F430111

General Info

Members Datasets Scaffolds Average Seq Length
385 215 770 423

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10043853|Ga0070666_100438532
Length 433
Sequence MLFGAEKTKENIVVRGARVLDPVAGIDALLDVRVDDGAIAALGTELDTNSHRVIEGEGLLLAPAFVDPHVHLRTPGREDEENIASGTAAXXXGGYCAILAMPNTDPVVDSAATLGSLIEAAHAEAEIPVGFLAAITKGQSGAELTEMGGLAAAGAAGFTDDGMPVAAPGLMRRALQYGSVTGRRIALHCEETTLSRDGQMHEGAVSAELGFTGYPSVAESLMVERDLALAAYERQPLHLLHLSAWESVQALRRARAEGVEATGEVTPHHLCLTDEAIRSLDPNLKMNPPLRSGSDRTALIEGLKDGTITVIGTDHAPHARHEKDVPFEAAPFGVTGLETAFASLYTHLVDPGIIVLETLLERMSTGPARAYGLPEPRIAVGAQANLVLLDLNASYRITEETFRSRSVNSWLLGETVKGKVRATIAAGRLAFSA

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 15.84
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10043853 3300005335 Bacteria 2995
2 JGI25407J50210_10001292 3300003373 Bacteria 5619
3 Ga0070658_10092740 3300005327 Bacteria 2490
4 Ga0070690_100015570 3300005330 Bacteria 4541
5 Ga0070682_100036903 3300005337 Bacteria 2989
6 Ga0068868_100019154 3300005338 Bacteria 5127
7 Ga0068868_100139630 3300005338 Bacteria 1988
8 Ga0070660_100055957 3300005339 Bacteria 3051
9 Ga0070689_100030414 3300005340 Bacteria 4099
10 Ga0070692_10016269 3300005345 Bacteria 3536
11 Ga0070688_100006579 3300005365 Bacteria 6218
12 Ga0070703_10007572 3300005406 Bacteria 3051
13 Ga0070714_100053001 3300005435 Bacteria 3461
14 Ga0070714_100056645 3300005435 Bacteria 3353
15 Ga0070713_100205116 3300005436 Bacteria 1782
16 Ga0070713_100229655 3300005436 Bacteria 1686
17 Ga0070710_10037919 3300005437 Bacteria 2645
18 Ga0070711_100078371 3300005439 Bacteria 2347
19 Ga0070705_100024034 3300005440 Bacteria 3282
20 Ga0070705_100031369 3300005440 Bacteria 2943
21 Ga0070694_100008951 3300005444 Bacteria 6133
22 Ga0070694_100010701 3300005444 Bacteria 5670
23 Ga0070708_100135755 3300005445 Bacteria 2279
24 Ga0070678_100001665 3300005456 Bacteria 11902
25 Ga0070662_100088325 3300005457 Bacteria 2323
26 Ga0068867_100000419 3300005459 Bacteria 28327
27 Ga0070685_10045915 3300005466 Bacteria 2507
28 Ga0070706_100055179 3300005467 Bacteria 3667
29 Ga0070706_100074139 3300005467 Bacteria 3151
30 Ga0070706_100074315 3300005467 Bacteria 3146
31 Ga0070707_100000635 3300005468 Bacteria 35108
32 Ga0070698_100009438 3300005471 Bacteria 10451
33 Ga0070698_100021659 3300005471 Bacteria 6729
34 Ga0070698_100052562 3300005471 Bacteria 4144
35 Ga0070698_100362849 3300005471 Bacteria 1381
36 Ga0070699_100030457 3300005518 Bacteria 4658
37 Ga0068853_100027575 3300005539 Bacteria 4771
38 Ga0070672_100168992 3300005543 Bacteria 1818
39 Ga0070695_100024382 3300005545 Bacteria 3725
40 Ga0070696_100019944 3300005546 Bacteria 4544
41 Ga0070696_100028888 3300005546 Bacteria 3785
42 Ga0070704_100044593 3300005549 Bacteria 3082
43 Ga0070704_100064547 3300005549 Bacteria 2632
44 Ga0070704_100201811 3300005549 Bacteria 1605
45 Ga0070704_100246592 3300005549 Bacteria 1465
46 Ga0068855_100131533 3300005563 Bacteria 2857
47 Ga0068855_100272086 3300005563 Bacteria 1883
48 Ga0068856_100014290 3300005614 Bacteria 7678
49 Ga0068856_100048516 3300005614 Bacteria 4185
50 Ga0070702_100023151 3300005615 Bacteria 3296
51 Ga0068859_100178049 3300005617 Bacteria 2209
52 Ga0068866_10001873 3300005718 Bacteria 8809
53 Ga0068858_100085960 3300005842 Bacteria 2926
54 Ga0068860_100212551 3300005843 Bacteria 1876
55 Ga0081455_10003352 3300005937 Bacteria 18467
56 Ga0081455_10005873 3300005937 Bacteria 13339
57 Ga0081455_10013085 3300005937 Bacteria 8225
58 Ga0081455_10067928 3300005937 Bacteria 2969
59 Ga0081538_10000057 3300005981 Bacteria 102521
60 Ga0081538_10001522 3300005981 Bacteria 23789
61 Ga0081540_1011247 3300005983 Bacteria 5996
62 Ga0081539_10020179 3300005985 Bacteria 4520
63 Ga0070717_10096034 3300006028 Bacteria 2510
64 Ga0070717_10153149 3300006028 Bacteria 1996
65 Ga0075365_10003877 3300006038 Bacteria 7821
66 Ga0075365_10031252 3300006038 Bacteria 3415
67 Ga0075365_10045715 3300006038 Bacteria 2873
68 Ga0075364_10004159 3300006051 Bacteria 8297
69 Ga0070715_10014809 3300006163 Bacteria 2896
70 Ga0070712_100005380 3300006175 Bacteria 7924
71 Ga0097621_100044100 3300006237 Bacteria 3597
72 Ga0075428_100170380 3300006844 Bacteria 2360
73 Ga0075431_100097375 3300006847 Bacteria 3038
74 Ga0075433_10007091 3300006852 Bacteria 8874
75 Ga0068865_100000269 3300006881 Bacteria 28461
76 Ga0075436_100013282 3300006914 Bacteria 5642
77 Ga0097620_100178063 3300006931 Bacteria 2209
78 Ga0075435_100002731 3300007076 Bacteria 11784
79 Ga0105240_10113226 3300009093 Bacteria 3278
80 Ga0111539_10017183 3300009094 Bacteria 8955
81 Ga0111539_10128974 3300009094 Bacteria 2962
82 Ga0111539_10210205 3300009094 Bacteria 2267
83 Ga0111539_10703762 3300009094 Bacteria 1176
84 Ga0105245_10058936 3300009098 Bacteria 3456
85 Ga0105245_10100983 3300009098 Bacteria 2669
86 Ga0105247_10023901 3300009101 Bacteria 3682
87 Ga0114129_10001278 3300009147 Bacteria 33592
88 Ga0114129_10032291 3300009147 Bacteria 7399
89 Ga0114129_10066968 3300009147 Bacteria 5008
90 Ga0114129_10067590 3300009147 Bacteria 4984
91 Ga0114129_10217119 3300009147 Bacteria 2582
92 Ga0105243_10020985 3300009148 Bacteria 4956
93 Ga0105243_10035161 3300009148 Bacteria 3883
94 Ga0105243_10112468 3300009148 Bacteria 2281
95 Ga0105243_10222527 3300009148 Unclassified 1669
96 Ga0105242_10019337 3300009176 Bacteria 5336
97 Ga0105242_10250448 3300009176 Bacteria 1596
98 Ga0105248_10012557 3300009177 Bacteria 9343
99 Ga0105238_10090226 3300009551 Bacteria 3052
100 Ga0105249_10003662 3300009553 Bacteria 13260
101 Ga0105249_10140142 3300009553 Bacteria 2318
102 Ga0105239_10118159 3300010375 Bacteria 2943
103 Ga0157374_10005704 3300013296 Bacteria 10502
104 Ga0157378_10037801 3300013297 Bacteria 4277
105 Ga0163162_10061494 3300013306 Bacteria 3793
106 Ga0157372_10141896 3300013307 Bacteria 2768
107 Ga0157375_10041480 3300013308 Bacteria 4444
108 Ga0157380_10029026 3300014326 Bacteria 4225
109 Ga0157376_10156675 3300014969 Bacteria 2060
110 Ga0163161_10009018 3300017792 Bacteria 6898
111 Ga0207653_10002300 3300025885 Bacteria 6100
112 Ga0207692_10005123 3300025898 Bacteria 5230
113 Ga0207692_10059176 3300025898 Bacteria 1977
114 Ga0207688_10130644 3300025901 Bacteria 1472
115 Ga0207680_10087678 3300025903 Bacteria 1971
116 Ga0207685_10028435 3300025905 Bacteria 1969
117 Ga0207699_10020484 3300025906 Bacteria 3546
118 Ga0207705_10083146 3300025909 Bacteria 2335
119 Ga0207684_10003747 3300025910 Bacteria 14694
120 Ga0207684_10118595 3300025910 Bacteria 2267
121 Ga0207654_10144752 3300025911 Bacteria 1520
122 Ga0207707_10111534 3300025912 Bacteria 2391
123 Ga0207695_10259217 3300025913 Bacteria 1637
124 Ga0207693_10000422 3300025915 Bacteria 38519
125 Ga0207693_10001049 3300025915 Bacteria 24711
126 Ga0207693_10012668 3300025915 Bacteria 6810
127 Ga0207693_10053845 3300025915 Bacteria 3157
128 Ga0207693_10055588 3300025915 Bacteria 3105
129 Ga0207693_10068653 3300025915 Bacteria 2774
130 Ga0207693_10112260 3300025915 Bacteria 2138
131 Ga0207663_10039269 3300025916 Bacteria 2867
132 Ga0207663_10065657 3300025916 Bacteria 2320
133 Ga0207660_10091452 3300025917 Bacteria 2257
134 Ga0207660_10092364 3300025917 Bacteria 2246
135 Ga0207657_10033976 3300025919 Bacteria 4592
136 Ga0207646_10006745 3300025922 Bacteria 11819
137 Ga0207687_10057116 3300025927 Bacteria 2740
138 Ga0207700_10000006 3300025928 Bacteria 348187
139 Ga0207700_10045483 3300025928 Bacteria 3240
140 Ga0207700_10244324 3300025928 Bacteria 1531
141 Ga0207664_10000789 3300025929 Bacteria 21390
142 Ga0207706_10011413 3300025933 Bacteria 8093
143 Ga0207706_10148491 3300025933 Bacteria 2062
144 Ga0207686_10059428 3300025934 Bacteria 2415
145 Ga0207669_10024606 3300025937 Bacteria 3239
146 Ga0207704_10139993 3300025938 Bacteria 1691
147 Ga0207665_10007191 3300025939 Bacteria 7365
148 Ga0207665_10062229 3300025939 Bacteria 2532
149 Ga0207691_10067713 3300025940 Bacteria 3228
150 Ga0207711_10022407 3300025941 Bacteria 5281
151 Ga0207689_10189457 3300025942 Bacteria 1697
152 Ga0207712_10100799 3300025961 Bacteria 2147
153 Ga0207677_10125007 3300026023 Bacteria 1942
154 Ga0207677_10168089 3300026023 Bacteria 1711
155 Ga0207708_10001945 3300026075 Bacteria 15228
156 Ga0207708_10043075 3300026075 Bacteria 3440
157 Ga0207702_10010568 3300026078 Bacteria 7714
158 Ga0207648_10000729 3300026089 Bacteria 36820
159 Ga0207648_10062689 3300026089 Bacteria 3241
160 Ga0207675_100004302 3300026118 Bacteria 13757
161 Ga0207675_100021274 3300026118 Bacteria 6041
162 Ga0207675_100109174 3300026118 Bacteria 2610
163 Ga0207683_10000371 3300026121 Bacteria 41225
164 Ga0207683_10018001 3300026121 Bacteria 6025
165 Ga0207428_10014471 3300027907 Bacteria 6853
166 Ga0207428_10083291 3300027907 Bacteria 2495
167 Ga0207428_10115713 3300027907 Bacteria 2060
168 Ga0265336_10021987 3300028666 Bacteria 2033
169 Ga0265338_10010331 3300028800 Bacteria 10962
170 Ga0265338_10023746 3300028800 Bacteria 6289
171 Ga0265330_10001408 3300031235 Bacteria 14070
172 Ga0265329_10007129 3300031242 Bacteria 4351
173 Ga0265340_10019739 3300031247 Bacteria 3468
174 Ga0265339_10024994 3300031249 Bacteria 3435
175 Ga0265327_10009207 3300031251 Bacteria 7163
176 Ga0265316_10016967 3300031344 Bacteria 6304
177 Ga0265314_10092952 3300031711 Bacteria 1959
178 Ga0265342_10058525 3300031712 Bacteria 2277
179 Ga0307405_10018083 3300031731 Bacteria 3882
180 Ga0307409_100124757 3300031995 Bacteria 2188
181 Ga0307416_100013250 3300032002 Bacteria 5597
182 Ga0307415_100022160 3300032126 Bacteria 3917
183 Ga0373928_0018165 3300035084 Unclassified 1454
184 Ga0373956_0054821 3300035119 Bacteria 1797
185 Ga0373943_0025765 3300035170 Bacteria 2750
186 Ga0373955_0035705 3300035172 Bacteria 2634
187 Ga0373961_0007767 3300035241 Bacteria 2600
188 Ga0373961_0010567 3300035241 Bacteria 2277
189 Ga0373962_0007075 3300035242 Bacteria 2741
190 Ga0373931_0002319 3300035691 Bacteria 8411
191 Ga0373947_0097284 3300035725 Bacteria 1844
192 Ga0373937_0086646 3300036401 Bacteria 2898
193 Ga0373925_0024608 3300037068 Bacteria 4397
194 Ga0395899_0012464 3300037312 Bacteria 6513
195 Ga0395899_0029028 3300037312 Bacteria 4161
196 Ga0395899_0075400 3300037312 Bacteria 2463
197 Ga0395899_0102388 3300037312 Bacteria 2066
198 Ga0395899_0143092 3300037312 Bacteria 1700
199 Ga0395900_0000988 3300037418 Bacteria 36988
200 Ga0395900_0002063 3300037418 Bacteria 22548
201 Ga0395900_0010486 3300037418 Bacteria 9478
202 Ga0395900_0017046 3300037418 Bacteria 7416
203 Ga0395900_0045007 3300037418 Bacteria 4545
204 Ga0395900_0047191 3300037418 Bacteria 4435
205 Ga0395900_0068997 3300037418 Bacteria 3633
206 Ga0395900_0090795 3300037418 Bacteria 3139
207 Ga0395900_0095742 3300037418 Bacteria 3050
208 Ga0395900_0099029 3300037418 Bacteria 2995
209 Ga0395898_0001851 3300037466 Bacteria 27144
210 Ga0395898_0006147 3300037466 Bacteria 12862
211 Ga0395898_0010358 3300037466 Bacteria 9751
212 Ga0395898_0011733 3300037466 Bacteria 9084
213 Ga0395898_0016182 3300037466 Bacteria 7639
214 Ga0395898_0023048 3300037466 Bacteria 6295
215 Ga0395898_0057793 3300037466 Bacteria 3778
216 Ga0395898_0060014 3300037466 Bacteria 3698
217 Ga0395898_0069703 3300037466 Bacteria 3401
218 Ga0395898_0185459 3300037466 Bacteria 1988
219 Ga0395898_0282447 3300037466 Bacteria 1583
220 Ga0395905_0002715 3300037471 Bacteria 19391
221 Ga0395905_0003035 3300037471 Bacteria 18184
222 Ga0395905_0007145 3300037471 Bacteria 11164
223 Ga0395905_0007299 3300037471 Bacteria 11015
224 Ga0395905_0008476 3300037471 Bacteria 10138
225 Ga0395905_0010493 3300037471 Bacteria 9010
226 Ga0395905_0042313 3300037471 Bacteria 4274
227 Ga0395905_0045421 3300037471 Bacteria 4119
228 Ga0395905_0045461 3300037471 Bacteria 4118
229 Ga0395905_0117533 3300037471 Bacteria 2499
230 Ga0395905_0187424 3300037471 Bacteria 1941
231 Ga0395905_0285415 3300037471 Bacteria 1537
232 Ga0395901_0001046 3300038443 Bacteria 29844
233 Ga0395901_0001425 3300038443 Bacteria 24931
234 Ga0395901_0001699 3300038443 Bacteria 22721
235 Ga0395901_0007379 3300038443 Bacteria 11093
236 Ga0395901_0008797 3300038443 Bacteria 10217
237 Ga0395901_0012514 3300038443 Bacteria 8608
238 Ga0395901_0017391 3300038443 Bacteria 7340
239 Ga0395901_0020914 3300038443 Bacteria 6703
240 Ga0395901_0026052 3300038443 Bacteria 6004
241 Ga0395901_0039672 3300038443 Bacteria 4874
242 Ga0395901_0050915 3300038443 Bacteria 4303
243 Ga0395901_0054798 3300038443 Bacteria 4145
244 Ga0395901_0081332 3300038443 Bacteria 3383
245 Ga0395901_0098256 3300038443 Bacteria 3069
246 Ga0451855_1883255 3300041511 Bacteria 2193
247 Ga0451853_0839514 3300041512 Unclassified 1491
248 Ga0451576_0071285 3300045051 Bacteria 3616
249 Ga0495603_0002533 3300046455 Bacteria 10757
250 Ga0495603_0091148 3300046455 Bacteria 1782
251 Ga0495641_0011157 3300046461 Bacteria 5143
252 Ga0495653_0005599 3300046463 Bacteria 10246
253 Ga0495580_0164869 3300046472 Bacteria 1533
254 Ga0495582_0062805 3300046473 Bacteria 2052
255 Ga0495639_0022631 3300046475 Bacteria 2758
256 Ga0495584_0041616 3300046491 Bacteria 2319
257 Ga0495594_0002098 3300046499 Bacteria 10375
258 Ga0495594_0078269 3300046499 Bacteria 1845
259 Ga0495630_0070647 3300046517 Bacteria 2627
260 Ga0495666_0013422 3300046526 Bacteria 4086
261 Ga0495667_0040570 3300046559 Bacteria 3090
262 Ga0495667_0042643 3300046559 Bacteria 3009
263 Ga0495634_0033469 3300046642 Bacteria 3532
264 Ga0495659_0003664 3300046664 Bacteria 4884
265 Ga0495659_0009673 3300046664 Bacteria 3082
266 Ga0495588_0003428 3300046674 Bacteria 6891
267 Ga0495588_0019736 3300046674 Bacteria 3306
268 Ga0495647_0008692 3300046681 Bacteria 3418
269 Ga0495647_0064762 3300046681 Bacteria 1450
270 Ga0495581_0046253 3300047315 Bacteria 2514
271 Ga0495581_0061453 3300047315 Bacteria 2171
272 Ga0495636_0020795 3300047318 Bacteria 2646
273 Ga0495676_0019661 3300047321 Bacteria 5937
274 Ga0495680_0003730 3300047322 Bacteria 14837
275 Ga0495680_0037175 3300047322 Bacteria 3902
276 Ga0496100_0055435 3300048903 Bacteria 2589
277 Ga0496100_0115305 3300048903 Bacteria 1873
278 Ga0496101_0031538 3300048904 Bacteria 3727
279 Ga0496101_0073370 3300048904 Bacteria 2513
280 Ga0496102_0043756 3300048905 Bacteria 4061
281 Ga0496102_0153096 3300048905 Bacteria 2167
282 Ga0496102_0213926 3300048905 Bacteria 1817
283 Ga0496103_0014588 3300048906 Bacteria 4667
284 Ga0496103_0016918 3300048906 Bacteria 4356
285 Ga0496103_0024091 3300048906 Bacteria 3671
286 Ga0496104_0013469 3300048907 Bacteria 7368
287 Ga0496104_0158507 3300048907 Bacteria 2171
288 Ga0496105_0007344 3300048908 Bacteria 8520
289 Ga0496105_0030211 3300048908 Bacteria 4440
290 Ga0496106_0006675 3300048909 Bacteria 8544
291 Ga0496106_0022055 3300048909 Bacteria 4729
292 Ga0496106_0172729 3300048909 Bacteria 1714
293 Ga0496106_0194630 3300048909 Bacteria 1612
294 Ga0496107_0014443 3300048910 Bacteria 5530
295 Ga0496107_0015999 3300048910 Bacteria 5263
296 Ga0496107_0019956 3300048910 Bacteria 4733
297 Ga0496108_0000888 3300048911 Bacteria 23275
298 Ga0496108_0005463 3300048911 Bacteria 10273
299 Ga0496108_0021581 3300048911 Bacteria 5291
300 Ga0496108_0040692 3300048911 Bacteria 3876
301 Ga0496108_0041582 3300048911 Bacteria 3838
302 Ga0496108_0075809 3300048911 Bacteria 2842
303 Ga0496108_0207807 3300048911 Bacteria 1699
304 Ga0496109_0000579 3300048912 Bacteria 30650
305 Ga0496109_0001185 3300048912 Bacteria 21642
306 Ga0496109_0007084 3300048912 Bacteria 9465
307 Ga0496109_0016787 3300048912 Bacteria 6406
308 Ga0496109_0029927 3300048912 Bacteria 4880
309 Ga0496109_0030153 3300048912 Bacteria 4862
310 Ga0496109_0051742 3300048912 Bacteria 3741
311 Ga0496109_0212383 3300048912 Bacteria 1820
312 Ga0496110_0018195 3300048913 Bacteria 5888
313 Ga0496110_0018567 3300048913 Bacteria 5833
314 Ga0496110_0022882 3300048913 Bacteria 5311
315 Ga0496110_0025658 3300048913 Bacteria 5039
316 Ga0496110_0031863 3300048913 Bacteria 4550
317 Ga0496111_0000740 3300048914 Bacteria 17415
318 Ga0496111_0004112 3300048914 Bacteria 9136
319 Ga0496111_0033774 3300048914 Bacteria 3650
320 Ga0496111_0036757 3300048914 Bacteria 3503
321 Ga0496112_0001299 3300048915 Bacteria 18983
322 Ga0496112_0004065 3300048915 Bacteria 12280
323 Ga0496112_0014923 3300048915 Bacteria 7229
324 Ga0496112_0028429 3300048915 Bacteria 5397
325 Ga0496112_0039430 3300048915 Bacteria 4616
326 Ga0496112_0096210 3300048915 Bacteria 2931
327 Ga0496112_0098787 3300048915 Bacteria 2888
328 Ga0496112_0157373 3300048915 Bacteria 2239
329 Ga0496112_0161803 3300048915 Bacteria 2205
330 Ga0496113_0000174 3300048916 Bacteria 28582
331 Ga0496113_0009714 3300048916 Bacteria 6321
332 Ga0496113_0149795 3300048916 Bacteria 1840
333 Ga0496114_0063008 3300048917 Bacteria 3104
334 Ga0496114_0212827 3300048917 Bacteria 1696
335 Ga0496115_0026190 3300048918 Bacteria 4549
336 Ga0496115_0028060 3300048918 Bacteria 4408
337 Ga0501031_0052897 3300049568 Bacteria 2645
338 Ga0501032_0009030 3300049569 Bacteria 7244
339 Ga0501033_0001810 3300049570 Bacteria 18675
340 Ga0501037_0005892 3300049573 Bacteria 8954
341 Ga0501038_0001658 3300049574 Bacteria 20668
342 Ga0501040_0069824 3300049576 Bacteria 2423
343 Ga0501041_0005591 3300049577 Bacteria 7351
344 Ga0501042_0051320 3300049578 Bacteria 2941
345 Ga0501043_0007898 3300049579 Bacteria 8408
346 Ga0501048_0036201 3300049582 Bacteria 3548
347 Ga0501067_0002546 3300049583 Bacteria 10059
348 Ga0501069_0007941 3300049585 Bacteria 5571
349 Ga0501069_0019455 3300049585 Bacteria 3672
350 Ga0501070_0003884 3300049586 Bacteria 12890
351 Ga0501070_0137664 3300049586 Bacteria 2016
352 Ga0501071_0049320 3300049587 Bacteria 3030
353 Ga0501072_0116560 3300049588 Bacteria 2127
354 Ga0501073_0012982 3300049589 Bacteria 6072
355 Ga0501074_0003093 3300049590 Bacteria 11736
356 Ga0501075_0011404 3300049591 Bacteria 6289
357 Ga0501076_0024392 3300049592 Bacteria 4674
358 Ga0501079_0012521 3300049741 Bacteria 6474
359 Ga0501080_0025565 3300049742 Bacteria 5482
360 Ga0501080_0122030 3300049742 Bacteria 2414
361 Ga0501081_0013746 3300049743 Bacteria 5324
362 Ga0501083_0004922 3300049744 Bacteria 9451
363 Ga0501035_0022479 3300049822 Bacteria 5792
364 Ga0501045_0009611 3300049824 Bacteria 6769
365 nmdc:mga00v17_11393_c1 3300050491 Bacteria 4888
366 nmdc:mga0yw44_11333_c1 3300050492 Bacteria 4596
367 nmdc:mga0yw44_11977_c1 3300050492 Bacteria 4502
368 nmdc:mga05p37_12859_c1 3300050507 Bacteria 10009
369 nmdc:mga05p37_77078_c1 3300050507 Bacteria 4104
370 nmdc:mga09592_42477_c1 3300050508 Bacteria 3824
371 nmdc:mga0qj67_272999_c1 3300050509 Bacteria 1371
372 nmdc:mga06r32_105922_c1 3300050510 Bacteria 2763
373 nmdc:mga06r32_161708_c1 3300050510 Bacteria 2221
374 nmdc:mga08y16_169127_c1 3300050511 Bacteria 2270
375 nmdc:mga08y16_34768_c1 3300050511 Bacteria 5294
376 nmdc:mga08y16_99035_c1 3300050511 Bacteria 3036
377 nmdc:mga0n895_30574_c1 3300050512 Bacteria 5149
378 nmdc:mga0rr50_12701_c1 3300050513 Bacteria 5455
379 nmdc:mga0rr50_32003_c1 3300050513 Bacteria 3742
380 nmdc:mga0a205_127405_c1 3300050515 Bacteria 2446
381 nmdc:mga0a205_55704_c1 3300050515 Bacteria 3818
382 Ga0495619_0015760 3300053085 Bacteria 4784
383 Ga0501084_0115746 3300054114 Bacteria 2253
384 Ga0501082_0002634 3300060353 Bacteria 15687
385 Ga0530510_0111328 3300061734 Bacteria 2005
386 Ga0070666_10043853
387 JGI25407J50210_10001292
388 Ga0070658_10092740
389 Ga0070690_100015570
390 Ga0070682_100036903
391 Ga0068868_100019154
392 Ga0068868_100139630
393 Ga0070660_100055957
394 Ga0070689_100030414
395 Ga0070692_10016269
396 Ga0070688_100006579
397 Ga0070703_10007572
398 Ga0070714_100053001
399 Ga0070714_100056645
400 Ga0070713_100205116
401 Ga0070713_100229655
402 Ga0070710_10037919
403 Ga0070711_100078371
404 Ga0070705_100024034
405 Ga0070705_100031369
406 Ga0070694_100008951
407 Ga0070694_100010701
408 Ga0070708_100135755
409 Ga0070678_100001665
410 Ga0070662_100088325
411 Ga0068867_100000419
412 Ga0070685_10045915
413 Ga0070706_100055179
414 Ga0070706_100074139
415 Ga0070706_100074315
416 Ga0070707_100000635
417 Ga0070698_100009438
418 Ga0070698_100021659
419 Ga0070698_100052562
420 Ga0070698_100362849
421 Ga0070699_100030457
422 Ga0068853_100027575
423 Ga0070672_100168992
424 Ga0070695_100024382
425 Ga0070696_100019944
426 Ga0070696_100028888
427 Ga0070704_100044593
428 Ga0070704_100064547
429 Ga0070704_100201811
430 Ga0070704_100246592
431 Ga0068855_100131533
432 Ga0068855_100272086
433 Ga0068856_100014290
434 Ga0068856_100048516
435 Ga0070702_100023151
436 Ga0068859_100178049
437 Ga0068866_10001873
438 Ga0068858_100085960
439 Ga0068860_100212551
440 Ga0081455_10003352
441 Ga0081455_10005873
442 Ga0081455_10013085
443 Ga0081455_10067928
444 Ga0081538_10000057
445 Ga0081538_10001522
446 Ga0081540_1011247
447 Ga0081539_10020179
448 Ga0070717_10096034
449 Ga0070717_10153149
450 Ga0075365_10003877
451 Ga0075365_10031252
452 Ga0075365_10045715
453 Ga0075364_10004159
454 Ga0070715_10014809
455 Ga0070712_100005380
456 Ga0097621_100044100
457 Ga0075428_100170380
458 Ga0075431_100097375
459 Ga0075433_10007091
460 Ga0068865_100000269
461 Ga0075436_100013282
462 Ga0097620_100178063
463 Ga0075435_100002731
464 Ga0105240_10113226
465 Ga0111539_10017183
466 Ga0111539_10128974
467 Ga0111539_10210205
468 Ga0111539_10703762
469 Ga0105245_10058936
470 Ga0105245_10100983
471 Ga0105247_10023901
472 Ga0114129_10001278
473 Ga0114129_10032291
474 Ga0114129_10066968
475 Ga0114129_10067590
476 Ga0114129_10217119
477 Ga0105243_10020985
478 Ga0105243_10035161
479 Ga0105243_10112468
480 Ga0105243_10222527
481 Ga0105242_10019337
482 Ga0105242_10250448
483 Ga0105248_10012557
484 Ga0105238_10090226
485 Ga0105249_10003662
486 Ga0105249_10140142
487 Ga0105239_10118159
488 Ga0157374_10005704
489 Ga0157378_10037801
490 Ga0163162_10061494
491 Ga0157372_10141896
492 Ga0157375_10041480
493 Ga0157380_10029026
494 Ga0157376_10156675
495 Ga0163161_10009018
496 Ga0207653_10002300
497 Ga0207692_10005123
498 Ga0207692_10059176
499 Ga0207688_10130644
500 Ga0207680_10087678
501 Ga0207685_10028435
502 Ga0207699_10020484
503 Ga0207705_10083146
504 Ga0207684_10003747
505 Ga0207684_10118595
506 Ga0207654_10144752
507 Ga0207707_10111534
508 Ga0207695_10259217
509 Ga0207693_10000422
510 Ga0207693_10001049
511 Ga0207693_10012668
512 Ga0207693_10053845
513 Ga0207693_10055588
514 Ga0207693_10068653
515 Ga0207693_10112260
516 Ga0207663_10039269
517 Ga0207663_10065657
518 Ga0207660_10091452
519 Ga0207660_10092364
520 Ga0207657_10033976
521 Ga0207646_10006745
522 Ga0207687_10057116
523 Ga0207700_10000006
524 Ga0207700_10045483
525 Ga0207700_10244324
526 Ga0207664_10000789
527 Ga0207706_10011413
528 Ga0207706_10148491
529 Ga0207686_10059428
530 Ga0207669_10024606
531 Ga0207704_10139993
532 Ga0207665_10007191
533 Ga0207665_10062229
534 Ga0207691_10067713
535 Ga0207711_10022407
536 Ga0207689_10189457
537 Ga0207712_10100799
538 Ga0207677_10125007
539 Ga0207677_10168089
540 Ga0207708_10001945
541 Ga0207708_10043075
542 Ga0207702_10010568
543 Ga0207648_10000729
544 Ga0207648_10062689
545 Ga0207675_100004302
546 Ga0207675_100021274
547 Ga0207675_100109174
548 Ga0207683_10000371
549 Ga0207683_10018001
550 Ga0207428_10014471
551 Ga0207428_10083291
552 Ga0207428_10115713
553 Ga0265336_10021987
554 Ga0265338_10010331
555 Ga0265338_10023746
556 Ga0265330_10001408
557 Ga0265329_10007129
558 Ga0265340_10019739
559 Ga0265339_10024994
560 Ga0265327_10009207
561 Ga0265316_10016967
562 Ga0265314_10092952
563 Ga0265342_10058525
564 Ga0307405_10018083
565 Ga0307409_100124757
566 Ga0307416_100013250
567 Ga0307415_100022160
568 Ga0373928_0018165
569 Ga0373956_0054821
570 Ga0373943_0025765
571 Ga0373955_0035705
572 Ga0373961_0007767
573 Ga0373961_0010567
574 Ga0373962_0007075
575 Ga0373931_0002319
576 Ga0373947_0097284
577 Ga0373937_0086646
578 Ga0373925_0024608
579 Ga0395899_0012464
580 Ga0395899_0029028
581 Ga0395899_0075400
582 Ga0395899_0102388
583 Ga0395899_0143092
584 Ga0395900_0000988
585 Ga0395900_0002063
586 Ga0395900_0010486
587 Ga0395900_0017046
588 Ga0395900_0045007
589 Ga0395900_0047191
590 Ga0395900_0068997
591 Ga0395900_0090795
592 Ga0395900_0095742
593 Ga0395900_0099029
594 Ga0395898_0001851
595 Ga0395898_0006147
596 Ga0395898_0010358
597 Ga0395898_0011733
598 Ga0395898_0016182
599 Ga0395898_0023048
600 Ga0395898_0057793
601 Ga0395898_0060014
602 Ga0395898_0069703
603 Ga0395898_0185459
604 Ga0395898_0282447
605 Ga0395905_0002715
606 Ga0395905_0003035
607 Ga0395905_0007145
608 Ga0395905_0007299
609 Ga0395905_0008476
610 Ga0395905_0010493
611 Ga0395905_0042313
612 Ga0395905_0045421
613 Ga0395905_0045461
614 Ga0395905_0117533
615 Ga0395905_0187424
616 Ga0395905_0285415
617 Ga0395901_0001046
618 Ga0395901_0001425
619 Ga0395901_0001699
620 Ga0395901_0007379
621 Ga0395901_0008797
622 Ga0395901_0012514
623 Ga0395901_0017391
624 Ga0395901_0020914
625 Ga0395901_0026052
626 Ga0395901_0039672
627 Ga0395901_0050915
628 Ga0395901_0054798
629 Ga0395901_0081332
630 Ga0395901_0098256
631 Ga0451855_1883255
632 Ga0451853_0839514
633 Ga0451576_0071285
634 Ga0495603_0002533
635 Ga0495603_0091148
636 Ga0495641_0011157
637 Ga0495653_0005599
638 Ga0495580_0164869
639 Ga0495582_0062805
640 Ga0495639_0022631
641 Ga0495584_0041616
642 Ga0495594_0002098
643 Ga0495594_0078269
644 Ga0495630_0070647
645 Ga0495666_0013422
646 Ga0495667_0040570
647 Ga0495667_0042643
648 Ga0495634_0033469
649 Ga0495659_0003664
650 Ga0495659_0009673
651 Ga0495588_0003428
652 Ga0495588_0019736
653 Ga0495647_0008692
654 Ga0495647_0064762
655 Ga0495581_0046253
656 Ga0495581_0061453
657 Ga0495636_0020795
658 Ga0495676_0019661
659 Ga0495680_0003730
660 Ga0495680_0037175
661 Ga0496100_0055435
662 Ga0496100_0115305
663 Ga0496101_0031538
664 Ga0496101_0073370
665 Ga0496102_0043756
666 Ga0496102_0153096
667 Ga0496102_0213926
668 Ga0496103_0014588
669 Ga0496103_0016918
670 Ga0496103_0024091
671 Ga0496104_0013469
672 Ga0496104_0158507
673 Ga0496105_0007344
674 Ga0496105_0030211
675 Ga0496106_0006675
676 Ga0496106_0022055
677 Ga0496106_0172729
678 Ga0496106_0194630
679 Ga0496107_0014443
680 Ga0496107_0015999
681 Ga0496107_0019956
682 Ga0496108_0000888
683 Ga0496108_0005463
684 Ga0496108_0021581
685 Ga0496108_0040692
686 Ga0496108_0041582
687 Ga0496108_0075809
688 Ga0496108_0207807
689 Ga0496109_0000579
690 Ga0496109_0001185
691 Ga0496109_0007084
692 Ga0496109_0016787
693 Ga0496109_0029927
694 Ga0496109_0030153
695 Ga0496109_0051742
696 Ga0496109_0212383
697 Ga0496110_0018195
698 Ga0496110_0018567
699 Ga0496110_0022882
700 Ga0496110_0025658
701 Ga0496110_0031863
702 Ga0496111_0000740
703 Ga0496111_0004112
704 Ga0496111_0033774
705 Ga0496111_0036757
706 Ga0496112_0001299
707 Ga0496112_0004065
708 Ga0496112_0014923
709 Ga0496112_0028429
710 Ga0496112_0039430
711 Ga0496112_0096210
712 Ga0496112_0098787
713 Ga0496112_0157373
714 Ga0496112_0161803
715 Ga0496113_0000174
716 Ga0496113_0009714
717 Ga0496113_0149795
718 Ga0496114_0063008
719 Ga0496114_0212827
720 Ga0496115_0026190
721 Ga0496115_0028060
722 Ga0501031_0052897
723 Ga0501032_0009030
724 Ga0501033_0001810
725 Ga0501037_0005892
726 Ga0501038_0001658
727 Ga0501040_0069824
728 Ga0501041_0005591
729 Ga0501042_0051320
730 Ga0501043_0007898
731 Ga0501048_0036201
732 Ga0501067_0002546
733 Ga0501069_0007941
734 Ga0501069_0019455
735 Ga0501070_0003884
736 Ga0501070_0137664
737 Ga0501071_0049320
738 Ga0501072_0116560
739 Ga0501073_0012982
740 Ga0501074_0003093
741 Ga0501075_0011404
742 Ga0501076_0024392
743 Ga0501079_0012521
744 Ga0501080_0025565
745 Ga0501080_0122030
746 Ga0501081_0013746
747 Ga0501083_0004922
748 Ga0501035_0022479
749 Ga0501045_0009611
750 nmdc:mga00v17_11393_c1
751 nmdc:mga0yw44_11333_c1
752 nmdc:mga0yw44_11977_c1
753 nmdc:mga05p37_12859_c1
754 nmdc:mga05p37_77078_c1
755 nmdc:mga09592_42477_c1
756 nmdc:mga0qj67_272999_c1
757 nmdc:mga06r32_105922_c1
758 nmdc:mga06r32_161708_c1
759 nmdc:mga08y16_169127_c1
760 nmdc:mga08y16_34768_c1
761 nmdc:mga08y16_99035_c1
762 nmdc:mga0n895_30574_c1
763 nmdc:mga0rr50_12701_c1
764 nmdc:mga0rr50_32003_c1
765 nmdc:mga0a205_127405_c1
766 nmdc:mga0a205_55704_c1
767 Ga0495619_0015760
768 Ga0501084_0115746
769 Ga0501082_0002634
770 Ga0530510_0111328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

60

430

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hg3-assembly1.cif.gz_A-2 hybrid dihydroorotase domain of human cad with e. coli flexible loop, bound to dihydroorotate 0.8407 107 375
4c6e-assembly1.cif.gz_A crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 5.5 0.8087 161 375
6hg2-assembly1.cif.gz_A-2 hybrid dihydroorotase domain of human cad with e. coli flexible loop, bound to fluoroorotate 0.8057 107 375
4c6b-assembly1.cif.gz_A-2 crystal structure of the dihydroorotase domain of human cad with incomplete active site, obtained recombinantly from e. coli. 0.803 161 375
8pbe-assembly1.cif.gz_A mutant k1556t of the dihydroorotase domain of human cad protein bound to the substrate carbamoyl aspartate 0.7954 161 375
ID Description Score Start End Superfamily
6gddA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8827 323 375 2.30.40.10
3griA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8579 326 375 2.30.40.10
4yiwA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.812 318 375 2.30.40.10
1gkpB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.7997 320 374 2.30.40.10
af_Q46806_2_437_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7994 109 372 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2N2CJX5-F1-model_v4 Amidohydrolase-related domain-containing protein 0.8655 102 375 GO:0004038
GO:0005737
GO:0006145
GO:0046872
AF-A0A3A0BQ29-F1-model_v4 Amidohydrolase-related domain-containing protein 0.8564 157 371 GO:0004038
GO:0005737
GO:0006145
GO:0046872
AF-A0A3B8WZK4-F1-model_v4 Dihydroorotase 0.853 100 375 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0006221
GO:0046872
AF-A0A524ISD7-F1-model_v4 Dihydroorotase 0.8502 168 375 GO:0004038
GO:0005737
GO:0006145
GO:0046872
AF-X1JR52-F1-model_v4 Amidohydrolase-related domain-containing protein 0.8488 164 375 GO:0004038
GO:0005737
GO:0006145

Map