164600 3300005290 Bacteria 1280
10 Ga0065715_10036261 3300005293 Bacteria 1350
11 Ga0065715_10090755 3300005293 Bacteria 6513
12 Ga0065715_10187727 3300005293 Bacteria 1434
13 Ga0065715_10279782 3300005293 Unclassified 1089
14 Ga0065715_10334748 3300005293 Bacteria 977
15 Ga0065707_10003815 3300005295 Bacteria 3998
16 Ga0065707_10155656 3300005295 Bacteria 1611
17 Ga0065707_10312127 3300005295 Unclassified 983
18 Ga0065707_10499789 3300005295 Unclassified 758
19 Ga0070676_10719833 3300005328 Unclassified 730
20 Ga0070683_100774079 3300005329 Unclassified 920
21 Ga0070690_100375208 3300005330 Bacteria 1038
22 Ga0068869_100691208 3300005334 Bacteria 869
23 Ga0068869_100712449 3300005334 Bacteria 857
24 Ga0068869_100837469 3300005334 Unclassified 793
25 Ga0068869_101143185 3300005334 Bacteria 682
26 Ga0068869_101162029 3300005334 Bacteria 677
27 Ga0070680_100937625 3300005336 Bacteria 747
28 Ga0070682_100002269 3300005337 Bacteria 10644
29 Ga0068868_100012234 3300005338 Bacteria 6271
30 Ga0068868_100290266 3300005338 Bacteria 1386
31 Ga0068868_102111546 3300005338 Unclassified 536
32 Ga0070660_100344676 3300005339 Unclassified 1226
33 Ga0070687_100158692 3300005343 Bacteria 1335
34 Ga0070687_100307204 3300005343 Bacteria 1008
35 Ga0070661_100087655 3300005344 Bacteria 2303
36 Ga0070692_10003369 3300005345 Bacteria 6470
37 Ga0070692_10028194 3300005345 Bacteria 2790
38 Ga0070669_100866607 3300005353 Unclassified 770
39 Ga0070675_100849713 3300005354 Unclassified 835
40 Ga0070675_101040717 3300005354 Unclassified 752
41 Ga0070671_100164886 3300005355 Unclassified 1873
42 Ga0070674_100131194 3300005356 Unclassified 1868
43 Ga0070674_102186935 3300005356 Unclassified 505
44 Ga0070673_100081615 3300005364 Bacteria 2622
45 Ga0070673_100578178 3300005364 Bacteria 1023
46 Ga0070688_100209650 3300005365 Bacteria 1367
47 Ga0070688_101677157 3300005365 Unclassified 520
48 Ga0070659_100392955 3300005366 Unclassified 1170
49 Ga0070659_100659823 3300005366 Bacteria 902
50 Ga0070667_100064069 3300005367 Bacteria 3118
51 Ga0070667_101003175 3300005367 Unclassified 779
52 Ga0070703_10000046 3300005406 Bacteria 59107
53 Ga0070703_10010311 3300005406 Bacteria 2632
54 Ga0070709_10105727 3300005434 Bacteria 1883
55 Ga0070705_100024988 3300005440 Bacteria 3232
56 Ga0070705_100034197 3300005440 Unclassified 2839
57 Ga0070705_100717136 3300005440 Unclassified 787
58 Ga0070705_100967786 3300005440 Unclassified 689
59 Ga0070705_101033558 3300005440 Unclassified 669
60 Ga0070700_100264003 3300005441 Bacteria 1241
61 Ga0070700_100536283 3300005441 Bacteria 907
62 Ga0070700_100796005 3300005441 Unclassified 761
63 Ga0070694_100000175 3300005444 Bacteria 33400
64 Ga0070694_100059766 3300005444 Bacteria 2597
65 Ga0070694_100104820 3300005444 Bacteria 2006
66 Ga0070694_100137280 3300005444 Bacteria 1773
67 Ga0070694_100157639 3300005444 Bacteria 1663
68 Ga0070694_100463382 3300005444 Bacteria 1003
69 Ga0070694_100702973 3300005444 Unclassified 822
70 Ga0070708_100090322 3300005445 Bacteria 2788
71 Ga0070708_100343304 3300005445 Bacteria 1407
72 Ga0070708_100735482 3300005445 Bacteria 928
73 Ga0070708_100977815 3300005445 Unclassified 794
74 Ga0070708_101312123 3300005445 Bacteria 676
75 Ga0070678_100294369 3300005456 Bacteria 1377
76 Ga0070678_100766311 3300005456 Bacteria 874
77 Ga0070662_101071071 3300005457 Unclassified 691
78 Ga0068867_100420098 3300005459 Bacteria 1132
79 Ga0068867_100579479 3300005459 Unclassified 976
80 Ga0070685_10079784 3300005466 Unclassified 1959
81 Ga0070685_10497793 3300005466 Unclassified 862
82 Ga0070706_100030782 3300005467 Bacteria 4946
83 Ga0070706_100055012 3300005467 Bacteria 3673
84 Ga0070706_100821919 3300005467 Bacteria 860
85 Ga0070706_101657446 3300005467 Bacteria 583
86 Ga0070707_100000284 3300005468 Bacteria 49662
87 Ga0070707_100020865 3300005468 Bacteria 6184
88 Ga0070707_100360690 3300005468 Bacteria 1412
89 Ga0070707_100435879 3300005468 Bacteria 1271
90 Ga0070707_100530531 3300005468 Unclassified 1139
91 Ga0070707_100660350 3300005468 Unclassified 1008
92 Ga0070707_102083597 3300005468 Unclassified 535
93 Ga0070698_100001820 3300005471 Bacteria 23723
94 Ga0070698_100022421 3300005471 Bacteria 6606
95 Ga0070698_100272614 3300005471 Bacteria 1624
96 Ga0070698_100309181 3300005471 Unclassified 1511
97 Ga0070698_101242069 3300005471 Bacteria 695
98 Ga0070698_101966041 3300005471 Unclassified 538
99 Ga0070699_100081759 3300005518 Bacteria 2816
100 Ga0070699_100089592 3300005518 Bacteria 2688
101 Ga0070699_100138741 3300005518 Unclassified 2146
102 Ga0070699_100227493 3300005518 Bacteria 1663
103 Ga0070699_100264663 3300005518 Bacteria 1538
104 Ga0070699_100354927 3300005518 Bacteria 1321
105 Ga0070699_100463642 3300005518 Unclassified 1149
106 Ga0070699_100619347 3300005518 Unclassified 987
107 Ga0070697_100004174 3300005536 Bacteria 11073
108 Ga0070697_100070605 3300005536 Bacteria 2863
109 Ga0070697_100122337 3300005536 Unclassified 2177
110 Ga0068853_100071358 3300005539 Unclassified 3024
111 Ga0068853_100362222 3300005539 Bacteria 1351
112 Ga0070672_100221393 3300005543 Unclassified 1587
113 Ga0070686_101038820 3300005544 Unclassified 674
114 Ga0070695_100052100 3300005545 Unclassified 2629
115 Ga0070695_100216787 3300005545 Bacteria 1377
116 Ga0070695_100781672 3300005545 Bacteria 764
117 Ga0070696_100020826 3300005546 Unclassified 4444
118 Ga0070696_100554527 3300005546 Bacteria 921
119 Ga0070696_101043562 3300005546 Unclassified 685
120 Ga0070693_100001099 3300005547 Bacteria 12144
121 Ga0070693_100004402 3300005547 Bacteria 6658
122 Ga0070693_100371600 3300005547 Bacteria 984
123 Ga0070665_100255202 3300005548 Unclassified 1754
124 Ga0070665_101364559 3300005548 Bacteria 718
125 Ga0070704_100010294 3300005549 Bacteria 5687
126 Ga0070704_100015158 3300005549 Bacteria 4835
127 Ga0070704_100015585 3300005549 Bacteria 4778
128 Ga0070704_100301022 3300005549 Unclassified 1336
129 Ga0070704_100731523 3300005549 Bacteria 880
130 Ga0070704_100938755 3300005549 Unclassified 780
131 Ga0070704_101761233 3300005549 Unclassified 573
132 Ga0068855_100272743 3300005563 Unclassified 1881
133 Ga0070664_100187878 3300005564 Unclassified 1840
134 Ga0070664_100304610 3300005564 Bacteria 1440
135 Ga0070664_100357294 3300005564 Bacteria 1330
136 Ga0068854_100321918 3300005578 Bacteria 1257
137 Ga0070702_100179974 3300005615 Unclassified 1382
138 Ga0070702_100268141 3300005615 Bacteria 1166
139 Ga0068859_100041606 3300005617 Bacteria 4615
140 Ga0068859_100048869 3300005617 Unclassified 4249
141 Ga0068859_100091251 3300005617 Bacteria 3097
142 Ga0068859_100317531 3300005617 Bacteria 1652
143 Ga0068859_100501173 3300005617 Bacteria 1309
144 Ga0068859_100579036 3300005617 Unclassified 1216
145 Ga0068859_101668704 3300005617 Bacteria 704
146 Ga0068864_100190549 3300005618 Unclassified 1879
147 Ga0068864_100317006 3300005618 Unclassified 1463
148 Ga0068864_100684593 3300005618 Bacteria 1001
149 Ga0068864_101761077 3300005618 Unclassified 624
150 Ga0068866_10004970 3300005718 Bacteria 5471
151 Ga0068866_10142842 3300005718 Bacteria 1376
152 Ga0068866_10143757 3300005718 Unclassified 1373
153 Ga0068861_100004130 3300005719 Bacteria 9738
154 Ga0068851_10119247 3300005834 Bacteria 1416
155 Ga0068851_10134492 3300005834 Bacteria 1339
156 Ga0068870_10483194 3300005840 Unclassified 822
157 Ga0068870_10637557 3300005840 Bacteria 728
158 Ga0068863_100166181 3300005841 Bacteria 2116
159 Ga0068863_100526120 3300005841 Bacteria 1166
160 Ga0068863_102195043 3300005841 Unclassified 562
161 Ga0068858_100000194 3300005842 Bacteria 64964
162 Ga0068858_100029238 3300005842 Bacteria 5116
163 Ga0068858_100063505 3300005842 Bacteria 3417
164 Ga0068858_100544331 3300005842 Bacteria 1124
165 Ga0068858_100678595 3300005842 Bacteria 1002
166 Ga0068860_101278547 3300005843 Bacteria 754
167 Ga0068860_101907356 3300005843 Unclassified 616
168 Ga0068862_100276568 3300005844 Unclassified 1537
169 Ga0070715_10000064 3300006163 Bacteria 33475
170 Ga0070716_100000002 3300006173 Bacteria 396037
171 Ga0070716_100169009 3300006173 Unclassified 1425
172 Ga0070716_100236580 3300006173 Bacteria 1236
173 Ga0097621_100001118 3300006237 Bacteria 18699
174 Ga0097621_100058489 3300006237 Unclassified 3154
175 Ga0097621_102270814 3300006237 Unclassified 519
176 Ga0068871_100014977 3300006358 Bacteria 5797
177 Ga0068871_100019099 3300006358 Bacteria 5227
178 Ga0068871_100218159 3300006358 Bacteria 1652
179 Ga0068871_100544646 3300006358 Unclassified 1050
180 Ga0068871_100575127 3300006358 Unclassified 1022
181 Ga0075428_100375742 3300006844 Unclassified 1524
182 Ga0075431_100761265 3300006847 Bacteria 943
183 Ga0075431_101566239 3300006847 Unclassified 617
184 Ga0075434_100116129 3300006871 Bacteria 2689
185 Ga0075429_100122824 3300006880 Archaea 2270
186 Ga0075429_100695522 3300006880 Unclassified 891
187 Ga0075429_100909623 3300006880 Bacteria 770
188 Ga0068865_100654997 3300006881 Unclassified 893
189 Ga0068865_100830843 3300006881 Unclassified 799
190 Ga0068865_101281445 3300006881 Unclassified 651
191 Ga0075436_100000014 3300006914 Bacteria 175616
192 Ga0097620_100041611 3300006931 Bacteria 4615
193 Ga0097620_100048868 3300006931 Unclassified 4249
194 Ga0097620_100091254 3300006931 Bacteria 3097
195 Ga0097620_100317525 3300006931 Bacteria 1652
196 Ga0097620_100501193 3300006931 Bacteria 1309
197 Ga0097620_100579054 3300006931 Unclassified 1216
198 Ga0097620_101668951 3300006931 Bacteria 704
199 Ga0075435_100002348 3300007076 Bacteria 12546
200 Ga0075435_100696911 3300007076 Bacteria 883
201 Ga0075435_101192223 3300007076 Unclassified 666
202 Ga0099794_10308043 3300007265 Bacteria 821
203 Ga0099795_10337784 3300007788 Bacteria 671
204 Ga0099795_10435355 3300007788 Unclassified 601
205 Ga0105240_10098368 3300009093 Bacteria 3563
206 Ga0111539_10008128 3300009094 Bacteria 13366
207 Ga0111539_10053045 3300009094 Bacteria 4827
208 Ga0105245_11688174 3300009098 Unclassified 686
209 Ga0105247_10000050 3300009101 Bacteria 146183
210 Ga0105247_10434427 3300009101 Bacteria 943
211 Ga0114129_10046027 3300009147 Bacteria 6132
212 Ga0114129_10120482 3300009147 Unclassified 3612
213 Ga0114129_10145598 3300009147 Bacteria 3246
214 Ga0114129_10524947 3300009147 Bacteria 1543
215 Ga0114129_13248034 3300009147 Unclassified 527
216 Ga0105243_10000096 3300009148 Bacteria 100257
217 Ga0105243_10016170 3300009148 Bacteria 5645
218 Ga0105243_10652470 3300009148 Unclassified 1020
219 Ga0105241_10783228 3300009174 Bacteria 877
220 Ga0105242_10013496 3300009176 Bacteria 6316
221 Ga0105248_10003524 3300009177 Bacteria 17356
222 Ga0105248_10019074 3300009177 Bacteria 7584
223 Ga0105248_10073618 3300009177 Unclassified 3839
224 Ga0105248_10546808 3300009177 Bacteria 1306
225 Ga0105248_11458935 3300009177 Unclassified 774
226 Ga0105237_10003725 3300009545 Bacteria 17950
227 Ga0105249_10205264 3300009553 Bacteria 1931
228 Ga0105239_10214275 3300010375 Bacteria 2159
229 Ga0105239_10332261 3300010375 Bacteria 1715
230 Ga0105246_10198651 3300011119 Unclassified 1557
231 Ga0157370_10161444 3300013104 Bacteria 2085
232 Ga0157374_10038662 3300013296 Bacteria 4387
233 Ga0157374_10103785 3300013296 Unclassified 2728
234 Ga0157378_10004042 3300013297 Bacteria 12955
235 Ga0157378_10028799 3300013297 Unclassified 4903
236 Ga0157378_10150941 3300013297 Unclassified 2165
237 Ga0157378_10294361 3300013297 Bacteria 1569
238 Ga0163162_10006421 3300013306 Bacteria 11387
239 Ga0163162_10095438 3300013306 Unclassified 3061
240 Ga0163162_10432446 3300013306 Bacteria 1448
241 Ga0157372_10014831 3300013307 Bacteria 8344
242 Ga0157372_10623043 3300013307 Bacteria 1257
243 Ga0157375_10118752 3300013308 Unclassified 2751
244 Ga0157375_10172367 3300013308 Unclassified 2312
245 Ga0157375_10188878 3300013308 Unclassified 2215
246 Ga0157375_12311023 3300013308 Unclassified 641
247 Ga0163163_10013358 3300014325 Bacteria 7516
248 Ga0163163_10030048 3300014325 Bacteria 5231
249 Ga0163163_10145747 3300014325 Unclassified 2411
250 Ga0163163_10758639 3300014325 Unclassified 1033
251 Ga0157380_10581084 3300014326 Bacteria 1105
252 Ga0157377_10023693 3300014745 Unclassified 3257
253 Ga0157377_10165622 3300014745 Unclassified 1378
254 Ga0157377_11494252 3300014745 Unclassified 537
255 Ga0157379_10038060 3300014968 Unclassified 4291
256 Ga0157379_10373029 3300014968 Bacteria 1308
257 Ga0157379_10486077 3300014968 Bacteria 1143
258 Ga0157376_10076776 3300014969 Bacteria 2855
259 Ga0157376_10122480 3300014969 Unclassified 2307
260 Ga0163161_10963176 3300017792 Unclassified 726
261 Ga0207672_1000212 3300025223 Bacteria 8197
262 Ga0207656_10470483 3300025321 Bacteria 636
263 Ga0207653_10000160 3300025885 Bacteria 47834
264 Ga0207653_10005743 3300025885 Bacteria 3869
265 Ga0207653_10073278 3300025885 Bacteria 1174
266 Ga0207642_10033608 3300025899 Bacteria 2172
267 Ga0207642_10225457 3300025899 Bacteria 1050
268 Ga0207710_10000003 3300025900 Bacteria 1071597
269 Ga0207710_10568716 3300025900 Unclassified 591
270 Ga0207680_10160450 3300025903 Unclassified 1507
271 Ga0207685_10000056 3300025905 Bacteria 34032
272 Ga0207699_10849549 3300025906 Unclassified 672
273 Ga0207645_10574379 3300025907 Bacteria 765
274 Ga0207684_10001244 3300025910 Bacteria 28307
275 Ga0207684_10581104 3300025910 Unclassified 957
276 Ga0207684_11220500 3300025910 Unclassified 622
277 Ga0207684_11292684 3300025910 Bacteria 601
278 Ga0207707_10286929 3300025912 Bacteria 1424
279 Ga0207671_10001860 3300025914 Bacteria 23563
280 Ga0207662_10455462 3300025918 Unclassified 875
281 Ga0207652_11234481 3300025921 Unclassified 650
282 Ga0207646_10000355 3300025922 Bacteria 62137
283 Ga0207646_10021275 3300025922 Bacteria 5996
284 Ga0207646_10131133 3300025922 Unclassified 2256
285 Ga0207646_10291802 3300025922 Bacteria 1474
286 Ga0207646_10702993 3300025922 Bacteria 904
287 Ga0207681_10869337 3300025923 Unclassified 754
288 Ga0207644_10000093 3300025931 Bacteria 64685
289 Ga0207644_10554603 3300025931 Bacteria 951
290 Ga0207644_10909829 3300025931 Unclassified 737
291 Ga0207690_10192549 3300025932 Unclassified 1543
292 Ga0207686_10000026 3300025934 Bacteria 169189
293 Ga0207709_10000142 3300025935 Bacteria 100236
294 Ga0207709_10020397 3300025935 Bacteria 3738
295 Ga0207670_10186239 3300025936 Bacteria 1567
296 Ga0207669_10128894 3300025937 Unclassified 1734
297 Ga0207704_10032852 3300025938 Bacteria 2943
298 Ga0207704_11410492 3300025938 Unclassified 597
299 Ga0207665_10000007 3300025939 Bacteria 177869
300 Ga0207665_10013684 3300025939 Bacteria 5336
301 Ga0207665_10122415 3300025939 Bacteria 1839
302 Ga0207665_10442674 3300025939 Unclassified 996
303 Ga0207691_10029985 3300025940 Bacteria 5087
304 Ga0207711_10029018 3300025941 Unclassified 4662
305 Ga0207711_10072840 3300025941 Bacteria 2985
306 Ga0207711_10095300 3300025941 Bacteria 2624
307 Ga0207689_11050241 3300025942 Bacteria 687
308 Ga0207689_11253301 3300025942 Bacteria 624
309 Ga0207661_10824049 3300025944 Unclassified 854
310 Ga0207679_10306952 3300025945 Bacteria 1370
311 Ga0207679_11685502 3300025945 Unclassified 580
312 Ga0207651_10893343 3300025960 Bacteria 791
313 Ga0207712_10679859 3300025961 Unclassified 897
314 Ga0207658_10271414 3300025986 Bacteria 1450
315 Ga0207658_11241847 3300025986 Unclassified 681
316 Ga0207677_10002150 3300026023 Bacteria 10360
317 Ga0207677_10578262 3300026023 Bacteria 983
318 Ga0207703_10000225 3300026035 Bacteria 64974
319 Ga0207703_10225841 3300026035 Bacteria 1676
320 Ga0207703_10362147 3300026035 Bacteria 1338
321 Ga0207703_10555173 3300026035 Bacteria 1083
322 Ga0207639_10457776 3300026041 Unclassified 1159
323 Ga0207639_10541320 3300026041 Bacteria 1068
324 Ga0207708_10051809 3300026075 Bacteria 3126
325 Ga0207708_10228176 3300026075 Bacteria 1494
326 Ga0207708_10418882 3300026075 Unclassified 1110
327 Ga0207708_11199366 3300026075 Bacteria 664
328 Ga0207641_10101546 3300026088 Bacteria 2535
329 Ga0207641_10577224 3300026088 Bacteria 1099
330 Ga0207641_11928776 3300026088 Unclassified 592
331 Ga0207648_10431557 3300026089 Bacteria 1198
332 Ga0207648_10866360 3300026089 Unclassified 843
333 Ga0207676_10007355 3300026095 Bacteria 7810
334 Ga0207676_10113983 3300026095 Unclassified 2267
335 Ga0207676_10319861 3300026095 Unclassified 1424
336 Ga0207676_10324796 3300026095 Bacteria 1414
337 Ga0207674_10307361 3300026116 Unclassified 1535
338 Ga0207675_100007393 3300026118 Bacteria 10380
339 Ga0207683_10097683 3300026121 Unclassified 2620
340 Ga0207683_10320492 3300026121 Bacteria 1420
341 Ga0207698_10027818 3300026142 Unclassified 4020
342 Ga0207698_10469705 3300026142 Bacteria 1218
343 Ga0207428_10012655 3300027907 Bacteria 7399
344 Ga0268266_11248031 3300028379 Bacteria 718
345 Ga0268266_11669203 3300028379 Bacteria 612
346 Ga0268265_10454199 3300028380 Bacteria 1197
347 Ga0268264_11146912 3300028381 Bacteria 786
348 Ga0307513_11114010 3300031456 Unclassified 502
349 Ga0307416_100836478 3300032002 Bacteria 1018
350 Ga0450923_161881 3300042125 Unclassified 545
351 Ga0453683_0145918 3300044673 Bacteria 1494
352 Ga0451576_2460620 3300045051 Unclassified 532
353 Ga0451576_2610984 3300045051 Unclassified 515
354 Ga0495582_0070871 3300046473 Unclassified 1929
355 Ga0495621_0094991 3300046539 Unclassified 1128
356 Ga0495656_0627483 3300046615 Unclassified 576
357 Ga0495625_0502595 3300046660 Unclassified 741
358 Ga0495659_0016664 3300046664 Bacteria 2428
359 Ga0495647_0116658 3300046681 Unclassified 1119
360 Ga0496100_1348403 3300048903 Unclassified 563
361 Ga0496102_0466269 3300048905 Unclassified 1184
362 Ga0496102_1127719 3300048905 Unclassified 704
363 Ga0496102_1865403 3300048905 Unclassified 518
364 Ga0496104_0718458 3300048907 Bacteria 907
365 Ga0496104_0748064 3300048907 Bacteria 885
366 Ga0496106_0616997 3300048909 Unclassified 868
367 Ga0496108_0998728 3300048911 Unclassified 715
368 Ga0496112_0208335 3300048915 Bacteria 1913
369 Ga0496112_0423375 3300048915 Bacteria 1270
370 Ga0496112_1463383 3300048915 Unclassified 597
371 Ga0501038_0022402 3300049574 Bacteria 5663
372 Ga0501273_083878 3300049770 Bacteria 533
373 nmdc:mga05p37_139025_c1 3300050507 Unclassified 2976
374 nmdc:mga05p37_163305_c1 3300050507 Bacteria 2719
375 nmdc:mga05p37_1874175_c1 3300050507 Unclassified 574
376 nmdc:mga09592_268964_c1 3300050508 Archaea 1478
377 nmdc:mga06r32_690410_c1 3300050510 Bacteria 987
378 nmdc:mga08y16_10741_c1 3300050511 Bacteria 9610
379 nmdc:mga0n895_652041_c1 3300050512 Unclassified 1051
380 nmdc:mga0n895_72907_c1 3300050512 Bacteria 3408
381 nmdc:mga0rr50_1489308_c1 3300050513 Unclassified 572
382 nmdc:mga0rr50_1571_c1 3300050513 Bacteria 12585
383 nmdc:mga08x19_56_c1 3300050514 Bacteria 120839
384 nmdc:mga08x19_772873_c1 3300050514 Unclassified 682
385 nmdc:mga0a205_720510_c1 3300050515 Unclassified 847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10187727 Ga0065715_101877273 96
2 3300005328 Ga0070676_10719833 Ga0070676_107198332 96
3 3300005329 Ga0070683_100774079 Ga0070683_1007740792 96
4 3300005330 Ga0070690_100375208 Ga0070690_1003752082 96
5 3300005338 Ga0068868_100290266 Ga0068868_1002902663 96
6 3300005344 Ga0070661_100087655 Ga0070661_1000876553 96
7 3300005354 Ga0070675_100849713 Ga0070675_1008497132 96
8 3300005364 Ga0070673_100081615 Ga0070673_1000816153 96
9 3300005366 Ga0070659_100392955 Ga0070659_1003929553 96
10 3300005367 Ga0070667_101003175 Ga0070667_1010031752 96
11 3300005456 Ga0070678_100766311 Ga0070678_1007663112 96
12 3300005459 Ga0068867_100579479 Ga0068867_1005794793 96
13 3300005466 Ga0070685_10497793 Ga0070685_104977931 96
14 3300005539 Ga0068853_100362222 Ga0068853_1003622222 96
15 3300005543 Ga0070672_100221393 Ga0070672_1002213933 96
16 3300005564 Ga0070664_100304610 Ga0070664_1003046104 96
17 3300005578 Ga0068854_100321918 Ga0068854_1003219183 96
18 3300005618 Ga0068864_100684593 Ga0068864_1006845931 96
19 3300005834 Ga0068851_10134492 Ga0068851_101344922 96
20 3300005841 Ga0068863_100526120 Ga0068863_1005261202 96
21 3300006358 Ga0068871_100575127 Ga0068871_1005751273 96
22 3300006881 Ga0068865_100830843 Ga0068865_1008308432 96
23 3300009177 Ga0105248_10546808 Ga0105248_105468082 96
24 3300013104 Ga0157370_10161444 Ga0157370_101614444 96
25 3300013296 Ga0157374_10038662 Ga0157374_100386624 96
26 3300013306 Ga0163162_10095438 Ga0163162_100954383 96
27 3300013307 Ga0157372_10623043 Ga0157372_106230433 96
28 3300013308 Ga0157375_10188878 Ga0157375_101888783 96
29 3300014745 Ga0157377_11494252 Ga0157377_114942521 96
30 3300025903 Ga0207680_10160450 Ga0207680_101604503 96
31 3300025907 Ga0207645_10574379 Ga0207645_105743792 96
32 3300025931 Ga0207644_10909829 Ga0207644_109098292 96
33 3300025932 Ga0207690_10192549 Ga0207690_101925493 96
34 3300025940 Ga0207691_10029985 Ga0207691_100299856 96
35 3300025944 Ga0207661_10824049 Ga0207661_108240492 96
36 3300025945 Ga0207679_11685502 Ga0207679_116855022 96
37 3300025986 Ga0207658_11241847 Ga0207658_112418472 96
38 3300026023 Ga0207677_10578262 Ga0207677_105782621 96
39 3300026041 Ga0207639_10541320 Ga0207639_105413201 96
40 3300026089 Ga0207648_10866360 Ga0207648_108663601 96
41 3300026095 Ga0207676_10324796 Ga0207676_103247963 96
42 3300026121 Ga0207683_10097683 Ga0207683_100976834 96
43 3300026142 Ga0207698_10469705 Ga0207698_104697053 96
44 3300026116 Ga0207674_10307361 Ga0207674_103073612 101
45 3300005356 Ga0070674_102186935 Ga0070674_1021869351 103
46 3300005444 Ga0070694_100104820 Ga0070694_1001048202 103
47 3300005445 Ga0070708_100090322 Ga0070708_1000903223 103
48 3300005539 Ga0068853_100071358 Ga0068853_1000713583 103
49 3300005546 Ga0070696_101043562 Ga0070696_1010435622 103
50 3300005564 Ga0070664_100187878 Ga0070664_1001878782 103
51 3300009147 Ga0114129_10524947 Ga0114129_105249472 103
52 3300013308 Ga0157375_10172367 Ga0157375_101723673 103
53 3300014325 Ga0163163_10013358 Ga0163163_1001335812 103
54 3300014969 Ga0157376_10122480 Ga0157376_101224802 103
55 3300026041 Ga0207639_10457776 Ga0207639_104577762 103
56 3300046473 Ga0495582_0070871 Ga0495582_0070871_1014_1328 103
57 3300046681 Ga0495647_0116658 Ga0495647_0116658_157_471 103
58 3300048903 Ga0496100_1348403 Ga0496100_1348403_159_473 103
59 3300048907 Ga0496104_0718458 Ga0496104_0718458_296_610 103
60 3300048911 Ga0496108_0998728 Ga0496108_0998728_331_645 103
61 3300048915 Ga0496112_1463383 Ga0496112_1463383_257_568 103
62 3300005290 Ga0065712_10164600 Ga0065712_101646002 104
63 3300005293 Ga0065715_10090755 Ga0065715_100907554 104
64 3300005334 Ga0068869_100691208 Ga0068869_1006912082 104
65 3300005334 Ga0068869_100712449 Ga0068869_1007124492 104
66 3300005338 Ga0068868_100012234 Ga0068868_10001223410 104
67 3300005355 Ga0070671_100164886 Ga0070671_1001648863 104
68 3300005364 Ga0070673_100578178 Ga0070673_1005781783 104
69 3300005365 Ga0070688_100209650 Ga0070688_1002096502 104
70 3300005366 Ga0070659_100659823 Ga0070659_1006598232 104
71 3300005367 Ga0070667_100064069 Ga0070667_1000640693 104
72 3300005440 Ga0070705_100717136 Ga0070705_1007171362 104
73 3300005456 Ga0070678_100294369 Ga0070678_1002943694 104
74 3300005457 Ga0070662_101071071 Ga0070662_1010710712 104
75 3300005459 Ga0068867_100420098 Ga0068867_1004200982 104
76 3300005466 Ga0070685_10079784 Ga0070685_100797841 104
77 3300005547 Ga0070693_100371600 Ga0070693_1003716001 104
78 3300005548 Ga0070665_100255202 Ga0070665_1002552022 104
79 3300005548 Ga0070665_101364559 Ga0070665_1013645592 104
80 3300005549 Ga0070704_100015158 Ga0070704_1000151586 104
81 3300005615 Ga0070702_100268141 Ga0070702_1002681412 104
82 3300005617 Ga0068859_100048869 Ga0068859_1000488694 104
83 3300005617 Ga0068859_101668704 Ga0068859_1016687042 104
84 3300005618 Ga0068864_100190549 Ga0068864_1001905494 104
85 3300005618 Ga0068864_100317006 Ga0068864_1003170062 104
86 3300005718 Ga0068866_10142842 Ga0068866_101428422 104
87 3300005834 Ga0068851_10119247 Ga0068851_101192473 104
88 3300005840 Ga0068870_10483194 Ga0068870_104831942 104
89 3300005840 Ga0068870_10637557 Ga0068870_106375572 104
90 3300005842 Ga0068858_100029238 Ga0068858_1000292384 104
91 3300006237 Ga0097621_100058489 Ga0097621_1000584894 104
92 3300006358 Ga0068871_100014977 Ga0068871_1000149774 104
93 3300006881 Ga0068865_101281445 Ga0068865_1012814452 104
94 3300006931 Ga0097620_100048868 Ga0097620_1000488684 104
95 3300006931 Ga0097620_101668951 Ga0097620_1016689511 104
96 3300009177 Ga0105248_10019074 Ga0105248_100190744 104
97 3300010375 Ga0105239_10214275 Ga0105239_102142751 104
98 3300013296 Ga0157374_10103785 Ga0157374_101037853 104
99 3300013297 Ga0157378_10004042 Ga0157378_100040424 104
100 3300013306 Ga0163162_10006421 Ga0163162_100064219 104
101 3300013308 Ga0157375_10118752 Ga0157375_101187523 104
102 3300014325 Ga0163163_10030048 Ga0163163_100300482 104
103 3300014325 Ga0163163_10145747 Ga0163163_101457474 104
104 3300014325 Ga0163163_10758639 Ga0163163_107586392 104
105 3300014745 Ga0157377_10023693 Ga0157377_100236933 104
106 3300014968 Ga0157379_10486077 Ga0157379_104860772 104
107 3300014969 Ga0157376_10076776 Ga0157376_100767764 104
108 3300025321 Ga0207656_10470483 Ga0207656_104704832 104
109 3300025899 Ga0207642_10225457 Ga0207642_102254572 104
110 3300025931 Ga0207644_10554603 Ga0207644_105546032 104
111 3300025938 Ga0207704_11410492 Ga0207704_114104921 104
112 3300025941 Ga0207711_10095300 Ga0207711_100953003 104
113 3300025942 Ga0207689_11050241 Ga0207689_110502412 104
114 3300025960 Ga0207651_10893343 Ga0207651_108933431 104
115 3300025986 Ga0207658_10271414 Ga0207658_102714142 104
116 3300026023 Ga0207677_10002150 Ga0207677_100021506 104
117 3300026035 Ga0207703_10555173 Ga0207703_105551732 104
118 3300026088 Ga0207641_10577224 Ga0207641_105772241 104
119 3300026089 Ga0207648_10431557 Ga0207648_104315572 104
120 3300026095 Ga0207676_10007355 Ga0207676_100073556 104
121 3300026095 Ga0207676_10319861 Ga0207676_103198612 104
122 3300026121 Ga0207683_10320492 Ga0207683_103204924 104
123 3300028379 Ga0268266_11248031 Ga0268266_112480312 104
124 3300028379 Ga0268266_11669203 Ga0268266_116692032 104
125 3300032002 Ga0307416_100836478 Ga0307416_1008364782 104
126 3300042125 Ga0450923_161881 Ga0450923_161881_157_477 104
127 3300045051 Ga0451576_2460620 Ga0451576_2460620_87_401 104
128 3300048915 Ga0496112_0423375 Ga0496112_0423375_806_1123 104
129 3300049770 Ga0501273_083878 Ga0501273_083878_148_465 104
130 3300005289 Ga0065704_10304131 Ga0065704_103041312 105
131 3300005295 Ga0065707_10155656 Ga0065707_101556563 105
132 3300005334 Ga0068869_101162029 Ga0068869_1011620292 105
133 3300005440 Ga0070705_101033558 Ga0070705_1010335582 105
134 3300005444 Ga0070694_100463382 Ga0070694_1004633822 105
135 3300005444 Ga0070694_100702973 Ga0070694_1007029732 105
136 3300005468 Ga0070707_100360690 Ga0070707_1003606903 105
137 3300005471 Ga0070698_100272614 Ga0070698_1002726143 105
138 3300005536 Ga0070697_100070605 Ga0070697_1000706053 105
139 3300005536 Ga0070697_100122337 Ga0070697_1001223372 105
140 3300005546 Ga0070696_100020826 Ga0070696_1000208262 105
141 3300005617 Ga0068859_100579036 Ga0068859_1005790363 105
142 3300006931 Ga0097620_100579054 Ga0097620_1005790543 105
143 3300009147 Ga0114129_10046027 Ga0114129_100460274 105
144 3300009177 Ga0105248_10003524 Ga0105248_1000352411 105
145 3300025922 Ga0207646_10291802 Ga0207646_102918023 105
146 3300025941 Ga0207711_10072840 Ga0207711_100728402 105
147 3300031456 Ga0307513_11114010 Ga0307513_111140101 105
148 3300050507 nmdc:mga05p37_163305_c1 nmdc:mga05p37_163305_c1_1229_1549 105
149 3300050512 nmdc:mga0n895_652041_c1 nmdc:mga0n895_652041_c1_283_606 105
150 3300005289 Ga0065704_10137052 Ga0065704_101370522 106
151 3300005289 Ga0065704_10599380 Ga0065704_105993801 106
152 3300005293 Ga0065715_10036261 Ga0065715_100362611 106
153 3300005295 Ga0065707_10003815 Ga0065707_100038155 106
154 3300005295 Ga0065707_10312127 Ga0065707_103121271 106
155 3300005334 Ga0068869_100837469 Ga0068869_1008374692 106
156 3300005334 Ga0068869_101143185 Ga0068869_1011431852 106
157 3300005336 Ga0070680_100937625 Ga0070680_1009376252 106
158 3300005337 Ga0070682_100002269 Ga0070682_10000226913 106
159 3300005338 Ga0068868_102111546 Ga0068868_1021115461 106
160 3300005339 Ga0070660_100344676 Ga0070660_1003446761 106
161 3300005343 Ga0070687_100158692 Ga0070687_1001586923 106
162 3300005343 Ga0070687_100307204 Ga0070687_1003072042 106
163 3300005345 Ga0070692_10003369 Ga0070692_1000336910 106
164 3300005345 Ga0070692_10028194 Ga0070692_100281944 106
165 3300005353 Ga0070669_100866607 Ga0070669_1008666071 106
166 3300005354 Ga0070675_101040717 Ga0070675_1010407171 106
167 3300005365 Ga0070688_101677157 Ga0070688_1016771572 106
168 3300005406 Ga0070703_10000046 Ga0070703_1000004641 106
169 3300005406 Ga0070703_10010311 Ga0070703_100103112 106
170 3300005440 Ga0070705_100024988 Ga0070705_1000249883 106
171 3300005440 Ga0070705_100034197 Ga0070705_1000341973 106
172 3300005440 Ga0070705_100967786 Ga0070705_1009677862 106
173 3300005441 Ga0070700_100264003 Ga0070700_1002640032 106
174 3300005441 Ga0070700_100536283 Ga0070700_1005362832 106
175 3300005441 Ga0070700_100796005 Ga0070700_1007960051 106
176 3300005444 Ga0070694_100000175 Ga0070694_10000017533 106
177 3300005444 Ga0070694_100059766 Ga0070694_1000597664 106
178 3300005444 Ga0070694_100137280 Ga0070694_1001372802 106
179 3300005444 Ga0070694_100157639 Ga0070694_1001576393 106
180 3300005445 Ga0070708_100343304 Ga0070708_1003433043 106
181 3300005445 Ga0070708_100735482 Ga0070708_1007354821 106
182 3300005445 Ga0070708_100977815 Ga0070708_1009778151 106
183 3300005467 Ga0070706_100821919 Ga0070706_1008219191 106
184 3300005468 Ga0070707_100000284 Ga0070707_10000028434 106
185 3300005468 Ga0070707_100020865 Ga0070707_1000208655 106
186 3300005468 Ga0070707_100435879 Ga0070707_1004358791 106
187 3300005468 Ga0070707_100660350 Ga0070707_1006603502 106
188 3300005468 Ga0070707_102083597 Ga0070707_1020835971 106
189 3300005471 Ga0070698_100309181 Ga0070698_1003091813 106
190 3300005471 Ga0070698_101242069 Ga0070698_1012420691 106
191 3300005471 Ga0070698_101966041 Ga0070698_1019660411 106
192 3300005518 Ga0070699_100081759 Ga0070699_1000817592 106
193 3300005518 Ga0070699_100089592 Ga0070699_1000895924 106
194 3300005518 Ga0070699_100138741 Ga0070699_1001387414 106
195 3300005518 Ga0070699_100227493 Ga0070699_1002274932 106
196 3300005518 Ga0070699_100264663 Ga0070699_1002646631 106
197 3300005518 Ga0070699_100354927 Ga0070699_1003549271 106
198 3300005518 Ga0070699_100463642 Ga0070699_1004636422 106
199 3300005518 Ga0070699_100619347 Ga0070699_1006193472 106
200 3300005536 Ga0070697_100004174 Ga0070697_1000041745 106
201 3300005544 Ga0070686_101038820 Ga0070686_1010388201 106
202 3300005545 Ga0070695_100216787 Ga0070695_1002167873 106
203 3300005545 Ga0070695_100781672 Ga0070695_1007816721 106
204 3300005546 Ga0070696_100554527 Ga0070696_1005545272 106
205 3300005547 Ga0070693_100001099 Ga0070693_10000109915 106
206 3300005549 Ga0070704_100010294 Ga0070704_1000102945 106
207 3300005549 Ga0070704_100015585 Ga0070704_1000155855 106
208 3300005549 Ga0070704_100731523 Ga0070704_1007315232 106
209 3300005549 Ga0070704_100938755 Ga0070704_1009387551 106
210 3300005549 Ga0070704_101761233 Ga0070704_1017612332 106
211 3300005563 Ga0068855_100272743 Ga0068855_1002727432 106
212 3300005615 Ga0070702_100179974 Ga0070702_1001799742 106
213 3300005617 Ga0068859_100041606 Ga0068859_1000416063 106
214 3300005617 Ga0068859_100091251 Ga0068859_1000912513 106
215 3300005617 Ga0068859_100317531 Ga0068859_1003175312 106
216 3300005618 Ga0068864_101761077 Ga0068864_1017610771 106
217 3300005718 Ga0068866_10143757 Ga0068866_101437572 106
218 3300005841 Ga0068863_100166181 Ga0068863_1001661812 106
219 3300005842 Ga0068858_100063505 Ga0068858_1000635054 106
220 3300005842 Ga0068858_100544331 Ga0068858_1005443312 106
221 3300005842 Ga0068858_100678595 Ga0068858_1006785952 106
222 3300005843 Ga0068860_101278547 Ga0068860_1012785472 106
223 3300005843 Ga0068860_101907356 Ga0068860_1019073562 106
224 3300005844 Ga0068862_100276568 Ga0068862_1002765682 106
225 3300006173 Ga0070716_100000002 Ga0070716_100000002114 106
226 3300006173 Ga0070716_100169009 Ga0070716_1001690093 106
227 3300006173 Ga0070716_100236580 Ga0070716_1002365801 106
228 3300006237 Ga0097621_100001118 Ga0097621_10000111812 106
229 3300006237 Ga0097621_102270814 Ga0097621_1022708141 106
230 3300006358 Ga0068871_100019099 Ga0068871_1000190994 106
231 3300006358 Ga0068871_100218159 Ga0068871_1002181594 106
232 3300006844 Ga0075428_100375742 Ga0075428_1003757421 106
233 3300006847 Ga0075431_100761265 Ga0075431_1007612652 106
234 3300006847 Ga0075431_101566239 Ga0075431_1015662392 106
235 3300006880 Ga0075429_100122824 Ga0075429_1001228241 106
236 3300006880 Ga0075429_100695522 Ga0075429_1006955221 106
237 3300006880 Ga0075429_100909623 Ga0075429_1009096232 106
238 3300006881 Ga0068865_100654997 Ga0068865_1006549972 106
239 3300006931 Ga0097620_100041611 Ga0097620_1000416113 106
240 3300006931 Ga0097620_100091254 Ga0097620_1000912542 106
241 3300006931 Ga0097620_100317525 Ga0097620_1003175252 106
242 3300007265 Ga0099794_10308043 Ga0099794_103080432 106
243 3300007788 Ga0099795_10337784 Ga0099795_103377842 106
244 3300009093 Ga0105240_10098368 Ga0105240_100983683 106
245 3300009094 Ga0111539_10008128 Ga0111539_100081284 106
246 3300009094 Ga0111539_10053045 Ga0111539_100530455 106
247 3300009098 Ga0105245_11688174 Ga0105245_116881742 106
248 3300009101 Ga0105247_10434427 Ga0105247_104344272 106
249 3300009147 Ga0114129_10145598 Ga0114129_101455982 106
250 3300009147 Ga0114129_13248034 Ga0114129_132480341 106
251 3300009148 Ga0105243_10000096 Ga0105243_100000962 106
252 3300009148 Ga0105243_10016170 Ga0105243_100161705 106
253 3300009148 Ga0105243_10652470 Ga0105243_106524702 106
254 3300009176 Ga0105242_10013496 Ga0105242_1001349611 106
255 3300009177 Ga0105248_10073618 Ga0105248_100736183 106
256 3300009177 Ga0105248_11458935 Ga0105248_114589352 106
257 3300009545 Ga0105237_10003725 Ga0105237_1000372516 106
258 3300009553 Ga0105249_10205264 Ga0105249_102052644 106
259 3300010375 Ga0105239_10332261 Ga0105239_103322611 106
260 3300011119 Ga0105246_10198651 Ga0105246_101986512 106
261 3300013297 Ga0157378_10150941 Ga0157378_101509414 106
262 3300013297 Ga0157378_10294361 Ga0157378_102943614 106
263 3300013306 Ga0163162_10432446 Ga0163162_104324463 106
264 3300013307 Ga0157372_10014831 Ga0157372_1001483111 106
265 3300013308 Ga0157375_12311023 Ga0157375_123110231 106
266 3300014326 Ga0157380_10581084 Ga0157380_105810842 106
267 3300014745 Ga0157377_10165622 Ga0157377_101656223 106
268 3300014968 Ga0157379_10373029 Ga0157379_103730292 106
269 3300017792 Ga0163161_10963176 Ga0163161_109631762 106
270 3300025885 Ga0207653_10000160 Ga0207653_1000016033 106
271 3300025885 Ga0207653_10005743 Ga0207653_100057432 106
272 3300025885 Ga0207653_10073278 Ga0207653_100732783 106
273 3300025900 Ga0207710_10568716 Ga0207710_105687161 106
274 3300025910 Ga0207684_10001244 Ga0207684_1000124411 106
275 3300025910 Ga0207684_11220500 Ga0207684_112205002 106
276 3300025910 Ga0207684_11292684 Ga0207684_112926841 106
277 3300025914 Ga0207671_10001860 Ga0207671_1000186015 106
278 3300025918 Ga0207662_10455462 Ga0207662_104554621 106
279 3300025922 Ga0207646_10000355 Ga0207646_1000035516 106
280 3300025922 Ga0207646_10021275 Ga0207646_100212752 106
281 3300025922 Ga0207646_10131133 Ga0207646_101311334 106
282 3300025922 Ga0207646_10702993 Ga0207646_107029931 106
283 3300025923 Ga0207681_10869337 Ga0207681_108693372 106
284 3300025934 Ga0207686_10000026 Ga0207686_100000262 106
285 3300025935 Ga0207709_10000142 Ga0207709_100001422 106
286 3300025935 Ga0207709_10020397 Ga0207709_100203975 106
287 3300025936 Ga0207670_10186239 Ga0207670_101862392 106
288 3300025938 Ga0207704_10032852 Ga0207704_100328525 106
289 3300025939 Ga0207665_10000007 Ga0207665_1000000776 106
290 3300025939 Ga0207665_10122415 Ga0207665_101224154 106
291 3300025939 Ga0207665_10442674 Ga0207665_104426742 106
292 3300025941 Ga0207711_10029018 Ga0207711_100290183 106
293 3300025942 Ga0207689_11253301 Ga0207689_112533011 106
294 3300025961 Ga0207712_10679859 Ga0207712_106798592 106
295 3300026035 Ga0207703_10225841 Ga0207703_102258412 106
296 3300026035 Ga0207703_10362147 Ga0207703_103621473 106
297 3300026075 Ga0207708_10051809 Ga0207708_100518092 106
298 3300026075 Ga0207708_10228176 Ga0207708_102281761 106
299 3300026075 Ga0207708_10418882 Ga0207708_104188822 106
300 3300026075 Ga0207708_11199366 Ga0207708_111993661 106
301 3300026088 Ga0207641_10101546 Ga0207641_101015463 106
302 3300026095 Ga0207676_10113983 Ga0207676_101139834 106
303 3300026142 Ga0207698_10027818 Ga0207698_100278184 106
304 3300027907 Ga0207428_10012655 Ga0207428_100126552 106
305 3300028380 Ga0268265_10454199 Ga0268265_104541992 106
306 3300028381 Ga0268264_11146912 Ga0268264_111469122 106
307 3300046539 Ga0495621_0094991 Ga0495621_0094991_495_821 106
308 3300046615 Ga0495656_0627483 Ga0495656_0627483_220_546 106
309 3300046664 Ga0495659_0016664 Ga0495659_0016664_1039_1365 106
310 3300050507 nmdc:mga05p37_1874175_c1 nmdc:mga05p37_1874175_c1_79_399 106
311 3300050508 nmdc:mga09592_268964_c1 nmdc:mga09592_268964_c1_1122_1442 106
312 3300050510 nmdc:mga06r32_690410_c1 nmdc:mga06r32_690410_c1_219_539 106
313 3300050511 nmdc:mga08y16_10741_c1 nmdc:mga08y16_10741_c1_1578_1898 106
314 3300050513 nmdc:mga0rr50_1489308_c1 nmdc:mga0rr50_1489308_c1_105_431 106
315 3300050514 nmdc:mga08x19_772873_c1 nmdc:mga08x19_772873_c1_266_595 106
316 3300005293 Ga0065715_10279782 Ga0065715_102797822 107
317 3300005434 Ga0070709_10105727 Ga0070709_101057273 107
318 3300005445 Ga0070708_101312123 Ga0070708_1013121231 107
319 3300005467 Ga0070706_100055012 Ga0070706_1000550121 107
320 3300005468 Ga0070707_100530531 Ga0070707_1005305311 107
321 3300005471 Ga0070698_100022421 Ga0070698_1000224216 107
322 3300005547 Ga0070693_100004402 Ga0070693_1000044028 107
323 3300005549 Ga0070704_100301022 Ga0070704_1003010222 107
324 3300005564 Ga0070664_100357294 Ga0070664_1003572942 107
325 3300005719 Ga0068861_100004130 Ga0068861_1000041306 107
326 3300006163 Ga0070715_10000064 Ga0070715_1000006412 107
327 3300006914 Ga0075436_100000014 Ga0075436_10000001431 107
328 3300007076 Ga0075435_100002348 Ga0075435_1000023486 107
329 3300009174 Ga0105241_10783228 Ga0105241_107832282 107
330 3300025905 Ga0207685_10000056 Ga0207685_1000005621 107
331 3300025906 Ga0207699_10849549 Ga0207699_108495491 107
332 3300025910 Ga0207684_10581104 Ga0207684_105811042 107
333 3300025912 Ga0207707_10286929 Ga0207707_102869292 107
334 3300025921 Ga0207652_11234481 Ga0207652_112344812 107
335 3300025939 Ga0207665_10013684 Ga0207665_100136844 107
336 3300025945 Ga0207679_10306952 Ga0207679_103069522 107
337 3300026118 Ga0207675_100007393 Ga0207675_1000073936 107
338 3300048905 Ga0496102_1127719 Ga0496102_1127719_74_403 107
339 3300048907 Ga0496104_0748064 Ga0496104_0748064_244_573 107
340 3300048909 Ga0496106_0616997 Ga0496106_0616997_269_598 107
341 3300048915 Ga0496112_0208335 Ga0496112_0208335_1145_1474 107
342 3300049574 Ga0501038_0022402 Ga0501038_0022402_2635_2967 107
343 3300050513 nmdc:mga0rr50_1571_c1 nmdc:mga0rr50_1571_c1_5163_5486 107
344 3300050514 nmdc:mga08x19_56_c1 nmdc:mga08x19_56_c1_118321_118644 107
345 3300005467 Ga0070706_100030782 Ga0070706_1000307826 108
346 3300005471 Ga0070698_100001820 Ga0070698_1000018209 108
347 3300007076 Ga0075435_100696911 Ga0075435_1006969112 108
348 3300005295 Ga0065707_10499789 Ga0065707_104997892 109
349 3300005467 Ga0070706_101657446 Ga0070706_1016574461 109
350 3300006358 Ga0068871_100544646 Ga0068871_1005446462 109
351 3300006871 Ga0075434_100116129 Ga0075434_1001161292 109
352 3300007788 Ga0099795_10435355 Ga0099795_104353552 109
353 3300009147 Ga0114129_10120482 Ga0114129_101204823 109
354 3300044673 Ga0453683_0145918 Ga0453683_0145918_75_407 109
355 3300046660 Ga0495625_0502595 Ga0495625_0502595_273_608 109
356 3300048905 Ga0496102_0466269 Ga0496102_0466269_502_846 109
357 3300050507 nmdc:mga05p37_139025_c1 nmdc:mga05p37_139025_c1_2569_2898 109
358 3300050512 nmdc:mga0n895_72907_c1 nmdc:mga0n895_72907_c1_1056_1394 109
359 3300050515 nmdc:mga0a205_720510_c1 nmdc:mga0a205_720510_c1_86_424 109
360 2162886012 MBSR1b_contig_13121653 MBSR1b_0748.00006220 110
361 3300001432 JGI24034J14986_100191 JGI24034J14986_1001914 110
362 3300002074 JGI24748J21848_1000014 JGI24748J21848_100001447 110
363 3300002239 JGI24034J26672_10000012 JGI24034J26672_1000001277 110
364 3300002244 JGI24742J22300_10007622 JGI24742J22300_100076223 110
365 3300005293 Ga0065715_10334748 Ga0065715_103347482 110
366 3300005356 Ga0070674_100131194 Ga0070674_1001311944 110
367 3300005545 Ga0070695_100052100 Ga0070695_1000521006 110
368 3300005617 Ga0068859_100501173 Ga0068859_1005011732 110
369 3300005718 Ga0068866_10004970 Ga0068866_100049702 110
370 3300005841 Ga0068863_102195043 Ga0068863_1021950432 110
371 3300005842 Ga0068858_100000194 Ga0068858_10000019424 110
372 3300006931 Ga0097620_100501193 Ga0097620_1005011932 110
373 3300007076 Ga0075435_101192223 Ga0075435_1011922231 110
374 3300009101 Ga0105247_10000050 Ga0105247_1000005046 110
375 3300013297 Ga0157378_10028799 Ga0157378_100287993 110
376 3300014968 Ga0157379_10038060 Ga0157379_100380604 110
377 3300025223 Ga0207672_1000212 Ga0207672_10002124 110
378 3300025899 Ga0207642_10033608 Ga0207642_100336083 110
379 3300025900 Ga0207710_10000003 Ga0207710_10000003836 110
380 3300025931 Ga0207644_10000093 Ga0207644_1000009316 110
381 3300025937 Ga0207669_10128894 Ga0207669_101288942 110
382 3300026035 Ga0207703_10000225 Ga0207703_1000022539 110
383 3300026088 Ga0207641_11928776 Ga0207641_119287762 110
384 3300045051 Ga0451576_2610984 Ga0451576_2610984_138_476 110
385 3300048905 Ga0496102_1865403 Ga0496102_1865403_16_366 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

26

113

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ky4-assembly1.cif.gz_D s-adenosylhomocysteine hydrolase refined with noncrystallographic restraints 0.8771 12 38
6npc-assembly1.cif.gz_B x-ray crystal structure of tmpa, 2-trimethylaminoethylphosphonate hydroxylase, with fe, 2og, and 2-trimethylaminoethylphosphonate 0.8492 10 102
5tul-assembly1.cif.gz_A crystal structure of tetracycline destructase tet(55) 0.8487 12 37
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.8478 9 103
6npb-assembly1.cif.gz_A x-ray crystal structure of tmpa, 2-trimethylaminoethylphosphonate hydroxylase, with fe and 2og 0.8333 11 102
ID Description Score Start End Superfamily
af_Q55AZ2_1151_1234_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9274 13 37 2.30.29.30
3l8kB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8851 16 37 3.50.50.60
af_Q54US8_49_419_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.885 12 35 3.50.50.60
af_A0A1D8PNJ2_5_94_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8782 15 101 3.30.2020.30
af_E7F0M9_49_126_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8719 25 103 3.30.2020.30
ID Description Score Start End GO Terms
AF-A0A352FN04-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9865 2 109 GO:0046872
AF-A0A2H5W216-F1-model_v4 Gamma-butyrobetaine dioxygenase (EC 1.14.11.1) 0.9848 12 104 GO:0008336
GO:0046872
AF-A0A2V8Q809-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9807 1 106 GO:0046872
AF-A0A7W1KZM3-F1-model_v4 DUF971 domain-containing protein 0.9804 9 109 GO:0046872
AF-A0A7Y4TSI3-F1-model_v4 DUF971 domain-containing protein 0.9785 12 102 GO:0046872

Feature Viewer

pLDDT pTM Quality
91.35 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map