F430113

General Info

Members Datasets Scaffolds Average Seq Length
385 190 770 111

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10901119|Ga0070691_109011191
Length 123
Sequence MDVRGVAGPLASLDAVSFETAIHQWREGERRLAEAPQNERPALERVTARIHAELRRRLGGPFTVDELADLYDSGTSWCLDVAVQVAPGAPWAWDARITCDAAFARYVREATDFAGGRRIETGP

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 8.31
Rhizosphere 82.6
Stem 0
Stem Tuber 0
Unclassified 10.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10901119 3300005341 Bacteria 545
2 JGI25406J46586_10017542 3300003203 Bacteria 2958
3 Ga0070680_100574351 3300005336 Bacteria 967
4 Ga0070682_100577152 3300005337 Bacteria 884
5 Ga0070661_100503426 3300005344 Bacteria 970
6 Ga0070692_10083969 3300005345 Bacteria 1720
7 Ga0070692_10426731 3300005345 Bacteria 843
8 Ga0070674_102004026 3300005356 Unclassified 527
9 Ga0070659_100000163 3300005366 Bacteria 51399
10 Ga0070659_100405980 3300005366 Bacteria 1151
11 Ga0070709_10443927 3300005434 Bacteria 976
12 Ga0070714_100016724 3300005435 Bacteria 5931
13 Ga0070714_100040292 3300005435 Bacteria 3937
14 Ga0070714_100043325 3300005435 Bacteria 3806
15 Ga0070714_100052740 3300005435 Bacteria 3470
16 Ga0070714_100172478 3300005435 Bacteria 1964
17 Ga0070714_100540453 3300005435 Bacteria 1115
18 Ga0070714_100809099 3300005435 Bacteria 908
19 Ga0070714_101609140 3300005435 Bacteria 634
20 Ga0070714_102042098 3300005435 Unclassified 559
21 Ga0070713_100117274 3300005436 Bacteria 2329
22 Ga0070713_100472894 3300005436 Bacteria 1180
23 Ga0070713_101204815 3300005436 Bacteria 733
24 Ga0070713_102208793 3300005436 Bacteria 533
25 Ga0070710_10000001 3300005437 Bacteria 552187
26 Ga0070710_10208524 3300005437 Bacteria 1238
27 Ga0070710_10770378 3300005437 Unclassified 685
28 Ga0070710_11039914 3300005437 Bacteria 598
29 Ga0070711_100102257 3300005439 Bacteria 2087
30 Ga0070711_100659509 3300005439 Bacteria 878
31 Ga0070700_101099603 3300005441 Bacteria 659
32 Ga0070700_101292405 3300005441 Bacteria 613
33 Ga0070663_100164605 3300005455 Bacteria 1710
34 Ga0070662_100374373 3300005457 Bacteria 1171
35 Ga0070681_10187286 3300005458 Bacteria 1990
36 Ga0070681_10273251 3300005458 Bacteria 1601
37 Ga0070684_100835081 3300005535 Bacteria 862
38 Ga0068853_102250114 3300005539 Bacteria 528
39 Ga0070696_100576928 3300005546 Bacteria 904
40 Ga0070696_101802938 3300005546 Bacteria 529
41 Ga0070665_100003731 3300005548 Bacteria 16131
42 Ga0070704_100262503 3300005549 Bacteria 1423
43 Ga0070664_100274577 3300005564 Bacteria 1519
44 Ga0068856_100615599 3300005614 Bacteria 1107
45 Ga0068856_102242585 3300005614 Bacteria 555
46 Ga0070702_100653313 3300005615 Bacteria 796
47 Ga0068859_101888709 3300005617 Bacteria 659
48 Ga0068859_102712094 3300005617 Bacteria 544
49 Ga0068866_11230763 3300005718 Bacteria 541
50 Ga0068861_100702281 3300005719 Unclassified 940
51 Ga0068862_101622482 3300005844 Unclassified 654
52 Ga0068862_101673363 3300005844 Bacteria 644
53 Ga0081455_10066658 3300005937 Bacteria 3005
54 Ga0081455_10474704 3300005937 Unclassified 848
55 Ga0081540_1005116 3300005983 Bacteria 9835
56 Ga0081539_10003175 3300005985 Bacteria 20824
57 Ga0081539_10009885 3300005985 Bacteria 7868
58 Ga0081539_10162821 3300005985 Bacteria 1062
59 Ga0070717_10026913 3300006028 Bacteria 4593
60 Ga0070717_10028957 3300006028 Bacteria 4438
61 Ga0070717_10034640 3300006028 Bacteria 4083
62 Ga0070717_10077204 3300006028 Bacteria 2788
63 Ga0070717_10080932 3300006028 Bacteria 2726
64 Ga0075365_10179668 3300006038 Bacteria 1479
65 Ga0070712_100000009 3300006175 Bacteria 143615
66 Ga0070712_100018866 3300006175 Bacteria 4488
67 Ga0075428_101172518 3300006844 Bacteria 810
68 Ga0075431_100364550 3300006847 Bacteria 1451
69 Ga0075434_101797480 3300006871 Bacteria 620
70 Ga0075429_100009743 3300006880 Bacteria 8326
71 Ga0068865_101613749 3300006881 Bacteria 583
72 Ga0097620_101889379 3300006931 Bacteria 659
73 Ga0097620_102713565 3300006931 Bacteria 544
74 Ga0105240_10107225 3300009093 Bacteria 3387
75 Ga0111539_11579568 3300009094 Bacteria 761
76 Ga0105245_10283784 3300009098 Bacteria 1619
77 Ga0105245_11547802 3300009098 Unclassified 714
78 Ga0114129_11066794 3300009147 Bacteria 1013
79 Ga0114129_12916645 3300009147 Bacteria 565
80 Ga0105243_11397622 3300009148 Bacteria 720
81 Ga0105243_11460444 3300009148 Bacteria 706
82 Ga0105242_10062382 3300009176 Bacteria 3067
83 Ga0105248_12270796 3300009177 Bacteria 618
84 Ga0105238_12980747 3300009551 Bacteria 509
85 Ga0105249_11726176 3300009553 Unclassified 698
86 Ga0105239_10066612 3300010375 Bacteria 3956
87 Ga0105239_10931901 3300010375 Bacteria 997
88 Ga0105246_10006461 3300011119 Bacteria 7161
89 Ga0157369_11636358 3300013105 Bacteria 654
90 Ga0157372_10970293 3300013307 Unclassified 985
91 Ga0157372_11480284 3300013307 Bacteria 782
92 Ga0157372_12208025 3300013307 Unclassified 632
93 Ga0157375_12499560 3300013308 Unclassified 617
94 Ga0157380_11542875 3300014326 Bacteria 718
95 Ga0157377_11053789 3300014745 Bacteria 620
96 Ga0157379_11767094 3300014968 Bacteria 607
97 Ga0157376_10067872 3300014969 Bacteria 3017
98 Ga0206354_10810603 3300020081 Bacteria 629
99 Ga0206353_11630166 3300020082 Bacteria 771
100 Ga0213873_10106699 3300021358 Bacteria 810
101 Ga0213873_10183376 3300021358 Bacteria 643
102 Ga0213874_10000318 3300021377 Bacteria 9539
103 Ga0213876_10001692 3300021384 Bacteria 13415
104 Ga0213876_10014290 3300021384 Bacteria 4209
105 Ga0213876_10047705 3300021384 Bacteria 2264
106 Ga0213876_10059446 3300021384 Bacteria 2017
107 Ga0213876_10215906 3300021384 Unclassified 1020
108 Ga0213875_10178728 3300021388 Bacteria 997
109 Ga0207692_10307607 3300025898 Bacteria 966
110 Ga0207692_10322209 3300025898 Bacteria 946
111 Ga0207699_10420329 3300025906 Bacteria 955
112 Ga0207705_10451507 3300025909 Unclassified 997
113 Ga0207695_11337660 3300025913 Bacteria 597
114 Ga0207693_10000101 3300025915 Bacteria 76993
115 Ga0207693_10019479 3300025915 Bacteria 5396
116 Ga0207663_10496836 3300025916 Bacteria 947
117 Ga0207663_11404331 3300025916 Bacteria 562
118 Ga0207657_10126748 3300025919 Bacteria 2096
119 Ga0207652_10439884 3300025921 Bacteria 1176
120 Ga0207681_10001085 3300025923 Bacteria 17649
121 Ga0207700_10070765 3300025928 Bacteria 2683
122 Ga0207700_10114299 3300025928 Bacteria 2178
123 Ga0207700_10802497 3300025928 Unclassified 842
124 Ga0207700_11514290 3300025928 Bacteria 595
125 Ga0207700_11767629 3300025928 Bacteria 544
126 Ga0207664_10000040 3300025929 Bacteria 158895
127 Ga0207664_10010865 3300025929 Bacteria 6447
128 Ga0207664_10127054 3300025929 Bacteria 2142
129 Ga0207664_10174651 3300025929 Bacteria 1841
130 Ga0207664_10396071 3300025929 Bacteria 1228
131 Ga0207664_10519980 3300025929 Bacteria 1067
132 Ga0207664_10546724 3300025929 Bacteria 1039
133 Ga0207664_10642889 3300025929 Bacteria 953
134 Ga0207664_10919440 3300025929 Bacteria 785
135 Ga0207690_10000166 3300025932 Bacteria 51430
136 Ga0207690_10604880 3300025932 Unclassified 895
137 Ga0207706_11229478 3300025933 Unclassified 621
138 Ga0207704_10191865 3300025938 Bacteria 1487
139 Ga0207665_11036050 3300025939 Bacteria 653
140 Ga0207661_10045715 3300025944 Bacteria 3467
141 Ga0207661_10185219 3300025944 Bacteria 1821
142 Ga0207661_10326364 3300025944 Bacteria 1381
143 Ga0207661_11900629 3300025944 Bacteria 541
144 Ga0207679_10612047 3300025945 Bacteria 982
145 Ga0207677_10746628 3300026023 Bacteria 872
146 Ga0207678_10063410 3300026067 Bacteria 3176
147 Ga0207678_10813349 3300026067 Bacteria 825
148 Ga0207708_10631797 3300026075 Bacteria 910
149 Ga0207702_11044763 3300026078 Bacteria 811
150 Ga0207702_11886705 3300026078 Bacteria 589
151 Ga0207676_10770814 3300026095 Bacteria 937
152 Ga0207675_101948641 3300026118 Bacteria 606
153 Ga0207675_102035624 3300026118 Archaea 591
154 Ga0207428_10581152 3300027907 Bacteria 808
155 Ga0268266_10038783 3300028379 Bacteria 4055
156 Ga0268266_11181351 3300028379 Bacteria 740
157 Ga0268265_12159383 3300028380 Unclassified 564
158 Ga0307406_10046319 3300031901 Bacteria 2736
159 Ga0307406_11009573 3300031901 Bacteria 714
160 Ga0307416_100487447 3300032002 Bacteria 1294
161 Ga0307414_12017378 3300032004 Bacteria 539
162 Ga0307415_101331987 3300032126 Bacteria 681
163 Ga0373923_0133566 3300035111 Bacteria 1117
164 Ga0373936_0239861 3300035113 Bacteria 808
165 Ga0373953_0013688 3300035117 Bacteria 2902
166 Ga0373954_0296131 3300035118 Bacteria 798
167 Ga0373946_0176712 3300035171 Bacteria 1011
168 Ga0373935_0609701 3300035692 Unclassified 799
169 Ga0373933_0124609 3300035724 Bacteria 1616
170 Ga0373947_0007421 3300035725 Bacteria 6348
171 Ga0373937_0079128 3300036401 Bacteria 3038
172 Ga0395898_0269815 3300037466 Bacteria 1623
173 Ga0395898_1013970 3300037466 Bacteria 766
174 Ga0395905_1181168 3300037471 Bacteria 669
175 Ga0436364_0096043 3300037853 Bacteria 854
176 Ga0436364_0160681 3300037853 Unclassified 660
177 Ga0436364_0560823 3300037853 Unclassified 646
178 Ga0436364_0868721 3300037853 Bacteria 734
179 Ga0436364_0892303 3300037853 Bacteria 1890
180 Ga0436364_1004177 3300037853 Bacteria 817
181 Ga0395901_0879806 3300038443 Bacteria 879
182 Ga0395901_1840333 3300038443 Bacteria 554
183 Ga0436365_0077570 3300039437 Bacteria 623
184 Ga0436365_0284863 3300039437 Bacteria 2030
185 Ga0436365_0423871 3300039437 Bacteria 4767
186 Ga0436365_0552734 3300039437 Bacteria 2684
187 Ga0436365_1027168 3300039437 Unclassified 517
188 Ga0436365_1115198 3300039437 Bacteria 3390
189 Ga0436365_1313801 3300039437 Bacteria 9321
190 Ga0436365_1333281 3300039437 Unclassified 669
191 Ga0436365_1422700 3300039437 Bacteria 1514
192 Ga0436365_1431349 3300039437 Bacteria 856
193 Ga0436365_1565263 3300039437 Bacteria 1192
194 Ga0436365_1582589 3300039437 Unclassified 1081
195 Ga0436365_1632565 3300039437 Bacteria 1226
196 Ga0436360_0776301 3300039438 Bacteria 1445
197 Ga0436363_0579928 3300039450 Bacteria 988
198 Ga0436363_1030730 3300039450 Bacteria 580
199 Ga0436363_1612774 3300039450 Bacteria 12809
200 Ga0436363_1697176 3300039450 Bacteria 541
201 Ga0436362_0196591 3300039453 Bacteria 2622
202 Ga0436362_0566726 3300039453 Bacteria 1244
203 Ga0436362_0595590 3300039453 Bacteria 1974
204 Ga0436362_0596126 3300039453 Bacteria 614
205 Ga0436362_1136177 3300039453 Bacteria 501
206 Ga0451855_1815524 3300041511 Bacteria 740
207 Ga0451853_0887664 3300041512 Unclassified 1035
208 Ga0466969_0131701 3300044656 Bacteria 1159
209 Ga0466969_0466538 3300044656 Bacteria 575
210 Ga0466972_0153521 3300044658 Bacteria 1082
211 Ga0466972_0161411 3300044658 Bacteria 1053
212 Ga0466965_0147402 3300044683 Bacteria 1229
213 Ga0466965_0176469 3300044683 Unclassified 1126
214 Ga0466965_0241566 3300044683 Bacteria 967
215 Ga0466965_0666414 3300044683 Unclassified 595
216 Ga0466966_0017855 3300044684 Bacteria 4685
217 Ga0466966_0076354 3300044684 Bacteria 2092
218 Ga0466966_0087756 3300044684 Bacteria 1933
219 Ga0466966_0223539 3300044684 Bacteria 1136
220 Ga0466966_0496566 3300044684 Bacteria 734
221 Ga0466966_0578046 3300044684 Bacteria 676
222 Ga0466961_0013867 3300044693 Bacteria 5165
223 Ga0466961_0034131 3300044693 Bacteria 3267
224 Ga0466961_0094969 3300044693 Bacteria 1881
225 Ga0466961_0284943 3300044693 Unclassified 1011
226 Ga0466961_0712470 3300044693 Unclassified 601
227 Ga0466961_0729425 3300044693 Bacteria 593
228 Ga0466961_0987404 3300044693 Bacteria 500
229 Ga0466963_0009584 3300044694 Bacteria 5836
230 Ga0466963_0411105 3300044694 Bacteria 954
231 Ga0466963_0790274 3300044694 Bacteria 669
232 Ga0466963_1297397 3300044694 Unclassified 511
233 Ga0466971_0008705 3300044719 Bacteria 4428
234 Ga0466971_0010443 3300044719 Bacteria 4058
235 Ga0466971_0043779 3300044719 Bacteria 2011
236 Ga0466971_0063806 3300044719 Bacteria 1667
237 Ga0466971_0176254 3300044719 Bacteria 1004
238 Ga0466968_0097152 3300044735 Bacteria 1312
239 Ga0466968_0419355 3300044735 Bacteria 658
240 Ga0466968_0420610 3300044735 Bacteria 657
241 Ga0466968_0567117 3300044735 Unclassified 571
242 Ga0466968_0575812 3300044735 Bacteria 567
243 Ga0466970_0141134 3300044765 Bacteria 1327
244 Ga0466970_0227722 3300044765 Bacteria 1041
245 Ga0466970_0957862 3300044765 Bacteria 504
246 Ga0466957_0007343 3300044842 Bacteria 6229
247 Ga0466957_0019536 3300044842 Bacteria 3985
248 Ga0466957_0114425 3300044842 Bacteria 1714
249 Ga0466957_0463768 3300044842 Unclassified 874
250 Ga0466957_0905247 3300044842 Unclassified 631
251 Ga0466960_0000623 3300044901 Bacteria 12210
252 Ga0466960_0084905 3300044901 Bacteria 1603
253 Ga0466960_0111055 3300044901 Unclassified 1424
254 Ga0466960_0219535 3300044901 Bacteria 1046
255 Ga0466960_0306680 3300044901 Bacteria 896
256 Ga0466960_0557595 3300044901 Bacteria 676
257 Ga0466960_0689738 3300044901 Bacteria 612
258 Ga0466959_0021063 3300045049 Bacteria 4807
259 Ga0466959_0086329 3300045049 Bacteria 2258
260 Ga0466959_0136030 3300045049 Bacteria 1739
261 Ga0466959_0513753 3300045049 Bacteria 809
262 Ga0466959_0526303 3300045049 Bacteria 798
263 Ga0466959_0566764 3300045049 Bacteria 765
264 Ga0466959_1089777 3300045049 Bacteria 531
265 Ga0466958_0000299 3300045836 Bacteria 19393
266 Ga0466958_0001632 3300045836 Bacteria 10792
267 Ga0466958_0019372 3300045836 Bacteria 3961
268 Ga0466958_0114908 3300045836 Bacteria 1682
269 Ga0466958_0224078 3300045836 Bacteria 1200
270 Ga0466958_0689099 3300045836 Bacteria 665
271 Ga0466958_0726778 3300045836 Bacteria 647
272 Ga0466967_0053577 3300045976 Bacteria 3546
273 Ga0466967_0407982 3300045976 Bacteria 1323
274 Ga0466967_0484311 3300045976 Bacteria 1212
275 Ga0466967_1115704 3300045976 Unclassified 786
276 Ga0466967_1359923 3300045976 Bacteria 707
277 Ga0495592_0064956 3300046454 Bacteria 2673
278 Ga0495592_0755568 3300046454 Bacteria 581
279 Ga0495603_0178005 3300046455 Bacteria 1231
280 Ga0495629_0485677 3300046459 Bacteria 834
281 Ga0495641_0198705 3300046461 Bacteria 899
282 Ga0495651_0111928 3300046462 Bacteria 2017
283 Ga0495653_0023997 3300046463 Bacteria 4920
284 Ga0495605_0081602 3300046474 Bacteria 1512
285 Ga0495662_0475545 3300046476 Bacteria 613
286 Ga0495664_0127517 3300046477 Bacteria 1540
287 Ga0495664_0324870 3300046477 Bacteria 928
288 Ga0495596_0084241 3300046500 Bacteria 1234
289 Ga0495596_0110659 3300046500 Bacteria 1067
290 Ga0495596_0310864 3300046500 Bacteria 613
291 Ga0495608_0028758 3300046511 Bacteria 3777
292 Ga0495608_0642024 3300046511 Bacteria 635
293 Ga0495618_0215885 3300046514 Bacteria 1211
294 Ga0495620_0029232 3300046515 Bacteria 2554
295 Ga0495628_0090479 3300046516 Bacteria 2369
296 Ga0495628_0928697 3300046516 Bacteria 602
297 Ga0495630_0100968 3300046517 Bacteria 2183
298 Ga0495652_0076014 3300046529 Bacteria 2787
299 Ga0495652_0161954 3300046529 Bacteria 1736
300 Ga0495652_0481526 3300046529 Unclassified 864
301 Ga0495654_0249549 3300046530 Bacteria 740
302 Ga0495640_0026260 3300046533 Bacteria 4211
303 Ga0495640_0803907 3300046533 Bacteria 560
304 Ga0495587_0044896 3300046536 Bacteria 2628
305 Ga0495587_0683918 3300046536 Bacteria 563
306 Ga0495667_0034239 3300046559 Bacteria 3396
307 Ga0495667_0415469 3300046559 Bacteria 847
308 Ga0495634_0674559 3300046642 Bacteria 596
309 Ga0495635_0003233 3300046663 Bacteria 11232
310 Ga0495635_0429321 3300046663 Unclassified 875
311 Ga0495635_0451971 3300046663 Bacteria 849
312 Ga0495657_0011672 3300046675 Bacteria 6556
313 Ga0495623_0145788 3300046679 Bacteria 1404
314 Ga0495646_0028704 3300046680 Bacteria 3482
315 Ga0495646_0540962 3300046680 Bacteria 595
316 Ga0495647_0024877 3300046681 Bacteria 2183
317 Ga0495658_0247387 3300046683 Bacteria 1121
318 Ga0495613_0585162 3300046689 Bacteria 744
319 Ga0495600_0050822 3300046809 Bacteria 2705
320 Ga0495581_0237456 3300047315 Bacteria 1066
321 Ga0495604_0015298 3300047317 Bacteria 6124
322 Ga0495604_0015786 3300047317 Bacteria 6027
323 Ga0495604_0169382 3300047317 Bacteria 1537
324 Ga0495674_0356065 3300047319 Bacteria 1187
325 Ga0495680_0007550 3300047322 Bacteria 9943
326 Ga0495680_0953443 3300047322 Bacteria 551
327 Ga0495680_1070009 3300047322 Bacteria 511
328 Ga0495675_0025480 3300047444 Bacteria 3771
329 Ga0495684_0069133 3300047471 Unclassified 2685
330 Ga0495593_0111730 3300047673 Bacteria 1395
331 Ga0495593_0200515 3300047673 Unclassified 1003
332 Ga0495602_0036459 3300048088 Bacteria 4577
333 Ga0495602_0308295 3300048088 Bacteria 1156
334 Ga0495602_1115298 3300048088 Unclassified 517
335 Ga0495614_0043711 3300048089 Bacteria 1922
336 Ga0496100_0000211 3300048903 Bacteria 32290
337 Ga0496101_0049562 3300048904 Bacteria 3021
338 Ga0496102_0547744 3300048905 Bacteria 1080
339 Ga0496104_0049578 3300048907 Bacteria 3959
340 Ga0496104_0103818 3300048907 Bacteria 2723
341 Ga0496104_0454802 3300048907 Bacteria 1192
342 Ga0496105_0083383 3300048908 Bacteria 2640
343 Ga0496105_0373963 3300048908 Bacteria 1135
344 Ga0496105_0434398 3300048908 Bacteria 1038
345 Ga0496105_0465834 3300048908 Bacteria 996
346 Ga0496108_0182870 3300048911 Bacteria 1816
347 Ga0496108_0934971 3300048911 Bacteria 743
348 Ga0496109_0246857 3300048912 Bacteria 1681
349 Ga0496109_0388639 3300048912 Bacteria 1318
350 Ga0496109_0425061 3300048912 Bacteria 1255
351 Ga0496109_1169100 3300048912 Bacteria 706
352 Ga0496109_1888970 3300048912 Bacteria 530
353 Ga0496110_0057983 3300048913 Bacteria 3410
354 Ga0496110_0156456 3300048913 Bacteria 2065
355 Ga0496110_0171230 3300048913 Bacteria 1970
356 Ga0496111_0080147 3300048914 Bacteria 2382
357 Ga0496111_0336685 3300048914 Bacteria 1117
358 Ga0496112_0031138 3300048915 Bacteria 5170
359 Ga0496112_0101936 3300048915 Bacteria 2840
360 Ga0496112_1255044 3300048915 Bacteria 657
361 Ga0496113_0083077 3300048916 Bacteria 2457
362 Ga0496113_0877152 3300048916 Archaea 710
363 Ga0496113_1049871 3300048916 Bacteria 640
364 Ga0496114_0147971 3300048917 Bacteria 2037
365 Ga0496114_1294483 3300048917 Bacteria 616
366 Ga0496115_0071724 3300048918 Bacteria 2809
367 Ga0496115_0532009 3300048918 Bacteria 941
368 Ga0501067_0186231 3300049583 Bacteria 1156
369 Ga0501070_0397688 3300049586 Bacteria 1115
370 nmdc:mga0yw44_603729_c1 3300050492 Bacteria 745
371 nmdc:mga0yw44_709363_c1 3300050492 Bacteria 683
372 nmdc:mga09592_4563_c1 3300050508 Bacteria 11207
373 nmdc:mga08y16_435135_c1 3300050511 Bacteria 1339
374 nmdc:mga0rr50_118052_c1 3300050513 Bacteria 2107
375 Ga0495601_0186830 3300053077 Bacteria 1355
376 Ga0495601_0690680 3300053077 Bacteria 651
377 Ga0495612_0325572 3300053078 Bacteria 692
378 Ga0495619_0073030 3300053085 Bacteria 2298
379 Ga0501082_1310614 3300060353 Unclassified 633
380 Ga0466962_0000147 3300061719 Bacteria 29152
381 Ga0466962_0010828 3300061719 Bacteria 4384
382 Ga0466962_0169321 3300061719 Bacteria 1063
383 Ga0466962_0227500 3300061719 Unclassified 914
384 Ga0466962_0334008 3300061719 Unclassified 753
385 Ga0466962_0407848 3300061719 Bacteria 681
386 Ga0070691_10901119
387 JGI25406J46586_10017542
388 Ga0070680_100574351
389 Ga0070682_100577152
390 Ga0070661_100503426
391 Ga0070692_10083969
392 Ga0070692_10426731
393 Ga0070674_102004026
394 Ga0070659_100000163
395 Ga0070659_100405980
396 Ga0070709_10443927
397 Ga0070714_100016724
398 Ga0070714_100040292
399 Ga0070714_100043325
400 Ga0070714_100052740
401 Ga0070714_100172478
402 Ga0070714_100540453
403 Ga0070714_100809099
404 Ga0070714_101609140
405 Ga0070714_102042098
406 Ga0070713_100117274
407 Ga0070713_100472894
408 Ga0070713_101204815
409 Ga0070713_102208793
410 Ga0070710_10000001
411 Ga0070710_10208524
412 Ga0070710_10770378
413 Ga0070710_11039914
414 Ga0070711_100102257
415 Ga0070711_100659509
416 Ga0070700_101099603
417 Ga0070700_101292405
418 Ga0070663_100164605
419 Ga0070662_100374373
420 Ga0070681_10187286
421 Ga0070681_10273251
422 Ga0070684_100835081
423 Ga0068853_102250114
424 Ga0070696_100576928
425 Ga0070696_101802938
426 Ga0070665_100003731
427 Ga0070704_100262503
428 Ga0070664_100274577
429 Ga0068856_100615599
430 Ga0068856_102242585
431 Ga0070702_100653313
432 Ga0068859_101888709
433 Ga0068859_102712094
434 Ga0068866_11230763
435 Ga0068861_100702281
436 Ga0068862_101622482
437 Ga0068862_101673363
438 Ga0081455_10066658
439 Ga0081455_10474704
440 Ga0081540_1005116
441 Ga0081539_10003175
442 Ga0081539_10009885
443 Ga0081539_10162821
444 Ga0070717_10026913
445 Ga0070717_10028957
446 Ga0070717_10034640
447 Ga0070717_10077204
448 Ga0070717_10080932
449 Ga0075365_10179668
450 Ga0070712_100000009
451 Ga0070712_100018866
452 Ga0075428_101172518
453 Ga0075431_100364550
454 Ga0075434_101797480
455 Ga0075429_100009743
456 Ga0068865_101613749
457 Ga0097620_101889379
458 Ga0097620_102713565
459 Ga0105240_10107225
460 Ga0111539_11579568
461 Ga0105245_10283784
462 Ga0105245_11547802
463 Ga0114129_11066794
464 Ga0114129_12916645
465 Ga0105243_11397622
466 Ga0105243_11460444
467 Ga0105242_10062382
468 Ga0105248_12270796
469 Ga0105238_12980747
470 Ga0105249_11726176
471 Ga0105239_10066612
472 Ga0105239_10931901
473 Ga0105246_10006461
474 Ga0157369_11636358
475 Ga0157372_10970293
476 Ga0157372_11480284
477 Ga0157372_12208025
478 Ga0157375_12499560
479 Ga0157380_11542875
480 Ga0157377_11053789
481 Ga0157379_11767094
482 Ga0157376_10067872
483 Ga0206354_10810603
484 Ga0206353_11630166
485 Ga0213873_10106699
486 Ga0213873_10183376
487 Ga0213874_10000318
488 Ga0213876_10001692
489 Ga0213876_10014290
490 Ga0213876_10047705
491 Ga0213876_10059446
492 Ga0213876_10215906
493 Ga0213875_10178728
494 Ga0207692_10307607
495 Ga0207692_10322209
496 Ga0207699_10420329
497 Ga0207705_10451507
498 Ga0207695_11337660
499 Ga0207693_10000101
500 Ga0207693_10019479
501 Ga0207663_10496836
502 Ga0207663_11404331
503 Ga0207657_10126748
504 Ga0207652_10439884
505 Ga0207681_10001085
506 Ga0207700_10070765
507 Ga0207700_10114299
508 Ga0207700_10802497
509 Ga0207700_11514290
510 Ga0207700_11767629
511 Ga0207664_10000040
512 Ga0207664_10010865
513 Ga0207664_10127054
514 Ga0207664_10174651
515 Ga0207664_10396071
516 Ga0207664_10519980
517 Ga0207664_10546724
518 Ga0207664_10642889
519 Ga0207664_10919440
520 Ga0207690_10000166
521 Ga0207690_10604880
522 Ga0207706_11229478
523 Ga0207704_10191865
524 Ga0207665_11036050
525 Ga0207661_10045715
526 Ga0207661_10185219
527 Ga0207661_10326364
528 Ga0207661_11900629
529 Ga0207679_10612047
530 Ga0207677_10746628
531 Ga0207678_10063410
532 Ga0207678_10813349
533 Ga0207708_10631797
534 Ga0207702_11044763
535 Ga0207702_11886705
536 Ga0207676_10770814
537 Ga0207675_101948641
538 Ga0207675_102035624
539 Ga0207428_10581152
540 Ga0268266_10038783
541 Ga0268266_11181351
542 Ga0268265_12159383
543 Ga0307406_10046319
544 Ga0307406_11009573
545 Ga0307416_100487447
546 Ga0307414_12017378
547 Ga0307415_101331987
548 Ga0373923_0133566
549 Ga0373936_0239861
550 Ga0373953_0013688
551 Ga0373954_0296131
552 Ga0373946_0176712
553 Ga0373935_0609701
554 Ga0373933_0124609
555 Ga0373947_0007421
556 Ga0373937_0079128
557 Ga0395898_0269815
558 Ga0395898_1013970
559 Ga0395905_1181168
560 Ga0436364_0096043
561 Ga0436364_0160681
562 Ga0436364_0560823
563 Ga0436364_0868721
564 Ga0436364_0892303
565 Ga0436364_1004177
566 Ga0395901_0879806
567 Ga0395901_1840333
568 Ga0436365_0077570
569 Ga0436365_0284863
570 Ga0436365_0423871
571 Ga0436365_0552734
572 Ga0436365_1027168
573 Ga0436365_1115198
574 Ga0436365_1313801
575 Ga0436365_1333281
576 Ga0436365_1422700
577 Ga0436365_1431349
578 Ga0436365_1565263
579 Ga0436365_1582589
580 Ga0436365_1632565
581 Ga0436360_0776301
582 Ga0436363_0579928
583 Ga0436363_1030730
584 Ga0436363_1612774
585 Ga0436363_1697176
586 Ga0436362_0196591
587 Ga0436362_0566726
588 Ga0436362_0595590
589 Ga0436362_0596126
590 Ga0436362_1136177
591 Ga0451855_1815524
592 Ga0451853_0887664
593 Ga0466969_0131701
594 Ga0466969_0466538
595 Ga0466972_0153521
596 Ga0466972_0161411
597 Ga0466965_0147402
598 Ga0466965_0176469
599 Ga0466965_0241566
600 Ga0466965_0666414
601 Ga0466966_0017855
602 Ga0466966_0076354
603 Ga0466966_0087756
604 Ga0466966_0223539
605 Ga0466966_0496566
606 Ga0466966_0578046
607 Ga0466961_0013867
608 Ga0466961_0034131
609 Ga0466961_0094969
610 Ga0466961_0284943
611 Ga0466961_0712470
612 Ga0466961_0729425
613 Ga0466961_0987404
614 Ga0466963_0009584
615 Ga0466963_0411105
616 Ga0466963_0790274
617 Ga0466963_1297397
618 Ga0466971_0008705
619 Ga0466971_0010443
620 Ga0466971_0043779
621 Ga0466971_0063806
622 Ga0466971_0176254
623 Ga0466968_0097152
624 Ga0466968_0419355
625 Ga0466968_0420610
626 Ga0466968_0567117
627 Ga0466968_0575812
628 Ga0466970_0141134
629 Ga0466970_0227722
630 Ga0466970_0957862
631 Ga0466957_0007343
632 Ga0466957_0019536
633 Ga0466957_0114425
634 Ga0466957_0463768
635 Ga0466957_0905247
636 Ga0466960_0000623
637 Ga0466960_0084905
638 Ga0466960_0111055
639 Ga0466960_0219535
640 Ga0466960_0306680
641 Ga0466960_0557595
642 Ga0466960_0689738
643 Ga0466959_0021063
644 Ga0466959_0086329
645 Ga0466959_0136030
646 Ga0466959_0513753
647 Ga0466959_0526303
648 Ga0466959_0566764
649 Ga0466959_1089777
650 Ga0466958_0000299
651 Ga0466958_0001632
652 Ga0466958_0019372
653 Ga0466958_0114908
654 Ga0466958_0224078
655 Ga0466958_0689099
656 Ga0466958_0726778
657 Ga0466967_0053577
658 Ga0466967_0407982
659 Ga0466967_0484311
660 Ga0466967_1115704
661 Ga0466967_1359923
662 Ga0495592_0064956
663 Ga0495592_0755568
664 Ga0495603_0178005
665 Ga0495629_0485677
666 Ga0495641_0198705
667 Ga0495651_0111928
668 Ga0495653_0023997
669 Ga0495605_0081602
670 Ga0495662_0475545
671 Ga0495664_0127517
672 Ga0495664_0324870
673 Ga0495596_0084241
674 Ga0495596_0110659
675 Ga0495596_0310864
676 Ga0495608_0028758
677 Ga0495608_0642024
678 Ga0495618_0215885
679 Ga0495620_0029232
680 Ga0495628_0090479
681 Ga0495628_0928697
682 Ga0495630_0100968
683 Ga0495652_0076014
684 Ga0495652_0161954
685 Ga0495652_0481526
686 Ga0495654_0249549
687 Ga0495640_0026260
688 Ga0495640_0803907
689 Ga0495587_0044896
690 Ga0495587_0683918
691 Ga0495667_0034239
692 Ga0495667_0415469
693 Ga0495634_0674559
694 Ga0495635_0003233
695 Ga0495635_0429321
696 Ga0495635_0451971
697 Ga0495657_0011672
698 Ga0495623_0145788
699 Ga0495646_0028704
700 Ga0495646_0540962
701 Ga0495647_0024877
702 Ga0495658_0247387
703 Ga0495613_0585162
704 Ga0495600_0050822
705 Ga0495581_0237456
706 Ga0495604_0015298
707 Ga0495604_0015786
708 Ga0495604_0169382
709 Ga0495674_0356065
710 Ga0495680_0007550
711 Ga0495680_0953443
712 Ga0495680_1070009
713 Ga0495675_0025480
714 Ga0495684_0069133
715 Ga0495593_0111730
716 Ga0495593_0200515
717 Ga0495602_0036459
718 Ga0495602_0308295
719 Ga0495602_1115298
720 Ga0495614_0043711
721 Ga0496100_0000211
722 Ga0496101_0049562
723 Ga0496102_0547744
724 Ga0496104_0049578
725 Ga0496104_0103818
726 Ga0496104_0454802
727 Ga0496105_0083383
728 Ga0496105_0373963
729 Ga0496105_0434398
730 Ga0496105_0465834
731 Ga0496108_0182870
732 Ga0496108_0934971
733 Ga0496109_0246857
734 Ga0496109_0388639
735 Ga0496109_0425061
736 Ga0496109_1169100
737 Ga0496109_1888970
738 Ga0496110_0057983
739 Ga0496110_0156456
740 Ga0496110_0171230
741 Ga0496111_0080147
742 Ga0496111_0336685
743 Ga0496112_0031138
744 Ga0496112_0101936
745 Ga0496112_1255044
746 Ga0496113_0083077
747 Ga0496113_0877152
748 Ga0496113_1049871
749 Ga0496114_0147971
750 Ga0496114_1294483
751 Ga0496115_0071724
752 Ga0496115_0532009
753 Ga0501067_0186231
754 Ga0501070_0397688
755 nmdc:mga0yw44_603729_c1
756 nmdc:mga0yw44_709363_c1
757 nmdc:mga09592_4563_c1
758 nmdc:mga08y16_435135_c1
759 nmdc:mga0rr50_118052_c1
760 Ga0495601_0186830
761 Ga0495601_0690680
762 Ga0495612_0325572
763 Ga0495619_0073030
764 Ga0501082_1310614
765 Ga0466962_0000147
766 Ga0466962_0010828
767 Ga0466962_0169321
768 Ga0466962_0227500
769 Ga0466962_0334008
770 Ga0466962_0407848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bqn-assembly1.cif.gz_A solution nmr structure of fold-c rei; de novo designed protein with an asymmetric all-alpha topology 0.3458 5 100
6mf9-assembly1.cif.gz_A crystal structure of cgd4-650 with compound bi2536 0.3189 1 93
7bqn-assembly1.cif.gz_A solution nmr structure of fold-c rei; de novo designed protein with an asymmetric all-alpha topology 0.3179 5 100
8a5s-assembly1.cif.gz_AAA crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. 0.3162 5 97
3kav-assembly1.cif.gz_A crystal structure of the mutant (l80m) pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 0.3092 2 97
ID Description Score Start End Superfamily
af_O35166_1_120_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3957 4 92 1.20.58.90
af_O14653_1_120_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3957 4 92 1.20.1270.60
af_O35165_2_96_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.3948 4 92 1.20.58.400
af_A0A1D6MVU9_32_187_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.374 4 93 1.20.140.40
af_O35165_2_96_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.3349 4 92 1.20.58.400
ID Description Score Start End GO Terms
AF-A0A6J4RKF7-F1-model_v4 TipAS antibiotic-recognition domain-containing protein 0.997 2 98
AF-A0A7V9TBK1-F1-model_v4 TipAS antibiotic-recognition domain-containing protein 0.9923 2 107
AF-A0A840IA10-F1-model_v4 Uncharacterized protein 0.9857 2 104
AF-H0EAP9-F1-model_v4 Uncharacterized protein 0.9848 2 106
AF-A0A7V9TBK1-F1-model_v4 TipAS antibiotic-recognition domain-containing protein 0.983 2 107

Map