F430096

General Info

Members Datasets Scaffolds Average Seq Length
385 210 766 125

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10279651|Ga0065712_102796512
Length 136
Sequence MKILYVEDDDNNVFVIKNRLGRVGYTIVIATDGEQGIAMAASEKPDLILMDLRMPGVDGWEATRRLKAAAETKRIPIIALSAHAMPGDREKALEAGCEDYDTKPIDFSRLRGKIEALLSTGNKNGAGSSNEKRDAP

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 0.26
Rhizosphere 98.7
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10279651 3300005290 Bacteria 898
2 Ga0065707_10552880 3300005295 Bacteria 720
3 Ga0070676_10251657 3300005328 Bacteria 1179
4 Ga0070676_10546788 3300005328 Bacteria 828
5 Ga0070683_101228705 3300005329 Bacteria 720
6 Ga0070670_100035827 3300005331 Bacteria 4272
7 Ga0070670_100052005 3300005331 Bacteria 3518
8 Ga0068869_100203277 3300005334 Bacteria 1563
9 Ga0068869_100506029 3300005334 Bacteria 1009
10 Ga0070666_10016580 3300005335 Bacteria 4714
11 Ga0070680_100185706 3300005336 Bacteria 1751
12 Ga0070680_100345302 3300005336 Bacteria 1265
13 Ga0070682_100535848 3300005337 Unclassified 913
14 Ga0068868_100027941 3300005338 Bacteria 4308
15 Ga0070660_100014051 3300005339 Bacteria 5763
16 Ga0070660_100057329 3300005339 Bacteria 3017
17 Ga0070661_100025482 3300005344 Bacteria 4250
18 Ga0070661_100139669 3300005344 Bacteria 1825
19 Ga0070668_100024446 3300005347 Bacteria 4578
20 Ga0070668_100044832 3300005347 Bacteria 3393
21 Ga0070669_100018536 3300005353 Bacteria 4973
22 Ga0070669_100056515 3300005353 Bacteria 2877
23 Ga0070669_100197560 3300005353 Bacteria 1581
24 Ga0070675_100018916 3300005354 Bacteria 5487
25 Ga0070675_100227853 3300005354 Bacteria 1625
26 Ga0070675_100783637 3300005354 Bacteria 871
27 Ga0070675_100823231 3300005354 Bacteria 849
28 Ga0070671_100007952 3300005355 Bacteria 8482
29 Ga0070671_100248105 3300005355 Bacteria 1512
30 Ga0070674_100005603 3300005356 Bacteria 7271
31 Ga0070673_100007819 3300005364 Bacteria 7080
32 Ga0070673_100019630 3300005364 Bacteria 4856
33 Ga0070688_100036989 3300005365 Bacteria 2972
34 Ga0070688_100094641 3300005365 Bacteria 1959
35 Ga0070659_100086557 3300005366 Bacteria 2507
36 Ga0070659_100158081 3300005366 Bacteria 1852
37 Ga0070659_100309571 3300005366 Bacteria 1319
38 Ga0070659_100312320 3300005366 Bacteria 1313
39 Ga0070667_100008322 3300005367 Bacteria 8597
40 Ga0070701_10702847 3300005438 Bacteria 680
41 Ga0070705_100547599 3300005440 Bacteria 886
42 Ga0070705_100917034 3300005440 Bacteria 706
43 Ga0070694_100269913 3300005444 Bacteria 1293
44 Ga0070694_100626678 3300005444 Bacteria 868
45 Ga0070708_100017898 3300005445 Bacteria 5922
46 Ga0070708_100184332 3300005445 Bacteria 1952
47 Ga0070663_100796219 3300005455 Bacteria 810
48 Ga0070663_101316102 3300005455 Bacteria 638
49 Ga0070678_100082446 3300005456 Bacteria 2441
50 Ga0070662_100011721 3300005457 Bacteria 5787
51 Ga0070681_10008951 3300005458 Bacteria 9846
52 Ga0068867_100018399 3300005459 Bacteria 4966
53 Ga0068867_100114887 3300005459 Bacteria 2073
54 Ga0070706_100012622 3300005467 Bacteria 7818
55 Ga0070706_100067158 3300005467 Bacteria 3316
56 Ga0070706_100115779 3300005467 Bacteria 2496
57 Ga0070706_100189433 3300005467 Bacteria 1922
58 Ga0070706_102018002 3300005467 Bacteria 522
59 Ga0070707_100057283 3300005468 Bacteria 3738
60 Ga0070707_100207295 3300005468 Bacteria 1911
61 Ga0070707_100397245 3300005468 Bacteria 1339
62 Ga0070707_100508141 3300005468 Bacteria 1167
63 Ga0070707_100641138 3300005468 Bacteria 1025
64 Ga0070698_100370248 3300005471 Bacteria 1365
65 Ga0070699_100009275 3300005518 Bacteria 8523
66 Ga0070699_100411381 3300005518 Bacteria 1224
67 Ga0070679_100136471 3300005530 Bacteria 2434
68 Ga0070679_100657813 3300005530 Bacteria 990
69 Ga0070679_101619264 3300005530 Bacteria 595
70 Ga0070697_100119458 3300005536 Bacteria 2204
71 Ga0070697_100433197 3300005536 Bacteria 1144
72 Ga0070697_100888551 3300005536 Unclassified 790
73 Ga0070697_101543474 3300005536 Bacteria 594
74 Ga0068853_100140562 3300005539 Bacteria 2167
75 Ga0068853_100259522 3300005539 Bacteria 1597
76 Ga0070672_100002376 3300005543 Bacteria 11911
77 Ga0070672_100380871 3300005543 Bacteria 1207
78 Ga0070672_100395371 3300005543 Unclassified 1184
79 Ga0070672_100750168 3300005543 Bacteria 857
80 Ga0070672_101451426 3300005543 Bacteria 614
81 Ga0070686_101412482 3300005544 Bacteria 584
82 Ga0070695_100062693 3300005545 Bacteria 2415
83 Ga0070696_100676691 3300005546 Bacteria 839
84 Ga0070693_100150771 3300005547 Unclassified 1472
85 Ga0070665_100112597 3300005548 Bacteria 2724
86 Ga0070665_101790578 3300005548 Bacteria 621
87 Ga0070704_100035689 3300005549 Bacteria 3382
88 Ga0070704_100130706 3300005549 Bacteria 1945
89 Ga0068855_100024642 3300005563 Bacteria 7197
90 Ga0068855_100106248 3300005563 Bacteria 3227
91 Ga0068855_100285262 3300005563 Bacteria 1832
92 Ga0068855_100697091 3300005563 Bacteria 1087
93 Ga0070664_100034948 3300005564 Bacteria 4218
94 Ga0070664_100096041 3300005564 Bacteria 2571
95 Ga0070664_101720930 3300005564 Unclassified 594
96 Ga0068857_100030487 3300005577 Bacteria 4762
97 Ga0068857_100183756 3300005577 Bacteria 1903
98 Ga0068854_100058418 3300005578 Bacteria 2784
99 Ga0070702_101197774 3300005615 Bacteria 612
100 Ga0068852_100018455 3300005616 Bacteria 5496
101 Ga0068852_100019257 3300005616 Bacteria 5396
102 Ga0068852_100698917 3300005616 Bacteria 1024
103 Ga0068859_100024665 3300005617 Bacteria 6035
104 Ga0068859_100305034 3300005617 Bacteria 1686
105 Ga0068859_100469210 3300005617 Bacteria 1354
106 Ga0068859_100756795 3300005617 Bacteria 1060
107 Ga0068864_100281419 3300005618 Bacteria 1552
108 Ga0068864_100896457 3300005618 Bacteria 875
109 Ga0068866_10033758 3300005718 Bacteria 2486
110 Ga0068861_100122260 3300005719 Bacteria 2102
111 Ga0068861_100292491 3300005719 Bacteria 1407
112 Ga0068861_100379689 3300005719 Bacteria 1248
113 Ga0068863_100005464 3300005841 Bacteria 12512
114 Ga0068863_100248473 3300005841 Bacteria 1718
115 Ga0068863_100349560 3300005841 Bacteria 1439
116 Ga0068863_100523580 3300005841 Bacteria 1169
117 Ga0068863_101298571 3300005841 Bacteria 734
118 Ga0068863_101617804 3300005841 Bacteria 657
119 Ga0068858_100375277 3300005842 Bacteria 1364
120 Ga0068860_100037382 3300005843 Bacteria 4648
121 Ga0068860_100055924 3300005843 Bacteria 3751
122 Ga0068860_100065855 3300005843 Bacteria 3440
123 Ga0068862_100104671 3300005844 Bacteria 2479
124 Ga0068862_100509052 3300005844 Bacteria 1144
125 Ga0068862_100547305 3300005844 Bacteria 1105
126 Ga0081540_1062214 3300005983 Bacteria 1774
127 Ga0075366_10023938 3300006195 Bacteria 3558
128 Ga0097621_100007904 3300006237 Bacteria 7628
129 Ga0097621_100201628 3300006237 Bacteria 1727
130 Ga0097621_100637329 3300006237 Bacteria 977
131 Ga0097621_100850008 3300006237 Bacteria 848
132 Ga0068871_100022548 3300006358 Bacteria 4857
133 Ga0068871_100289575 3300006358 Bacteria 1435
134 Ga0075428_100022579 3300006844 Bacteria 6966
135 Ga0075428_101802222 3300006844 Bacteria 637
136 Ga0075430_100157707 3300006846 Bacteria 1889
137 Ga0075431_100066013 3300006847 Bacteria 3736
138 Ga0075433_10069725 3300006852 Bacteria 3088
139 Ga0075433_10106384 3300006852 Bacteria 2486
140 Ga0075433_10261794 3300006852 Bacteria 1533
141 Ga0075433_10481096 3300006852 Bacteria 1094
142 Ga0075434_100024955 3300006871 Bacteria 5846
143 Ga0075434_100111516 3300006871 Bacteria 2746
144 Ga0075434_100119281 3300006871 Bacteria 2652
145 Ga0075434_101961037 3300006871 Bacteria 591
146 Ga0068865_100017709 3300006881 Bacteria 4586
147 Ga0068865_101543775 3300006881 Bacteria 596
148 Ga0075436_100362257 3300006914 Bacteria 1046
149 Ga0097620_100024666 3300006931 Bacteria 6035
150 Ga0097620_100305022 3300006931 Bacteria 1686
151 Ga0097620_100469198 3300006931 Bacteria 1354
152 Ga0097620_100756868 3300006931 Bacteria 1060
153 Ga0075435_100016511 3300007076 Bacteria 5567
154 Ga0075435_100017807 3300007076 Bacteria 5385
155 Ga0075435_100082778 3300007076 Bacteria 2638
156 Ga0099794_10004647 3300007265 Bacteria 5428
157 Ga0111539_11680631 3300009094 Bacteria 736
158 Ga0105245_11436952 3300009098 Bacteria 740
159 Ga0114129_10181368 3300009147 Bacteria 2864
160 Ga0114129_12355164 3300009147 Bacteria 638
161 Ga0114129_12553718 3300009147 Unclassified 610
162 Ga0105243_11774609 3300009148 Bacteria 647
163 Ga0105243_12303703 3300009148 Bacteria 576
164 Ga0105248_10014905 3300009177 Bacteria 8560
165 Ga0105248_10047147 3300009177 Bacteria 4832
166 Ga0105248_10403702 3300009177 Bacteria 1539
167 Ga0105248_11639537 3300009177 Bacteria 729
168 Ga0105238_10036163 3300009551 Bacteria 5019
169 Ga0105249_10091504 3300009553 Bacteria 2846
170 Ga0105249_11170520 3300009553 Bacteria 840
171 Ga0105239_10072059 3300010375 Bacteria 3797
172 Ga0157373_10144928 3300013100 Bacteria 1670
173 Ga0157370_10011153 3300013104 Bacteria 9419
174 Ga0157370_10019161 3300013104 Bacteria 6876
175 Ga0157369_10005990 3300013105 Bacteria 14124
176 Ga0157369_10436774 3300013105 Bacteria 1356
177 Ga0157378_10008668 3300013297 Bacteria 8850
178 Ga0163162_10039005 3300013306 Bacteria 4743
179 Ga0163162_10347857 3300013306 Bacteria 1615
180 Ga0157372_10031402 3300013307 Bacteria 5816
181 Ga0157375_10011267 3300013308 Bacteria 7892
182 Ga0157375_11319559 3300013308 Bacteria 849
183 Ga0157375_11771302 3300013308 Bacteria 732
184 Ga0157375_12168598 3300013308 Bacteria 662
185 Ga0163163_10142032 3300014325 Bacteria 2443
186 Ga0163163_11359807 3300014325 Bacteria 772
187 Ga0163163_11935458 3300014325 Bacteria 649
188 Ga0157380_10164671 3300014326 Bacteria 1931
189 Ga0157380_10281205 3300014326 Bacteria 1522
190 Ga0157380_10929903 3300014326 Bacteria 898
191 Ga0157377_10466040 3300014745 Bacteria 875
192 Ga0157377_10597207 3300014745 Bacteria 787
193 Ga0157377_10847720 3300014745 Bacteria 678
194 Ga0157379_12446447 3300014968 Bacteria 522
195 Ga0157376_10005344 3300014969 Bacteria 8968
196 Ga0157376_10008418 3300014969 Bacteria 7440
197 Ga0183362_10002 3300015683 Bacteria 1432711
198 Ga0163161_10014173 3300017792 Bacteria 5552
199 Ga0206356_11797559 3300020070 Bacteria 682
200 Ga0206352_10932386 3300020078 Bacteria 888
201 Ga0206353_11012554 3300020082 Bacteria 1912
202 Ga0207697_10036229 3300025315 Bacteria 2020
203 Ga0207680_10054965 3300025903 Bacteria 2397
204 Ga0207645_10834723 3300025907 Bacteria 626
205 Ga0207684_10070365 3300025910 Bacteria 2973
206 Ga0207684_10130381 3300025910 Bacteria 2158
207 Ga0207684_11710314 3300025910 Unclassified 507
208 Ga0207707_10004155 3300025912 Bacteria 12829
209 Ga0207695_11109170 3300025913 Bacteria 671
210 Ga0207693_10727464 3300025915 Bacteria 768
211 Ga0207660_10756261 3300025917 Bacteria 793
212 Ga0207662_10309581 3300025918 Bacteria 1052
213 Ga0207657_10012044 3300025919 Bacteria 8554
214 Ga0207657_10397732 3300025919 Bacteria 1084
215 Ga0207649_10009062 3300025920 Bacteria 5438
216 Ga0207649_10078308 3300025920 Bacteria 2132
217 Ga0207652_10333593 3300025921 Bacteria 1369
218 Ga0207652_11151393 3300025921 Bacteria 677
219 Ga0207646_10079922 3300025922 Unclassified 2923
220 Ga0207646_10176849 3300025922 Bacteria 1928
221 Ga0207646_10321146 3300025922 Bacteria 1399
222 Ga0207646_11440074 3300025922 Bacteria 598
223 Ga0207681_10026680 3300025923 Bacteria 3729
224 Ga0207681_10044272 3300025923 Bacteria 2983
225 Ga0207681_10051277 3300025923 Bacteria 2795
226 Ga0207694_10624143 3300025924 Bacteria 907
227 Ga0207650_10067263 3300025925 Bacteria 2688
228 Ga0207650_10072160 3300025925 Bacteria 2598
229 Ga0207650_10212285 3300025925 Bacteria 1554
230 Ga0207650_10816224 3300025925 Bacteria 791
231 Ga0207650_11085155 3300025925 Bacteria 681
232 Ga0207659_10006415 3300025926 Bacteria 7205
233 Ga0207659_10055178 3300025926 Bacteria 2840
234 Ga0207659_10150251 3300025926 Bacteria 1818
235 Ga0207644_10009176 3300025931 Bacteria 6486
236 Ga0207644_10274117 3300025931 Bacteria 1353
237 Ga0207644_10792204 3300025931 Bacteria 793
238 Ga0207690_10063388 3300025932 Bacteria 2520
239 Ga0207690_10117435 3300025932 Bacteria 1926
240 Ga0207690_10176031 3300025932 Bacteria 1607
241 Ga0207706_10060470 3300025933 Bacteria 3336
242 Ga0207670_11154265 3300025936 Bacteria 655
243 Ga0207669_10002166 3300025937 Bacteria 8335
244 Ga0207691_10024121 3300025940 Bacteria 5720
245 Ga0207691_10365297 3300025940 Bacteria 1233
246 Ga0207691_10603856 3300025940 Bacteria 929
247 Ga0207711_10005547 3300025941 Bacteria 10668
248 Ga0207711_10131813 3300025941 Bacteria 2242
249 Ga0207689_10142118 3300025942 Bacteria 1977
250 Ga0207661_10027152 3300025944 Bacteria 4370
251 Ga0207661_11097162 3300025944 Bacteria 733
252 Ga0207679_10050218 3300025945 Bacteria 3046
253 Ga0207679_11287567 3300025945 Unclassified 671
254 Ga0207667_10037773 3300025949 Bacteria 5161
255 Ga0207667_10067362 3300025949 Bacteria 3730
256 Ga0207667_10197355 3300025949 Bacteria 2065
257 Ga0207667_11100370 3300025949 Bacteria 778
258 Ga0207651_10011853 3300025960 Bacteria 4898
259 Ga0207651_10012783 3300025960 Bacteria 4770
260 Ga0207651_10234178 3300025960 Bacteria 1493
261 Ga0207712_10032446 3300025961 Bacteria 3526
262 Ga0207668_10058988 3300025972 Bacteria 2686
263 Ga0207640_10568708 3300025981 Bacteria 955
264 Ga0207658_10048284 3300025986 Bacteria 3120
265 Ga0207677_10184491 3300026023 Bacteria 1644
266 Ga0207677_11063087 3300026023 Bacteria 736
267 Ga0207703_10505235 3300026035 Bacteria 1135
268 Ga0207639_10042018 3300026041 Bacteria 3425
269 Ga0207639_10164758 3300026041 Bacteria 1871
270 Ga0207678_10218003 3300026067 Bacteria 1633
271 Ga0207678_11044180 3300026067 Bacteria 723
272 Ga0207708_10087945 3300026075 Bacteria 2393
273 Ga0207702_10017643 3300026078 Bacteria 5906
274 Ga0207641_10021918 3300026088 Bacteria 5252
275 Ga0207641_10085625 3300026088 Bacteria 2747
276 Ga0207641_11161117 3300026088 Bacteria 771
277 Ga0207648_10016135 3300026089 Bacteria 6839
278 Ga0207676_10293187 3300026095 Bacteria 1482
279 Ga0207676_10497881 3300026095 Bacteria 1157
280 Ga0207674_10040525 3300026116 Bacteria 4823
281 Ga0207674_10207958 3300026116 Bacteria 1906
282 Ga0207675_100134783 3300026118 Bacteria 2342
283 Ga0207675_100998307 3300026118 Bacteria 855
284 Ga0207683_10017806 3300026121 Bacteria 6059
285 Ga0207698_10010294 3300026142 Bacteria 5997
286 Ga0207698_10024003 3300026142 Bacteria 4271
287 Ga0207698_10047789 3300026142 Bacteria 3245
288 Ga0207698_11991493 3300026142 Bacteria 595
289 Ga0209969_1003875 3300027360 Bacteria 2083
290 Ga0209967_1002417 3300027364 Bacteria 2420
291 Ga0209981_1029673 3300027378 Bacteria 800
292 Ga0209984_1000521 3300027424 Bacteria 4212
293 Ga0210000_1000389 3300027462 Bacteria 6125
294 Ga0209995_1003132 3300027471 Bacteria 2627
295 Ga0209968_1039006 3300027526 Bacteria 809
296 Ga0209999_1002198 3300027543 Bacteria 3417
297 Ga0209982_1004730 3300027552 Bacteria 1957
298 Ga0209983_1021057 3300027665 Bacteria 1362
299 Ga0209588_1035161 3300027671 Bacteria 1610
300 Ga0209971_1003755 3300027682 Bacteria 3593
301 Ga0209974_10003629 3300027876 Bacteria 5545
302 Ga0268266_10096634 3300028379 Bacteria 2597
303 Ga0268266_10436171 3300028379 Bacteria 1244
304 Ga0268265_10054922 3300028380 Bacteria 3025
305 Ga0268265_10118864 3300028380 Bacteria 2174
306 Ga0268265_10956331 3300028380 Bacteria 844
307 Ga0268264_10039884 3300028381 Bacteria 3879
308 Ga0268264_10095266 3300028381 Bacteria 2575
309 Ga0307416_100933992 3300032002 Bacteria 969
310 Ga0307416_101600097 3300032002 Bacteria 757
311 Ga0373951_0098785 3300035091 Bacteria 774
312 Ga0373961_0138387 3300035241 Bacteria 821
313 Ga0373947_1157878 3300035725 Bacteria 527
314 Ga0373937_0667694 3300036401 Bacteria 985
315 Ga0316584_0444498 3300036712 Unclassified 918
316 Ga0316584_0561258 3300036712 Bacteria 796
317 Ga0395899_0066446 3300037312 Bacteria 2648
318 Ga0395900_0009454 3300037418 Bacteria 9991
319 Ga0395900_0911349 3300037418 Bacteria 802
320 Ga0436364_1428870 3300037853 Bacteria 681
321 Ga0395901_0008713 3300038443 Bacteria 10252
322 Ga0451849_0024246 3300041505 Bacteria 541
323 Ga0439464_0032846 3300042439 Bacteria 1459
324 Ga0451577_0265340 3300042876 Bacteria 1554
325 Ga0453684_0513787 3300044712 Bacteria 1324
326 Ga0451576_0827952 3300045051 Bacteria 972
327 Ga0451576_2043257 3300045051 Bacteria 590
328 Ga0495592_0299077 3300046454 Bacteria 1047
329 Ga0495628_0223968 3300046516 Bacteria 1412
330 Ga0495628_0323354 3300046516 Bacteria 1138
331 Ga0495652_0051226 3300046529 Bacteria 3527
332 Ga0495621_0046715 3300046539 Bacteria 1537
333 Ga0495599_0054083 3300046678 Bacteria 2515
334 Ga0495647_0221923 3300046681 Bacteria 835
335 Ga0495669_0514187 3300046684 Bacteria 582
336 Ga0496104_1019294 3300048907 Bacteria 732
337 Ga0501031_0655368 3300049568 Bacteria 675
338 Ga0501033_0921929 3300049570 Bacteria 586
339 Ga0501038_0083552 3300049574 Bacteria 2688
340 Ga0501038_0408782 3300049574 Bacteria 1049
341 Ga0501039_0608034 3300049575 Bacteria 857
342 Ga0501039_0704320 3300049575 Bacteria 790
343 Ga0501040_0700882 3300049576 Bacteria 732
344 Ga0501041_0883052 3300049577 Bacteria 574
345 Ga0501041_1066302 3300049577 Bacteria 520
346 Ga0501042_1446538 3300049578 Bacteria 501
347 Ga0501048_0189809 3300049582 Bacteria 1456
348 Ga0501072_0145462 3300049588 Bacteria 1890
349 Ga0501075_0141518 3300049591 Bacteria 1833
350 Ga0501075_1530060 3300049591 Bacteria 505
351 Ga0501076_0012785 3300049592 Bacteria 6286
352 Ga0501076_0691901 3300049592 Bacteria 842
353 Ga0501077_0170399 3300049593 Bacteria 1383
354 Ga0501081_0050482 3300049743 Bacteria 2866
355 Ga0501045_1141306 3300049824 Bacteria 569
356 nmdc:mga0k408_416671_c1 3300050493 Bacteria 799
357 nmdc:mga05p37_118460_c1 3300050507 Bacteria 3254
358 nmdc:mga05p37_132139_c1 3300050507 Bacteria 3062
359 nmdc:mga0qj67_145205_c1 3300050509 Bacteria 1923
360 nmdc:mga06r32_1214329_c1 3300050510 Unclassified 700
361 nmdc:mga0n895_10546_c1 3300050512 Bacteria 8171
362 nmdc:mga0n895_1333409_c1 3300050512 Bacteria 688
363 nmdc:mga0n895_151758_c1 3300050512 Bacteria 2347
364 nmdc:mga0rr50_28290_c1 3300050513 Bacteria 3938
365 nmdc:mga0rr50_391195_c1 3300050513 Bacteria 1173
366 nmdc:mga0rr50_535860_c1 3300050513 Bacteria 997
367 nmdc:mga0rr50_9927_c1 3300050513 Bacteria 6018
368 nmdc:mga08x19_1334864_c1 3300050514 Unclassified 508
369 nmdc:mga08x19_208704_c1 3300050514 Bacteria 1340
370 nmdc:mga08x19_278777_c1 3300050514 Bacteria 1158
371 nmdc:mga0a205_1504803_c1 3300050515 Bacteria 521
372 nmdc:mga0a205_164582_c1 3300050515 Bacteria 2114
373 nmdc:mga0a205_22316_c2 3300050515 Bacteria 3392
374 nmdc:mga0a205_307974_c1 3300050515 Bacteria 1456
375 nmdc:mga0a205_342059_c1 3300050515 Bacteria 1364
376 Ga0495601_0076736 3300053077 Bacteria 2140
377 Ga0495612_0039277 3300053078 Bacteria 1925
378 Ga0495595_0177205 3300053084 Bacteria 1056
379 Ga0495619_0244659 3300053085 Bacteria 1243
380 Ga0501084_0107732 3300054114 Bacteria 2341
381 Ga0501084_0471686 3300054114 Bacteria 1061
382 Ga0501084_0689165 3300054114 Bacteria 862
383 Ga0501082_0109308 3300060353 Bacteria 2393
384 Ga0065712_10279651
385 Ga0065707_10552880
386 Ga0070676_10251657
387 Ga0070676_10546788
388 Ga0070683_101228705
389 Ga0070670_100035827
390 Ga0070670_100052005
391 Ga0068869_100203277
392 Ga0068869_100506029
393 Ga0070666_10016580
394 Ga0070680_100185706
395 Ga0070680_100345302
396 Ga0070682_100535848
397 Ga0068868_100027941
398 Ga0070660_100014051
399 Ga0070660_100057329
400 Ga0070661_100025482
401 Ga0070661_100139669
402 Ga0070668_100024446
403 Ga0070668_100044832
404 Ga0070669_100018536
405 Ga0070669_100056515
406 Ga0070669_100197560
407 Ga0070675_100018916
408 Ga0070675_100227853
409 Ga0070675_100783637
410 Ga0070675_100823231
411 Ga0070671_100007952
412 Ga0070671_100248105
413 Ga0070674_100005603
414 Ga0070673_100007819
415 Ga0070673_100019630
416 Ga0070688_100036989
417 Ga0070688_100094641
418 Ga0070659_100086557
419 Ga0070659_100158081
420 Ga0070659_100309571
421 Ga0070659_100312320
422 Ga0070667_100008322
423 Ga0070701_10702847
424 Ga0070705_100547599
425 Ga0070705_100917034
426 Ga0070694_100269913
427 Ga0070694_100626678
428 Ga0070708_100017898
429 Ga0070708_100184332
430 Ga0070663_100796219
431 Ga0070663_101316102
432 Ga0070678_100082446
433 Ga0070662_100011721
434 Ga0070681_10008951
435 Ga0068867_100018399
436 Ga0068867_100114887
437 Ga0070706_100012622
438 Ga0070706_100067158
439 Ga0070706_100115779
440 Ga0070706_100189433
441 Ga0070706_102018002
442 Ga0070707_100057283
443 Ga0070707_100207295
444 Ga0070707_100397245
445 Ga0070707_100508141
446 Ga0070707_100641138
447 Ga0070698_100370248
448 Ga0070699_100009275
449 Ga0070699_100411381
450 Ga0070679_100136471
451 Ga0070679_100657813
452 Ga0070679_101619264
453 Ga0070697_100119458
454 Ga0070697_100433197
455 Ga0070697_100888551
456 Ga0070697_101543474
457 Ga0068853_100140562
458 Ga0068853_100259522
459 Ga0070672_100002376
460 Ga0070672_100380871
461 Ga0070672_100395371
462 Ga0070672_100750168
463 Ga0070672_101451426
464 Ga0070686_101412482
465 Ga0070695_100062693
466 Ga0070696_100676691
467 Ga0070693_100150771
468 Ga0070665_100112597
469 Ga0070665_101790578
470 Ga0070704_100035689
471 Ga0070704_100130706
472 Ga0068855_100024642
473 Ga0068855_100106248
474 Ga0068855_100285262
475 Ga0068855_100697091
476 Ga0070664_100034948
477 Ga0070664_100096041
478 Ga0070664_101720930
479 Ga0068857_100030487
480 Ga0068857_100183756
481 Ga0068854_100058418
482 Ga0070702_101197774
483 Ga0068852_100018455
484 Ga0068852_100019257
485 Ga0068852_100698917
486 Ga0068859_100024665
487 Ga0068859_100305034
488 Ga0068859_100469210
489 Ga0068859_100756795
490 Ga0068864_100281419
491 Ga0068864_100896457
492 Ga0068866_10033758
493 Ga0068861_100122260
494 Ga0068861_100292491
495 Ga0068861_100379689
496 Ga0068863_100005464
497 Ga0068863_100248473
498 Ga0068863_100349560
499 Ga0068863_100523580
500 Ga0068863_101298571
501 Ga0068863_101617804
502 Ga0068858_100375277
503 Ga0068860_100037382
504 Ga0068860_100055924
505 Ga0068860_100065855
506 Ga0068862_100104671
507 Ga0068862_100509052
508 Ga0068862_100547305
509 Ga0081540_1062214
510 Ga0075366_10023938
511 Ga0097621_100007904
512 Ga0097621_100201628
513 Ga0097621_100637329
514 Ga0097621_100850008
515 Ga0068871_100022548
516 Ga0068871_100289575
517 Ga0075428_100022579
518 Ga0075428_101802222
519 Ga0075430_100157707
520 Ga0075431_100066013
521 Ga0075433_10069725
522 Ga0075433_10106384
523 Ga0075433_10261794
524 Ga0075433_10481096
525 Ga0075434_100024955
526 Ga0075434_100111516
527 Ga0075434_100119281
528 Ga0075434_101961037
529 Ga0068865_100017709
530 Ga0068865_101543775
531 Ga0075436_100362257
532 Ga0097620_100024666
533 Ga0097620_100305022
534 Ga0097620_100469198
535 Ga0097620_100756868
536 Ga0075435_100016511
537 Ga0075435_100017807
538 Ga0075435_100082778
539 Ga0099794_10004647
540 Ga0111539_11680631
541 Ga0105245_11436952
542 Ga0114129_10181368
543 Ga0114129_12355164
544 Ga0114129_12553718
545 Ga0105243_11774609
546 Ga0105243_12303703
547 Ga0105248_10014905
548 Ga0105248_10047147
549 Ga0105248_10403702
550 Ga0105248_11639537
551 Ga0105238_10036163
552 Ga0105249_10091504
553 Ga0105249_11170520
554 Ga0105239_10072059
555 Ga0157373_10144928
556 Ga0157370_10011153
557 Ga0157370_10019161
558 Ga0157369_10005990
559 Ga0157369_10436774
560 Ga0157378_10008668
561 Ga0163162_10039005
562 Ga0163162_10347857
563 Ga0157372_10031402
564 Ga0157375_10011267
565 Ga0157375_11319559
566 Ga0157375_11771302
567 Ga0157375_12168598
568 Ga0163163_10142032
569 Ga0163163_11359807
570 Ga0163163_11935458
571 Ga0157380_10164671
572 Ga0157380_10281205
573 Ga0157380_10929903
574 Ga0157377_10466040
575 Ga0157377_10597207
576 Ga0157377_10847720
577 Ga0157379_12446447
578 Ga0157376_10005344
579 Ga0157376_10008418
580 Ga0183362_10002
581 Ga0163161_10014173
582 Ga0206356_11797559
583 Ga0206352_10932386
584 Ga0206353_11012554
585 Ga0207697_10036229
586 Ga0207680_10054965
587 Ga0207645_10834723
588 Ga0207684_10070365
589 Ga0207684_10130381
590 Ga0207684_11710314
591 Ga0207707_10004155
592 Ga0207695_11109170
593 Ga0207693_10727464
594 Ga0207660_10756261
595 Ga0207662_10309581
596 Ga0207657_10012044
597 Ga0207657_10397732
598 Ga0207649_10009062
599 Ga0207649_10078308
600 Ga0207652_10333593
601 Ga0207652_11151393
602 Ga0207646_10079922
603 Ga0207646_10176849
604 Ga0207646_10321146
605 Ga0207646_11440074
606 Ga0207681_10026680
607 Ga0207681_10044272
608 Ga0207681_10051277
609 Ga0207694_10624143
610 Ga0207650_10067263
611 Ga0207650_10072160
612 Ga0207650_10212285
613 Ga0207650_10816224
614 Ga0207650_11085155
615 Ga0207659_10006415
616 Ga0207659_10055178
617 Ga0207659_10150251
618 Ga0207644_10009176
619 Ga0207644_10274117
620 Ga0207644_10792204
621 Ga0207690_10063388
622 Ga0207690_10117435
623 Ga0207690_10176031
624 Ga0207706_10060470
625 Ga0207670_11154265
626 Ga0207669_10002166
627 Ga0207691_10024121
628 Ga0207691_10365297
629 Ga0207691_10603856
630 Ga0207711_10005547
631 Ga0207711_10131813
632 Ga0207689_10142118
633 Ga0207661_10027152
634 Ga0207661_11097162
635 Ga0207679_10050218
636 Ga0207679_11287567
637 Ga0207667_10037773
638 Ga0207667_10067362
639 Ga0207667_10197355
640 Ga0207667_11100370
641 Ga0207651_10011853
642 Ga0207651_10012783
643 Ga0207651_10234178
644 Ga0207712_10032446
645 Ga0207668_10058988
646 Ga0207640_10568708
647 Ga0207658_10048284
648 Ga0207677_10184491
649 Ga0207677_11063087
650 Ga0207703_10505235
651 Ga0207639_10042018
652 Ga0207639_10164758
653 Ga0207678_10218003
654 Ga0207678_11044180
655 Ga0207708_10087945
656 Ga0207702_10017643
657 Ga0207641_10021918
658 Ga0207641_10085625
659 Ga0207641_11161117
660 Ga0207648_10016135
661 Ga0207676_10293187
662 Ga0207676_10497881
663 Ga0207674_10040525
664 Ga0207674_10207958
665 Ga0207675_100134783
666 Ga0207675_100998307
667 Ga0207683_10017806
668 Ga0207698_10010294
669 Ga0207698_10024003
670 Ga0207698_10047789
671 Ga0207698_11991493
672 Ga0209969_1003875
673 Ga0209967_1002417
674 Ga0209981_1029673
675 Ga0209984_1000521
676 Ga0210000_1000389
677 Ga0209995_1003132
678 Ga0209968_1039006
679 Ga0209999_1002198
680 Ga0209982_1004730
681 Ga0209983_1021057
682 Ga0209588_1035161
683 Ga0209971_1003755
684 Ga0209974_10003629
685 Ga0268266_10096634
686 Ga0268266_10436171
687 Ga0268265_10054922
688 Ga0268265_10118864
689 Ga0268265_10956331
690 Ga0268264_10039884
691 Ga0268264_10095266
692 Ga0307416_100933992
693 Ga0307416_101600097
694 Ga0373951_0098785
695 Ga0373961_0138387
696 Ga0373947_1157878
697 Ga0373937_0667694
698 Ga0316584_0444498
699 Ga0316584_0561258
700 Ga0395899_0066446
701 Ga0395900_0009454
702 Ga0395900_0911349
703 Ga0436364_1428870
704 Ga0395901_0008713
705 Ga0451849_0024246
706 Ga0439464_0032846
707 Ga0451577_0265340
708 Ga0453684_0513787
709 Ga0451576_0827952
710 Ga0451576_2043257
711 Ga0495592_0299077
712 Ga0495628_0223968
713 Ga0495628_0323354
714 Ga0495652_0051226
715 Ga0495621_0046715
716 Ga0495599_0054083
717 Ga0495647_0221923
718 Ga0495669_0514187
719 Ga0496104_1019294
720 Ga0501031_0655368
721 Ga0501033_0921929
722 Ga0501038_0083552
723 Ga0501038_0408782
724 Ga0501039_0608034
725 Ga0501039_0704320
726 Ga0501040_0700882
727 Ga0501041_0883052
728 Ga0501041_1066302
729 Ga0501042_1446538
730 Ga0501048_0189809
731 Ga0501072_0145462
732 Ga0501075_0141518
733 Ga0501075_1530060
734 Ga0501076_0012785
735 Ga0501076_0691901
736 Ga0501077_0170399
737 Ga0501081_0050482
738 Ga0501045_1141306
739 nmdc:mga0k408_416671_c1
740 nmdc:mga05p37_118460_c1
741 nmdc:mga05p37_132139_c1
742 nmdc:mga0qj67_145205_c1
743 nmdc:mga06r32_1214329_c1
744 nmdc:mga0n895_10546_c1
745 nmdc:mga0n895_1333409_c1
746 nmdc:mga0n895_151758_c1
747 nmdc:mga0rr50_28290_c1
748 nmdc:mga0rr50_391195_c1
749 nmdc:mga0rr50_535860_c1
750 nmdc:mga0rr50_9927_c1
751 nmdc:mga08x19_1334864_c1
752 nmdc:mga08x19_208704_c1
753 nmdc:mga08x19_278777_c1
754 nmdc:mga0a205_1504803_c1
755 nmdc:mga0a205_164582_c1
756 nmdc:mga0a205_22316_c2
757 nmdc:mga0a205_307974_c1
758 nmdc:mga0a205_342059_c1
759 Ga0495601_0076736
760 Ga0495612_0039277
761 Ga0495595_0177205
762 Ga0495619_0244659
763 Ga0501084_0107732
764 Ga0501084_0471686
765 Ga0501084_0689165
766 Ga0501082_0109308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

3

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wb4-assembly1.cif.gz_B activated diguanylate cyclase pled in complex with c-di-gmp 0.9764 2 120
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.9722 2 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9685 1 120
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.968 1 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9677 1 120
ID Description Score Start End Superfamily
2wb4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9764 2 120 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9674 2 125 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9653 2 82 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9593 1 82 3.40.50.2300
4qpjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9592 1 119 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0B4X0T7-F1-model_v4 Response regulator CheY-like domain-containing protein 1 1 118 GO:0000160
AF-K9SVB3-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.994 2 124 GO:0000155
GO:0005524
GO:0005886
GO:0009927
AF-A0A4V0XUN7-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9923 2 118 GO:0000155
GO:0005524
GO:0005886
GO:0009927
AF-A0A3S1B4Z3-F1-model_v4 Response regulator 0.9921 2 119 GO:0000155
GO:0006355
AF-A0A1Z4MZQ1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9918 2 121 GO:0000155
GO:0005524
GO:0005886
GO:0009927

Map