F430042

General Info

Members Datasets Scaffolds Average Seq Length
384 205 384 213

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_90253_c1|nmdc:mga0qj67_90253_c1_973_1752
Length 259
Sequence VQSSRPEEPTDLALFAASFVSEGDGVEVNETSERVMTKISTLGAAFAFAALIFTNSGAAVASEQTDLLDRSARTIEHMKVDPAFERARSMMKDAKAVVVFPSLIKGGFIFGAEGGNGVMMGNNAGMWSDPVFYTMGSASFGLQAGLEQTEVVMLVMSDRALQALTRAEFKFGADAGLTLVSLSAGAGAATSPNLTGDIIIWTSGKGLYGGLTLNGSVVKARDEWNTAFYGRPAPIGDILASRIRAPGPNPIRQQLSALR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
203 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 1.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 1.56
Rhizosphere 94.01
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000392 3300003215 Bacteria 29639
2 Ga0058863_11528203 3300004799 Bacteria 702
3 Ga0058862_12265246 3300004803 Bacteria 1518
4 Ga0070658_10003001 3300005327 Bacteria 13962
5 Ga0070658_10030413 3300005327 Bacteria 4338
6 Ga0070658_10130946 3300005327 Bacteria 2090
7 Ga0070658_10359557 3300005327 Bacteria 1247
8 Ga0070676_10035943 3300005328 Bacteria 2852
9 Ga0070683_100078487 3300005329 Bacteria 3089
10 Ga0070683_100121557 3300005329 Unclassified 2467
11 Ga0070670_100431648 3300005331 Unclassified 1166
12 Ga0070670_100822105 3300005331 Bacteria 840
13 Ga0070666_10038783 3300005335 Bacteria 3171
14 Ga0070666_10042041 3300005335 Bacteria 3056
15 Ga0070680_100000073 3300005336 Bacteria 53790
16 Ga0070680_100708016 3300005336 Unclassified 867
17 Ga0068868_100063257 3300005338 Bacteria 2935
18 Ga0068868_100401867 3300005338 Bacteria 1182
19 Ga0070660_100019424 3300005339 Bacteria 4980
20 Ga0070660_100076692 3300005339 Bacteria 2618
21 Ga0070660_100168059 3300005339 Unclassified 1770
22 Ga0070691_10000338 3300005341 Bacteria 16631
23 Ga0070691_10201442 3300005341 Bacteria 1046
24 Ga0070661_100110575 3300005344 Bacteria 2051
25 Ga0070661_100667392 3300005344 Bacteria 845
26 Ga0070661_100684139 3300005344 Bacteria 835
27 Ga0070673_100182772 3300005364 Bacteria 1796
28 Ga0070673_100938422 3300005364 Unclassified 804
29 Ga0070667_100048176 3300005367 Bacteria 3586
30 Ga0070667_100052581 3300005367 Bacteria 3437
31 Ga0070709_10056111 3300005434 Unclassified 2490
32 Ga0070709_10455203 3300005434 Bacteria 965
33 Ga0070714_100048701 3300005435 Bacteria 3605
34 Ga0070714_100540833 3300005435 Unclassified 1114
35 Ga0070713_100000137 3300005436 Bacteria 48167
36 Ga0070713_100199796 3300005436 Bacteria 1805
37 Ga0070713_101221727 3300005436 Bacteria 728
38 Ga0070710_10100056 3300005437 Bacteria 1725
39 Ga0070705_100302087 3300005440 Bacteria 1147
40 Ga0070678_100032153 3300005456 Bacteria 3629
41 Ga0070678_100035950 3300005456 Bacteria 3464
42 Ga0070678_100152751 3300005456 Bacteria 1862
43 Ga0070662_100621114 3300005457 Bacteria 910
44 Ga0070681_10002014 3300005458 Bacteria 18391
45 Ga0070681_10093862 3300005458 Bacteria 2949
46 Ga0068867_100006553 3300005459 Bacteria 8225
47 Ga0068867_100073547 3300005459 Bacteria 2559
48 Ga0068867_100382175 3300005459 Bacteria 1183
49 Ga0068867_100391554 3300005459 Unclassified 1170
50 Ga0070685_10410777 3300005466 Unclassified 939
51 Ga0070679_100001893 3300005530 Bacteria 18797
52 Ga0070679_100012282 3300005530 Bacteria 8182
53 Ga0070679_100257323 3300005530 Bacteria 1701
54 Ga0070684_100130623 3300005535 Bacteria 2266
55 Ga0070684_100154032 3300005535 Bacteria 2083
56 Ga0068853_100001989 3300005539 Bacteria 15087
57 Ga0068853_100154238 3300005539 Bacteria 2069
58 Ga0070672_100285326 3300005543 Bacteria 1397
59 Ga0070672_100402981 3300005543 Bacteria 1173
60 Ga0070672_100430027 3300005543 Bacteria 1135
61 Ga0070695_100064880 3300005545 Bacteria 2376
62 Ga0070693_100011457 3300005547 Bacteria 4466
63 Ga0070693_100052026 3300005547 Bacteria 2347
64 Ga0070693_100603314 3300005547 Bacteria 793
65 Ga0070665_100001230 3300005548 Bacteria 31100
66 Ga0070665_100061764 3300005548 Bacteria 3756
67 Ga0070665_100062355 3300005548 Bacteria 3738
68 Ga0070665_100115139 3300005548 Bacteria 2691
69 Ga0070665_100243402 3300005548 Unclassified 1799
70 Ga0070665_100286228 3300005548 Bacteria 1650
71 Ga0070665_100762091 3300005548 Bacteria 981
72 Ga0068855_100000114 3300005563 Bacteria 100372
73 Ga0068855_100077789 3300005563 Bacteria 3849
74 Ga0068855_100144588 3300005563 Bacteria 2708
75 Ga0070664_100488191 3300005564 Bacteria 1134
76 Ga0068857_100002401 3300005577 Bacteria 15272
77 Ga0068857_100144817 3300005577 Unclassified 2150
78 Ga0068854_100016359 3300005578 Bacteria 4944
79 Ga0068856_100005644 3300005614 Bacteria 12313
80 Ga0068856_100009246 3300005614 Bacteria 9579
81 Ga0068856_100134164 3300005614 Bacteria 2481
82 Ga0068852_100217032 3300005616 Bacteria 1817
83 Ga0068864_100082589 3300005618 Bacteria 2820
84 Ga0068864_100097066 3300005618 Bacteria 2609
85 Ga0068864_100326829 3300005618 Bacteria 1441
86 Ga0068866_10006371 3300005718 Bacteria 4914
87 Ga0068851_10093072 3300005834 Bacteria 1589
88 Ga0068863_100316507 3300005841 Bacteria 1515
89 Ga0068858_100011268 3300005842 Bacteria 8449
90 Ga0068858_100070774 3300005842 Bacteria 3233
91 Ga0068858_100900179 3300005842 Bacteria 865
92 Ga0068860_100107469 3300005843 Bacteria 2666
93 Ga0068860_100224253 3300005843 Bacteria 1825
94 Ga0070712_100000282 3300006175 Bacteria 28632
95 Ga0070712_100000367 3300006175 Bacteria 25540
96 Ga0097621_100000399 3300006237 Bacteria 30221
97 Ga0097621_100042607 3300006237 Bacteria 3657
98 Ga0097621_100072847 3300006237 Bacteria 2842
99 Ga0097621_100117797 3300006237 Bacteria 2251
100 Ga0097621_100130518 3300006237 Bacteria 2139
101 Ga0097621_100783126 3300006237 Unclassified 883
102 Ga0068871_100000342 3300006358 Bacteria 32312
103 Ga0068871_100028854 3300006358 Unclassified 4354
104 Ga0068871_100032974 3300006358 Bacteria 4096
105 Ga0068871_100765024 3300006358 Bacteria 889
106 Ga0075430_100187912 3300006846 Bacteria 1717
107 Ga0075431_100171175 3300006847 Unclassified 2231
108 Ga0075431_100176739 3300006847 Unclassified 2192
109 Ga0075434_100053395 3300006871 Bacteria 4016
110 Ga0068865_100034172 3300006881 Bacteria 3410
111 Ga0075436_100001761 3300006914 Bacteria 14823
112 Ga0075435_100667065 3300007076 Bacteria 903
113 Ga0105240_10005397 3300009093 Bacteria 19057
114 Ga0105240_10018204 3300009093 Bacteria 9443
115 Ga0105240_10063498 3300009093 Bacteria 4594
116 Ga0105240_10640928 3300009093 Bacteria 1166
117 Ga0111539_10088763 3300009094 Bacteria 3633
118 Ga0105245_10020193 3300009098 Bacteria 5839
119 Ga0105245_10068842 3300009098 Bacteria 3208
120 Ga0105243_10087739 3300009148 Bacteria 2554
121 Ga0105243_10360522 3300009148 Bacteria 1338
122 Ga0105241_10013052 3300009174 Bacteria 6090
123 Ga0105241_10032320 3300009174 Bacteria 3922
124 Ga0105241_10224277 3300009174 Bacteria 1581
125 Ga0105242_10024844 3300009176 Bacteria 4735
126 Ga0105248_10000009 3300009177 Bacteria 403549
127 Ga0105248_10024041 3300009177 Bacteria 6772
128 Ga0105248_10372822 3300009177 Bacteria 1607
129 Ga0105248_10439128 3300009177 Bacteria 1470
130 Ga0105248_11005953 3300009177 Bacteria 942
131 Ga0105237_10051033 3300009545 Bacteria 4157
132 Ga0105237_10064993 3300009545 Bacteria 3644
133 Ga0105237_10239474 3300009545 Bacteria 1816
134 Ga0105237_10419520 3300009545 Unclassified 1343
135 Ga0105238_10007332 3300009551 Bacteria 11043
136 Ga0105238_10032087 3300009551 Bacteria 5345
137 Ga0105238_10123090 3300009551 Bacteria 2573
138 Ga0105238_10147069 3300009551 Bacteria 2332
139 Ga0105238_10163121 3300009551 Bacteria 2205
140 Ga0105238_10380033 3300009551 Unclassified 1404
141 Ga0105238_10661413 3300009551 Bacteria 1055
142 Ga0105249_10050304 3300009553 Bacteria 3800
143 Ga0105239_10010265 3300010375 Bacteria 10488
144 Ga0105239_10017326 3300010375 Bacteria 7968
145 Ga0105239_10028074 3300010375 Bacteria 6192
146 Ga0105239_10138829 3300010375 Bacteria 2707
147 Ga0105239_10223699 3300010375 Bacteria 2111
148 Ga0105239_10518224 3300010375 Bacteria 1356
149 Ga0105239_10938217 3300010375 Unclassified 994
150 Ga0105246_10002746 3300011119 Bacteria 10650
151 Ga0105246_10021369 3300011119 Bacteria 4165
152 Ga0157373_10029398 3300013100 Bacteria 3958
153 Ga0157370_10022617 3300013104 Bacteria 6255
154 Ga0157370_10023368 3300013104 Bacteria 6139
155 Ga0157370_10540969 3300013104 Bacteria 1068
156 Ga0157369_10020655 3300013105 Bacteria 7365
157 Ga0157369_10052461 3300013105 Bacteria 4412
158 Ga0157374_10139531 3300013296 Bacteria 2352
159 Ga0157374_10243434 3300013296 Bacteria 1769
160 Ga0157374_10285150 3300013296 Unclassified 1631
161 Ga0157374_11091335 3300013296 Unclassified 818
162 Ga0157378_10153178 3300013297 Bacteria 2149
163 Ga0157378_10432896 3300013297 Bacteria 1302
164 Ga0163162_10026231 3300013306 Bacteria 5759
165 Ga0163162_10106284 3300013306 Bacteria 2902
166 Ga0163162_10161974 3300013306 Bacteria 2359
167 Ga0163162_10245402 3300013306 Bacteria 1922
168 Ga0163162_10413831 3300013306 Bacteria 1480
169 Ga0157372_10013351 3300013307 Bacteria 8770
170 Ga0157372_10131559 3300013307 Bacteria 2879
171 Ga0157375_10143703 3300013308 Bacteria 2515
172 Ga0157375_10291306 3300013308 Bacteria 1795
173 Ga0163163_10000004 3300014325 Bacteria 416569
174 Ga0163163_10037663 3300014325 Bacteria 4706
175 Ga0163163_10105362 3300014325 Bacteria 2845
176 Ga0163163_10124980 3300014325 Bacteria 2609
177 Ga0182008_10242906 3300014497 Bacteria 927
178 Ga0157379_10002839 3300014968 Bacteria 14608
179 Ga0157379_10003675 3300014968 Bacteria 13040
180 Ga0157379_10544142 3300014968 Bacteria 1080
181 Ga0157376_10183000 3300014969 Unclassified 1917
182 Ga0157376_10194487 3300014969 Bacteria 1862
183 Ga0163161_10044984 3300017792 Bacteria 3181
184 Ga0206356_10640465 3300020070 Bacteria 690
185 Ga0206356_11665914 3300020070 Bacteria 1505
186 Ga0209455_1012057 3300025272 Bacteria 2089
187 Ga0209758_1000008 3300025297 Bacteria 1215263
188 Ga0207692_10021408 3300025898 Unclassified 2958
189 Ga0207680_10022107 3300025903 Bacteria 3454
190 Ga0207699_10026035 3300025906 Bacteria 3219
191 Ga0207699_10133644 3300025906 Bacteria 1622
192 Ga0207705_10001678 3300025909 Bacteria 17625
193 Ga0207654_10033675 3300025911 Bacteria 2842
194 Ga0207654_10056069 3300025911 Bacteria 2284
195 Ga0207707_10000002 3300025912 Bacteria 1142054
196 Ga0207707_10053954 3300025912 Bacteria 3499
197 Ga0207695_10000004 3300025913 Bacteria 1288665
198 Ga0207695_10052987 3300025913 Bacteria 4247
199 Ga0207695_10238138 3300025913 Bacteria 1722
200 Ga0207695_10262788 3300025913 Unclassified 1623
201 Ga0207695_10443790 3300025913 Bacteria 1181
202 Ga0207695_10683439 3300025913 Unclassified 907
203 Ga0207695_10767295 3300025913 Unclassified 844
204 Ga0207671_10027600 3300025914 Bacteria 4244
205 Ga0207671_10105529 3300025914 Bacteria 2138
206 Ga0207671_10441881 3300025914 Unclassified 1036
207 Ga0207693_10002178 3300025915 Bacteria 17072
208 Ga0207693_10070882 3300025915 Bacteria 2727
209 Ga0207663_10338335 3300025916 Bacteria 1136
210 Ga0207660_10000069 3300025917 Bacteria 53883
211 Ga0207657_10010134 3300025919 Bacteria 9418
212 Ga0207657_10106556 3300025919 Bacteria 2319
213 Ga0207657_10209309 3300025919 Unclassified 1566
214 Ga0207649_10081516 3300025920 Bacteria 2095
215 Ga0207652_10000299 3300025921 Bacteria 51311
216 Ga0207652_10043269 3300025921 Bacteria 3835
217 Ga0207694_10000015 3300025924 Bacteria 363898
218 Ga0207694_10009780 3300025924 Bacteria 7237
219 Ga0207694_10083784 3300025924 Bacteria 2507
220 Ga0207650_10535963 3300025925 Unclassified 981
221 Ga0207687_10009821 3300025927 Bacteria 6265
222 Ga0207700_10000005 3300025928 Bacteria 394836
223 Ga0207700_10025405 3300025928 Bacteria 4112
224 Ga0207664_10028210 3300025929 Bacteria 4264
225 Ga0207706_10426426 3300025933 Unclassified 1149
226 Ga0207686_10013362 3300025934 Bacteria 4541
227 Ga0207686_10073371 3300025934 Bacteria 2208
228 Ga0207709_10045521 3300025935 Bacteria 2658
229 Ga0207669_10402406 3300025937 Bacteria 1073
230 Ga0207704_10036509 3300025938 Bacteria 2828
231 Ga0207704_10060774 3300025938 Bacteria 2340
232 Ga0207704_10072894 3300025938 Bacteria 2185
233 Ga0207691_10570740 3300025940 Bacteria 959
234 Ga0207711_10000003 3300025941 Bacteria 1042791
235 Ga0207711_10000005 3300025941 Bacteria 822972
236 Ga0207711_10000009 3300025941 Bacteria 580864
237 Ga0207711_10000015 3300025941 Bacteria 494097
238 Ga0207711_10023756 3300025941 Bacteria 5132
239 Ga0207711_10697180 3300025941 Unclassified 947
240 Ga0207711_10717518 3300025941 Bacteria 932
241 Ga0207689_10005907 3300025942 Bacteria 10840
242 Ga0207689_10347217 3300025942 Bacteria 1233
243 Ga0207689_10437585 3300025942 Bacteria 1092
244 Ga0207661_10268353 3300025944 Unclassified 1522
245 Ga0207667_10000012 3300025949 Bacteria 445492
246 Ga0207667_10034588 3300025949 Bacteria 5425
247 Ga0207667_10217169 3300025949 Bacteria 1959
248 Ga0207651_10173962 3300025960 Bacteria 1701
249 Ga0207668_10118300 3300025972 Bacteria 2002
250 Ga0207658_10052818 3300025986 Bacteria 3000
251 Ga0207677_10927621 3300026023 Bacteria 786
252 Ga0207703_10008159 3300026035 Bacteria 8276
253 Ga0207703_10079832 3300026035 Bacteria 2724
254 Ga0207703_10678893 3300026035 Bacteria 979
255 Ga0207639_10000626 3300026041 Bacteria 24369
256 Ga0207639_10013738 3300026041 Bacteria 5678
257 Ga0207702_10000055 3300026078 Bacteria 136325
258 Ga0207702_10000102 3300026078 Bacteria 99313
259 Ga0207702_10021429 3300026078 Bacteria 5351
260 Ga0207702_10463115 3300026078 Bacteria 1232
261 Ga0207641_10064050 3300026088 Bacteria 3141
262 Ga0207648_10022993 3300026089 Bacteria 5590
263 Ga0207648_10090871 3300026089 Bacteria 2668
264 Ga0207648_10383962 3300026089 Bacteria 1270
265 Ga0207648_10387661 3300026089 Bacteria 1264
266 Ga0207676_10246088 3300026095 Unclassified 1607
267 Ga0207674_10001979 3300026116 Bacteria 25949
268 Ga0207675_100035489 3300026118 Unclassified 4651
269 Ga0207675_100158201 3300026118 Bacteria 2160
270 Ga0207683_10052147 3300026121 Bacteria 3584
271 Ga0207683_10169009 3300026121 Bacteria 1980
272 Ga0207683_10209888 3300026121 Bacteria 1772
273 Ga0207698_10011198 3300026142 Bacteria 5804
274 Ga0207428_10050127 3300027907 Bacteria 3341
275 Ga0268266_10000930 3300028379 Bacteria 37406
276 Ga0268266_10016983 3300028379 Bacteria 6217
277 Ga0268266_10071806 3300028379 Bacteria 3000
278 Ga0268266_10152568 3300028379 Bacteria 2084
279 Ga0268266_10664240 3300028379 Bacteria 1003
280 Ga0268265_10228141 3300028380 Unclassified 1635
281 Ga0268264_10126091 3300028381 Bacteria 2262
282 Ga0307517_10190349 3300028786 Unclassified 1304
283 Ga0265338_10129054 3300028800 Bacteria 2000
284 Ga0265332_10011304 3300031238 Bacteria 3970
285 Ga0265328_10171043 3300031239 Bacteria 821
286 Ga0265320_10001345 3300031240 Bacteria 17924
287 Ga0265325_10036190 3300031241 Bacteria 2617
288 Ga0265340_10068995 3300031247 Unclassified 1678
289 Ga0265340_10201651 3300031247 Bacteria 895
290 Ga0265339_10020160 3300031249 Bacteria 3899
291 Ga0265316_10126364 3300031344 Bacteria 1928
292 Ga0265316_10543632 3300031344 Bacteria 827
293 Ga0265313_10075939 3300031595 Bacteria 1537
294 Ga0265314_10011857 3300031711 Bacteria 7160
295 Ga0265314_10045758 3300031711 Bacteria 3091
296 Ga0307516_10039412 3300031730 Bacteria 4710
297 Ga0307516_10073693 3300031730 Bacteria 3271
298 Ga0307510_10282415 3300033180 Bacteria 1130
299 Ga0373932_0047251 3300035112 Bacteria 1265
300 Ga0373955_0288188 3300035172 Bacteria 989
301 Ga0373931_0160902 3300035691 Bacteria 1316
302 Ga0373937_0002756 3300036401 Bacteria 14659
303 Ga0373937_0083002 3300036401 Bacteria 2965
304 Ga0373937_0200870 3300036401 Unclassified 1874
305 Ga0373925_0222265 3300037068 Bacteria 1508
306 Ga0395899_0239189 3300037312 Bacteria 1250
307 Ga0395898_0039400 3300037466 Bacteria 4677
308 Ga0395901_0264172 3300038443 Bacteria 1791
309 Ga0436365_0019186 3300039437 Bacteria 728
310 Ga0436361_0072873 3300039447 Plasmid 3357
311 Ga0436362_0467777 3300039453 Bacteria 713
312 Ga0436362_1074859 3300039453 Bacteria 1663
313 Ga0466963_0407232 3300044694 Bacteria 959
314 Ga0495592_0475013 3300046454 Bacteria 780
315 Ga0495629_0206118 3300046459 Bacteria 1359
316 Ga0495650_0123721 3300046471 Bacteria 950
317 Ga0495630_0823583 3300046517 Bacteria 708
318 Ga0495621_0037832 3300046539 Bacteria 1680
319 Ga0495622_0000443 3300046557 Bacteria 26751
320 Ga0495671_0187182 3300046692 Bacteria 1005
321 Ga0495589_0201225 3300046794 Bacteria 940
322 Ga0495672_0167496 3300047320 Bacteria 1124
323 Ga0496102_0067051 3300048905 Bacteria 3291
324 Ga0496106_0234752 3300048909 Bacteria 1465
325 Ga0496107_0543879 3300048910 Bacteria 860
326 Ga0496107_0710401 3300048910 Bacteria 739
327 Ga0496110_0560414 3300048913 Bacteria 1038
328 Ga0496115_0275418 3300048918 Unclassified 1382
329 Ga0496121_0000323 3300048924 Bacteria 100188
330 Ga0496126_0001155 3300048929 Bacteria 43745
331 Ga0495682_0005706 3300049460 Bacteria 5139
332 Ga0501032_0095538 3300049569 Unclassified 1970
333 Ga0501032_0261491 3300049569 Bacteria 1122
334 Ga0501033_0020120 3300049570 Bacteria 5045
335 Ga0501034_0030128 3300049571 Bacteria 5515
336 Ga0501034_0063075 3300049571 Bacteria 3720
337 Ga0501036_0073042 3300049572 Bacteria 2900
338 Ga0501036_0542116 3300049572 Bacteria 967
339 Ga0501037_0060359 3300049573 Bacteria 2766
340 Ga0501038_0065405 3300049574 Bacteria 3098
341 Ga0501038_0133224 3300049574 Bacteria 2038
342 Ga0501039_0478432 3300049575 Unclassified 978
343 Ga0501043_0028020 3300049579 Bacteria 4421
344 Ga0501046_0044490 3300049580 Bacteria 3531
345 Ga0501046_0620470 3300049580 Bacteria 766
346 Ga0501047_0013932 3300049581 Bacteria 7639
347 Ga0501047_0016901 3300049581 Bacteria 6973
348 Ga0501047_0055688 3300049581 Bacteria 3824
349 Ga0501048_0049576 3300049582 Bacteria 2992
350 Ga0501067_0000836 3300049583 Bacteria 16565
351 Ga0501067_0017210 3300049583 Bacteria 3995
352 Ga0501069_0002067 3300049585 Bacteria 10095
353 Ga0501070_0143346 3300049586 Bacteria 1972
354 Ga0501072_0004616 3300049588 Bacteria 10488
355 Ga0501073_0013332 3300049589 Bacteria 5983
356 Ga0501073_0017369 3300049589 Bacteria 5212
357 Ga0501073_0032040 3300049589 Bacteria 3749
358 Ga0501074_0068114 3300049590 Unclassified 2558
359 Ga0501079_0002782 3300049741 Bacteria 12759
360 Ga0501079_0220610 3300049741 Bacteria 1481
361 Ga0501080_0015870 3300049742 Bacteria 6948
362 Ga0501080_0017860 3300049742 Bacteria 6565
363 Ga0501035_0011275 3300049822 Bacteria 8282
364 Ga0501035_0094667 3300049822 Unclassified 2626
365 Ga0501035_0464749 3300049822 Bacteria 1045
366 Ga0501044_0038482 3300049823 Bacteria 4994
367 Ga0501044_0194248 3300049823 Unclassified 1990
368 nmdc:mga0qj67_90253_c1 3300050509 Bacteria 2461
369 nmdc:mga06r32_577266_c1 3300050510 Unclassified 1097
370 nmdc:mga08y16_79019_c1 3300050511 Bacteria 3429
371 nmdc:mga0n895_22271_c1 3300050512 Bacteria 5940
372 nmdc:mga0rr50_246296_c1 3300050513 Bacteria 1483
373 nmdc:mga08x19_51_c1 3300050514 Bacteria 124093
374 Ga0500595_000371 3300053119 Bacteria 28943
375 Ga0500595_014934 3300053119 Unclassified 2931
376 Ga0500642_0162625 3300053130 Bacteria 1046
377 Ga0500655_000800 3300053133 Bacteria 6176
378 Ga0500573_0000060 3300053140 Bacteria 68257
379 Ga0500619_034512 3300053154 Bacteria 1563
380 Ga0500639_189110 3300053163 Bacteria 899
381 Ga0501084_0000096 3300054114 Bacteria 65139
382 Ga0501084_0026178 3300054114 Bacteria 4865
383 Ga0501084_0138770 3300054114 Bacteria 2047
384 Ga0501082_0049894 3300060353 Bacteria 3609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10017326 Ga0105239_1001732610 174
2 3300049571 Ga0501034_0063075 Ga0501034_0063075_486_1154 180
3 3300049581 Ga0501047_0013932 Ga0501047_0013932_6321_6989 180
4 3300049583 Ga0501067_0017210 Ga0501067_0017210_2497_3165 180
5 3300049586 Ga0501070_0143346 Ga0501070_0143346_355_1023 180
6 3300049588 Ga0501072_0004616 Ga0501072_0004616_7761_8429 180
7 3300049589 Ga0501073_0013332 Ga0501073_0013332_3611_4279 180
8 3300049741 Ga0501079_0220610 Ga0501079_0220610_791_1459 180
9 3300005435 Ga0070714_100048701 Ga0070714_1000487013 184
10 3300005436 Ga0070713_100000137 Ga0070713_10000013714 184
11 3300005440 Ga0070705_100302087 Ga0070705_1003020871 184
12 3300005614 Ga0068856_100005644 Ga0068856_1000056446 184
13 3300005618 Ga0068864_100082589 Ga0068864_1000825892 184
14 3300006175 Ga0070712_100000282 Ga0070712_1000002823 184
15 3300006871 Ga0075434_100053395 Ga0075434_1000533956 184
16 3300006914 Ga0075436_100001761 Ga0075436_10000176113 184
17 3300007076 Ga0075435_100667065 Ga0075435_1006670652 184
18 3300009551 Ga0105238_10661413 Ga0105238_106614132 184
19 3300025898 Ga0207692_10021408 Ga0207692_100214084 184
20 3300025915 Ga0207693_10070882 Ga0207693_100708823 184
21 3300025928 Ga0207700_10000005 Ga0207700_10000005320 184
22 3300025929 Ga0207664_10028210 Ga0207664_100282103 184
23 3300026078 Ga0207702_10000055 Ga0207702_10000055113 184
24 3300026078 Ga0207702_10000102 Ga0207702_100001027 184
25 3300026095 Ga0207676_10246088 Ga0207676_102460882 184
26 3300050513 nmdc:mga0rr50_246296_c1 nmdc:mga0rr50_246296_c1_601_1269 184
27 3300048905 Ga0496102_0067051 Ga0496102_0067051_1903_2607 185
28 3300048909 Ga0496106_0234752 Ga0496106_0234752_293_997 185
29 3300048913 Ga0496110_0560414 Ga0496110_0560414_64_768 185
30 3300048918 Ga0496115_0275418 Ga0496115_0275418_76_819 185
31 3300050512 nmdc:mga0n895_22271_c1 nmdc:mga0n895_22271_c1_4906_5610 185
32 3300050514 nmdc:mga08x19_51_c1 nmdc:mga08x19_51_c1_114812_115516 185
33 3300005456 Ga0070678_100032153 Ga0070678_1000321534 188
34 3300005564 Ga0070664_100488191 Ga0070664_1004881912 188
35 3300006237 Ga0097621_100117797 Ga0097621_1001177971 188
36 3300006237 Ga0097621_100130518 Ga0097621_1001305183 188
37 3300009098 Ga0105245_10068842 Ga0105245_100688423 188
38 3300011119 Ga0105246_10021369 Ga0105246_100213692 188
39 3300013296 Ga0157374_10243434 Ga0157374_102434341 188
40 3300013297 Ga0157378_10432896 Ga0157378_104328962 188
41 3300036401 Ga0373937_0200870 Ga0373937_0200870_921_1583 190
42 3300049569 Ga0501032_0095538 Ga0501032_0095538_627_1295 190
43 3300049571 Ga0501034_0030128 Ga0501034_0030128_2613_3281 190
44 3300049572 Ga0501036_0073042 Ga0501036_0073042_78_746 190
45 3300049581 Ga0501047_0016901 Ga0501047_0016901_4070_4738 190
46 3300049582 Ga0501048_0049576 Ga0501048_0049576_1512_2180 190
47 3300049583 Ga0501067_0000836 Ga0501067_0000836_7427_8095 190
48 3300049585 Ga0501069_0002067 Ga0501069_0002067_8268_8936 190
49 3300049589 Ga0501073_0032040 Ga0501073_0032040_444_1112 190
50 3300049590 Ga0501074_0068114 Ga0501074_0068114_1281_1949 190
51 3300049741 Ga0501079_0002782 Ga0501079_0002782_8619_9287 190
52 3300049742 Ga0501080_0017860 Ga0501080_0017860_1828_2496 190
53 3300049822 Ga0501035_0011275 Ga0501035_0011275_7292_7960 190
54 3300049823 Ga0501044_0194248 Ga0501044_0194248_1147_1815 190
55 3300054114 Ga0501084_0026178 Ga0501084_0026178_2839_3507 190
56 3300025913 Ga0207695_10443790 Ga0207695_104437901 193
57 3300005327 Ga0070658_10030413 Ga0070658_100304133 195
58 3300005335 Ga0070666_10038783 Ga0070666_100387834 195
59 3300005339 Ga0070660_100076692 Ga0070660_1000766923 195
60 3300005539 Ga0068853_100154238 Ga0068853_1001542383 195
61 3300005543 Ga0070672_100430027 Ga0070672_1004300273 195
62 3300005548 Ga0070665_100062355 Ga0070665_1000623553 195
63 3300009177 Ga0105248_11005953 Ga0105248_110059532 195
64 3300009551 Ga0105238_10380033 Ga0105238_103800333 195
65 3300013296 Ga0157374_10139531 Ga0157374_101395312 195
66 3300013296 Ga0157374_11091335 Ga0157374_110913352 195
67 3300014969 Ga0157376_10183000 Ga0157376_101830001 195
68 3300025903 Ga0207680_10022107 Ga0207680_100221073 195
69 3300025919 Ga0207657_10010134 Ga0207657_100101343 195
70 3300025934 Ga0207686_10073371 Ga0207686_100733713 195
71 3300025941 Ga0207711_10717518 Ga0207711_107175181 195
72 3300028379 Ga0268266_10071806 Ga0268266_100718064 195
73 3300046454 Ga0495592_0475013 Ga0495592_0475013_69_695 195
74 3300046459 Ga0495629_0206118 Ga0495629_0206118_217_843 195
75 3300046517 Ga0495630_0823583 Ga0495630_0823583_10_636 195
76 3300046557 Ga0495622_0000443 Ga0495622_0000443_21934_22560 195
77 3300048910 Ga0496107_0710401 Ga0496107_0710401_99_725 195
78 3300053119 Ga0500595_014934 Ga0500595_014934_452_1078 195
79 3300005842 Ga0068858_100011268 Ga0068858_10001126810 196
80 3300006847 Ga0075431_100171175 Ga0075431_1001711754 196
81 3300009545 Ga0105237_10419520 Ga0105237_104195202 196
82 3300010375 Ga0105239_10010265 Ga0105239_100102659 196
83 3300014968 Ga0157379_10002839 Ga0157379_1000283916 196
84 3300026035 Ga0207703_10008159 Ga0207703_100081593 196
85 3300048924 Ga0496121_0000323 Ga0496121_0000323_12957_13583 196
86 3300050510 nmdc:mga06r32_577266_c1 nmdc:mga06r32_577266_c1_400_1047 196
87 3300005842 Ga0068858_100900179 Ga0068858_1009001791 197
88 3300013306 Ga0163162_10106284 Ga0163162_101062842 197
89 3300014325 Ga0163163_10000004 Ga0163163_10000004274 197
90 3300026035 Ga0207703_10678893 Ga0207703_106788931 197
91 3300005437 Ga0070710_10100056 Ga0070710_101000563 198
92 3300014968 Ga0157379_10544142 Ga0157379_105441423 198
93 3300031239 Ga0265328_10171043 Ga0265328_101710431 198
94 3300039453 Ga0436362_0467777 Ga0436362_0467777_59_682 198
95 3300005435 Ga0070714_100540833 Ga0070714_1005408332 199
96 3300006237 Ga0097621_100783126 Ga0097621_1007831261 199
97 3300009093 Ga0105240_10640928 Ga0105240_106409282 199
98 3300014969 Ga0157376_10194487 Ga0157376_101944873 199
99 3300028379 Ga0268266_10016983 Ga0268266_100169834 199
100 3300005329 Ga0070683_100078487 Ga0070683_1000784872 200
101 3300005344 Ga0070661_100667392 Ga0070661_1006673921 200
102 3300005535 Ga0070684_100130623 Ga0070684_1001306231 200
103 3300005563 Ga0068855_100144588 Ga0068855_1001445882 200
104 3300013104 Ga0157370_10540969 Ga0157370_105409691 200
105 3300025913 Ga0207695_10683439 Ga0207695_106834391 200
106 3300025914 Ga0207671_10441881 Ga0207671_104418812 200
107 3300025944 Ga0207661_10268353 Ga0207661_102683532 200
108 3300025949 Ga0207667_10217169 Ga0207667_102171693 200
109 3300026078 Ga0207702_10463115 Ga0207702_104631152 200
110 3300053163 Ga0500639_189110 Ga0500639_189110_212_838 201
111 3300031730 Ga0307516_10039412 Ga0307516_100394123 202
112 3300035112 Ga0373932_0047251 Ga0373932_0047251_526_1200 203
113 3300035691 Ga0373931_0160902 Ga0373931_0160902_126_800 203
114 3300026121 Ga0207683_10209888 Ga0207683_102098881 204
115 3300039447 Ga0436361_0072873 Ga0436361_0072873_544_1221 204
116 3300046539 Ga0495621_0037832 Ga0495621_0037832_843_1481 204
117 3300005339 Ga0070660_100168059 Ga0070660_1001680592 205
118 3300005436 Ga0070713_101221727 Ga0070713_1012217271 205
119 3300005459 Ga0068867_100391554 Ga0068867_1003915541 205
120 3300005563 Ga0068855_100000114 Ga0068855_10000011453 205
121 3300005577 Ga0068857_100002401 Ga0068857_10000240123 205
122 3300005578 Ga0068854_100016359 Ga0068854_1000163598 205
123 3300005614 Ga0068856_100009246 Ga0068856_1000092465 205
124 3300006175 Ga0070712_100000367 Ga0070712_10000036722 205
125 3300009093 Ga0105240_10005397 Ga0105240_100053974 205
126 3300009551 Ga0105238_10032087 Ga0105238_100320874 205
127 3300025906 Ga0207699_10026035 Ga0207699_100260354 205
128 3300025906 Ga0207699_10133644 Ga0207699_101336443 205
129 3300025913 Ga0207695_10000004 Ga0207695_10000004249 205
130 3300025913 Ga0207695_10052987 Ga0207695_100529876 205
131 3300025914 Ga0207671_10027600 Ga0207671_100276006 205
132 3300025915 Ga0207693_10002178 Ga0207693_1000217814 205
133 3300025916 Ga0207663_10338335 Ga0207663_103383352 205
134 3300025919 Ga0207657_10209309 Ga0207657_102093091 205
135 3300025924 Ga0207694_10000015 Ga0207694_10000015114 205
136 3300025924 Ga0207694_10009780 Ga0207694_100097808 205
137 3300025949 Ga0207667_10000012 Ga0207667_1000001267 205
138 3300026035 Ga0207703_10079832 Ga0207703_100798322 205
139 3300026041 Ga0207639_10013738 Ga0207639_100137385 205
140 3300026078 Ga0207702_10021429 Ga0207702_100214293 205
141 3300026089 Ga0207648_10383962 Ga0207648_103839622 205
142 3300026116 Ga0207674_10001979 Ga0207674_1000197915 205
143 3300026142 Ga0207698_10011198 Ga0207698_100111985 205
144 3300031238 Ga0265332_10011304 Ga0265332_100113041 205
145 3300031249 Ga0265339_10020160 Ga0265339_100201602 205
146 3300031344 Ga0265316_10126364 Ga0265316_101263643 205
147 3300031711 Ga0265314_10045758 Ga0265314_100457581 205
148 3300037068 Ga0373925_0222265 Ga0373925_0222265_127_789 205
149 3300049460 Ga0495682_0005706 Ga0495682_0005706_4126_4791 205
150 3300049574 Ga0501038_0065405 Ga0501038_0065405_1132_1794 205
151 3300053133 Ga0500655_000800 Ga0500655_000800_4128_4793 205
152 3300054114 Ga0501084_0000096 Ga0501084_0000096_3174_3836 205
153 3300060353 Ga0501082_0049894 Ga0501082_0049894_499_1161 205
154 3300004799 Ga0058863_11528203 Ga0058863_115282031 206
155 3300004803 Ga0058862_12265246 Ga0058862_122652463 206
156 3300005327 Ga0070658_10130946 Ga0070658_101309462 206
157 3300005336 Ga0070680_100000073 Ga0070680_10000007361 206
158 3300005457 Ga0070662_100621114 Ga0070662_1006211141 206
159 3300005458 Ga0070681_10002014 Ga0070681_1000201423 206
160 3300005530 Ga0070679_100001893 Ga0070679_10000189319 206
161 3300005548 Ga0070665_100286228 Ga0070665_1002862281 206
162 3300009148 Ga0105243_10360522 Ga0105243_103605222 206
163 3300013308 Ga0157375_10291306 Ga0157375_102913062 206
164 3300020070 Ga0206356_11665914 Ga0206356_116659141 206
165 3300025912 Ga0207707_10000002 Ga0207707_10000002950 206
166 3300025913 Ga0207695_10767295 Ga0207695_107672951 206
167 3300025917 Ga0207660_10000069 Ga0207660_1000006961 206
168 3300025921 Ga0207652_10000299 Ga0207652_1000029944 206
169 3300025941 Ga0207711_10000003 Ga0207711_10000003642 206
170 3300025941 Ga0207711_10000005 Ga0207711_10000005492 206
171 3300025941 Ga0207711_10000009 Ga0207711_10000009164 206
172 3300025941 Ga0207711_10000015 Ga0207711_10000015395 206
173 3300026041 Ga0207639_10000626 Ga0207639_1000062627 206
174 3300028379 Ga0268266_10152568 Ga0268266_101525682 206
175 3300031344 Ga0265316_10543632 Ga0265316_105436321 206
176 3300039453 Ga0436362_1074859 Ga0436362_1074859_683_1348 206
177 3300049572 Ga0501036_0542116 Ga0501036_0542116_46_723 206
178 3300049575 Ga0501039_0478432 Ga0501039_0478432_28_705 206
179 3300053140 Ga0500573_0000060 Ga0500573_0000060_59271_59915 206
180 3300054114 Ga0501084_0138770 Ga0501084_0138770_1250_1927 206
181 3300005327 Ga0070658_10003001 Ga0070658_1000300112 207
182 3300005328 Ga0070676_10035943 Ga0070676_100359433 207
183 3300005329 Ga0070683_100121557 Ga0070683_1001215573 207
184 3300005336 Ga0070680_100708016 Ga0070680_1007080161 207
185 3300005339 Ga0070660_100019424 Ga0070660_1000194242 207
186 3300005341 Ga0070691_10000338 Ga0070691_1000033821 207
187 3300005341 Ga0070691_10201442 Ga0070691_102014422 207
188 3300005364 Ga0070673_100182772 Ga0070673_1001827722 207
189 3300005434 Ga0070709_10056111 Ga0070709_100561113 207
190 3300005436 Ga0070713_100199796 Ga0070713_1001997961 207
191 3300005456 Ga0070678_100152751 Ga0070678_1001527512 207
192 3300005458 Ga0070681_10093862 Ga0070681_100938623 207
193 3300005459 Ga0068867_100006553 Ga0068867_1000065534 207
194 3300005530 Ga0070679_100012282 Ga0070679_1000122822 207
195 3300005539 Ga0068853_100001989 Ga0068853_10000198915 207
196 3300005543 Ga0070672_100285326 Ga0070672_1002853262 207
197 3300005545 Ga0070695_100064880 Ga0070695_1000648804 207
198 3300005547 Ga0070693_100011457 Ga0070693_1000114573 207
199 3300005547 Ga0070693_100603314 Ga0070693_1006033141 207
200 3300005548 Ga0070665_100001230 Ga0070665_1000012304 207
201 3300005548 Ga0070665_100762091 Ga0070665_1007620912 207
202 3300005563 Ga0068855_100077789 Ga0068855_1000777893 207
203 3300005841 Ga0068863_100316507 Ga0068863_1003165072 207
204 3300006237 Ga0097621_100000399 Ga0097621_1000003994 207
205 3300006358 Ga0068871_100000342 Ga0068871_1000003425 207
206 3300006846 Ga0075430_100187912 Ga0075430_1001879121 207
207 3300006847 Ga0075431_100176739 Ga0075431_1001767392 207
208 3300009093 Ga0105240_10018204 Ga0105240_100182043 207
209 3300009093 Ga0105240_10063498 Ga0105240_100634984 207
210 3300009094 Ga0111539_10088763 Ga0111539_100887633 207
211 3300009098 Ga0105245_10020193 Ga0105245_100201935 207
212 3300009148 Ga0105243_10087739 Ga0105243_100877393 207
213 3300009174 Ga0105241_10013052 Ga0105241_100130525 207
214 3300009174 Ga0105241_10224277 Ga0105241_102242772 207
215 3300009177 Ga0105248_10024041 Ga0105248_100240417 207
216 3300009545 Ga0105237_10051033 Ga0105237_100510333 207
217 3300009545 Ga0105237_10239474 Ga0105237_102394741 207
218 3300009551 Ga0105238_10007332 Ga0105238_100073325 207
219 3300009551 Ga0105238_10163121 Ga0105238_101631212 207
220 3300009553 Ga0105249_10050304 Ga0105249_100503043 207
221 3300010375 Ga0105239_10028074 Ga0105239_100280746 207
222 3300010375 Ga0105239_10518224 Ga0105239_105182241 207
223 3300010375 Ga0105239_10938217 Ga0105239_109382171 207
224 3300013100 Ga0157373_10029398 Ga0157373_100293983 207
225 3300013104 Ga0157370_10022617 Ga0157370_100226175 207
226 3300013104 Ga0157370_10023368 Ga0157370_100233684 207
227 3300013105 Ga0157369_10020655 Ga0157369_100206555 207
228 3300013297 Ga0157378_10153178 Ga0157378_101531783 207
229 3300013306 Ga0163162_10026231 Ga0163162_100262315 207
230 3300013307 Ga0157372_10013351 Ga0157372_100133519 207
231 3300014325 Ga0163163_10124980 Ga0163163_101249803 207
232 3300014497 Ga0182008_10242906 Ga0182008_102429061 207
233 3300014968 Ga0157379_10003675 Ga0157379_100036755 207
234 3300020070 Ga0206356_10640465 Ga0206356_106404651 207
235 3300025909 Ga0207705_10001678 Ga0207705_1000167813 207
236 3300025912 Ga0207707_10053954 Ga0207707_100539542 207
237 3300025913 Ga0207695_10238138 Ga0207695_102381382 207
238 3300025913 Ga0207695_10262788 Ga0207695_102627882 207
239 3300025914 Ga0207671_10105529 Ga0207671_101055291 207
240 3300025919 Ga0207657_10106556 Ga0207657_101065562 207
241 3300025921 Ga0207652_10043269 Ga0207652_100432692 207
242 3300025924 Ga0207694_10083784 Ga0207694_100837842 207
243 3300025925 Ga0207650_10535963 Ga0207650_105359631 207
244 3300025927 Ga0207687_10009821 Ga0207687_100098215 207
245 3300025928 Ga0207700_10025405 Ga0207700_100254053 207
246 3300025933 Ga0207706_10426426 Ga0207706_104264262 207
247 3300025935 Ga0207709_10045521 Ga0207709_100455213 207
248 3300025938 Ga0207704_10072894 Ga0207704_100728943 207
249 3300025940 Ga0207691_10570740 Ga0207691_105707401 207
250 3300025941 Ga0207711_10023756 Ga0207711_100237564 207
251 3300025942 Ga0207689_10005907 Ga0207689_100059072 207
252 3300025949 Ga0207667_10034588 Ga0207667_100345885 207
253 3300026088 Ga0207641_10064050 Ga0207641_100640501 207
254 3300026089 Ga0207648_10022993 Ga0207648_100229934 207
255 3300026118 Ga0207675_100035489 Ga0207675_1000354895 207
256 3300026118 Ga0207675_100158201 Ga0207675_1001582013 207
257 3300026121 Ga0207683_10169009 Ga0207683_101690092 207
258 3300027907 Ga0207428_10050127 Ga0207428_100501272 207
259 3300028379 Ga0268266_10000930 Ga0268266_100009304 207
260 3300028800 Ga0265338_10129054 Ga0265338_101290543 207
261 3300031240 Ga0265320_10001345 Ga0265320_1000134515 207
262 3300031241 Ga0265325_10036190 Ga0265325_100361903 207
263 3300031247 Ga0265340_10068995 Ga0265340_100689952 207
264 3300031247 Ga0265340_10201651 Ga0265340_102016511 207
265 3300031595 Ga0265313_10075939 Ga0265313_100759393 207
266 3300031711 Ga0265314_10011857 Ga0265314_100118574 207
267 3300035172 Ga0373955_0288188 Ga0373955_0288188_292_957 207
268 3300036401 Ga0373937_0002756 Ga0373937_0002756_4446_5111 207
269 3300036401 Ga0373937_0083002 Ga0373937_0083002_526_1194 207
270 3300037312 Ga0395899_0239189 Ga0395899_0239189_382_1008 207
271 3300037466 Ga0395898_0039400 Ga0395898_0039400_3323_3949 207
272 3300038443 Ga0395901_0264172 Ga0395901_0264172_830_1456 207
273 3300044694 Ga0466963_0407232 Ga0466963_0407232_122_748 207
274 3300048910 Ga0496107_0543879 Ga0496107_0543879_149_814 207
275 3300048929 Ga0496126_0001155 Ga0496126_0001155_25759_26424 207
276 3300049569 Ga0501032_0261491 Ga0501032_0261491_176_802 207
277 3300049570 Ga0501033_0020120 Ga0501033_0020120_2157_2783 207
278 3300049573 Ga0501037_0060359 Ga0501037_0060359_2005_2631 207
279 3300049574 Ga0501038_0133224 Ga0501038_0133224_1302_1928 207
280 3300049579 Ga0501043_0028020 Ga0501043_0028020_1418_2044 207
281 3300049580 Ga0501046_0620470 Ga0501046_0620470_66_692 207
282 3300049589 Ga0501073_0017369 Ga0501073_0017369_1583_2209 207
283 3300049822 Ga0501035_0094667 Ga0501035_0094667_1419_2045 207
284 3300049823 Ga0501044_0038482 Ga0501044_0038482_3364_3990 207
285 3300050511 nmdc:mga08y16_79019_c1 nmdc:mga08y16_79019_c1_992_1666 207
286 3300003215 JGI25153J46596_10000392 JGI25153J46596_1000039227 208
287 3300005327 Ga0070658_10359557 Ga0070658_103595572 208
288 3300005331 Ga0070670_100431648 Ga0070670_1004316481 208
289 3300005331 Ga0070670_100822105 Ga0070670_1008221051 208
290 3300005335 Ga0070666_10042041 Ga0070666_100420412 208
291 3300005338 Ga0068868_100063257 Ga0068868_1000632574 208
292 3300005338 Ga0068868_100401867 Ga0068868_1004018672 208
293 3300005344 Ga0070661_100110575 Ga0070661_1001105753 208
294 3300005344 Ga0070661_100684139 Ga0070661_1006841391 208
295 3300005364 Ga0070673_100938422 Ga0070673_1009384221 208
296 3300005367 Ga0070667_100048176 Ga0070667_1000481763 208
297 3300005367 Ga0070667_100052581 Ga0070667_1000525814 208
298 3300005434 Ga0070709_10455203 Ga0070709_104552031 208
299 3300005456 Ga0070678_100035950 Ga0070678_1000359503 208
300 3300005459 Ga0068867_100073547 Ga0068867_1000735473 208
301 3300005459 Ga0068867_100382175 Ga0068867_1003821752 208
302 3300005466 Ga0070685_10410777 Ga0070685_104107772 208
303 3300005530 Ga0070679_100257323 Ga0070679_1002573232 208
304 3300005535 Ga0070684_100154032 Ga0070684_1001540322 208
305 3300005543 Ga0070672_100402981 Ga0070672_1004029812 208
306 3300005547 Ga0070693_100052026 Ga0070693_1000520263 208
307 3300005548 Ga0070665_100061764 Ga0070665_1000617644 208
308 3300005548 Ga0070665_100115139 Ga0070665_1001151391 208
309 3300005548 Ga0070665_100243402 Ga0070665_1002434023 208
310 3300005577 Ga0068857_100144817 Ga0068857_1001448172 208
311 3300005614 Ga0068856_100134164 Ga0068856_1001341644 208
312 3300005616 Ga0068852_100217032 Ga0068852_1002170323 208
313 3300005618 Ga0068864_100097066 Ga0068864_1000970664 208
314 3300005618 Ga0068864_100326829 Ga0068864_1003268292 208
315 3300005718 Ga0068866_10006371 Ga0068866_100063714 208
316 3300005834 Ga0068851_10093072 Ga0068851_100930722 208
317 3300005842 Ga0068858_100070774 Ga0068858_1000707743 208
318 3300005843 Ga0068860_100107469 Ga0068860_1001074694 208
319 3300005843 Ga0068860_100224253 Ga0068860_1002242533 208
320 3300006237 Ga0097621_100042607 Ga0097621_1000426072 208
321 3300006237 Ga0097621_100072847 Ga0097621_1000728473 208
322 3300006358 Ga0068871_100028854 Ga0068871_1000288545 208
323 3300006358 Ga0068871_100032974 Ga0068871_1000329744 208
324 3300006358 Ga0068871_100765024 Ga0068871_1007650241 208
325 3300006881 Ga0068865_100034172 Ga0068865_1000341723 208
326 3300009174 Ga0105241_10032320 Ga0105241_100323204 208
327 3300009176 Ga0105242_10024844 Ga0105242_100248444 208
328 3300009177 Ga0105248_10000009 Ga0105248_10000009314 208
329 3300009177 Ga0105248_10372822 Ga0105248_103728223 208
330 3300009177 Ga0105248_10439128 Ga0105248_104391283 208
331 3300009545 Ga0105237_10064993 Ga0105237_100649934 208
332 3300009551 Ga0105238_10123090 Ga0105238_101230903 208
333 3300009551 Ga0105238_10147069 Ga0105238_101470691 208
334 3300010375 Ga0105239_10138829 Ga0105239_101388295 208
335 3300010375 Ga0105239_10223699 Ga0105239_102236993 208
336 3300011119 Ga0105246_10002746 Ga0105246_100027464 208
337 3300013105 Ga0157369_10052461 Ga0157369_100524615 208
338 3300013296 Ga0157374_10285150 Ga0157374_102851502 208
339 3300013306 Ga0163162_10161974 Ga0163162_101619743 208
340 3300013306 Ga0163162_10245402 Ga0163162_102454022 208
341 3300013306 Ga0163162_10413831 Ga0163162_104138311 208
342 3300013307 Ga0157372_10131559 Ga0157372_101315594 208
343 3300013308 Ga0157375_10143703 Ga0157375_101437032 208
344 3300014325 Ga0163163_10037663 Ga0163163_100376635 208
345 3300014325 Ga0163163_10105362 Ga0163163_101053622 208
346 3300017792 Ga0163161_10044984 Ga0163161_100449843 208
347 3300025272 Ga0209455_1012057 Ga0209455_10120573 208
348 3300025297 Ga0209758_1000008 Ga0209758_1000008695 208
349 3300025911 Ga0207654_10033675 Ga0207654_100336754 208
350 3300025911 Ga0207654_10056069 Ga0207654_100560694 208
351 3300025920 Ga0207649_10081516 Ga0207649_100815163 208
352 3300025934 Ga0207686_10013362 Ga0207686_100133624 208
353 3300025937 Ga0207669_10402406 Ga0207669_104024062 208
354 3300025938 Ga0207704_10036509 Ga0207704_100365092 208
355 3300025938 Ga0207704_10060774 Ga0207704_100607743 208
356 3300025941 Ga0207711_10697180 Ga0207711_106971802 208
357 3300025942 Ga0207689_10347217 Ga0207689_103472171 208
358 3300025942 Ga0207689_10437585 Ga0207689_104375851 208
359 3300025960 Ga0207651_10173962 Ga0207651_101739621 208
360 3300025972 Ga0207668_10118300 Ga0207668_101183003 208
361 3300025986 Ga0207658_10052818 Ga0207658_100528183 208
362 3300026023 Ga0207677_10927621 Ga0207677_109276211 208
363 3300026089 Ga0207648_10090871 Ga0207648_100908713 208
364 3300026089 Ga0207648_10387661 Ga0207648_103876611 208
365 3300026121 Ga0207683_10052147 Ga0207683_100521473 208
366 3300028379 Ga0268266_10664240 Ga0268266_106642402 208
367 3300028380 Ga0268265_10228141 Ga0268265_102281412 208
368 3300028381 Ga0268264_10126091 Ga0268264_101260911 208
369 3300028786 Ga0307517_10190349 Ga0307517_101903492 208
370 3300031730 Ga0307516_10073693 Ga0307516_100736933 208
371 3300033180 Ga0307510_10282415 Ga0307510_102824151 208
372 3300039437 Ga0436365_0019186 Ga0436365_0019186_65_694 208
373 3300046471 Ga0495650_0123721 Ga0495650_0123721_124_750 208
374 3300046692 Ga0495671_0187182 Ga0495671_0187182_11_643 208
375 3300046794 Ga0495589_0201225 Ga0495589_0201225_31_708 208
376 3300047320 Ga0495672_0167496 Ga0495672_0167496_449_1081 208
377 3300049580 Ga0501046_0044490 Ga0501046_0044490_1099_1725 208
378 3300049581 Ga0501047_0055688 Ga0501047_0055688_2164_2790 208
379 3300049742 Ga0501080_0015870 Ga0501080_0015870_3156_3875 208
380 3300049822 Ga0501035_0464749 Ga0501035_0464749_359_985 208
381 3300050509 nmdc:mga0qj67_90253_c1 nmdc:mga0qj67_90253_c1_973_1752 208
382 3300053119 Ga0500595_000371 Ga0500595_000371_1980_2615 208
383 3300053130 Ga0500642_0162625 Ga0500642_0162625_257_889 208
384 3300053154 Ga0500619_034512 Ga0500619_034512_780_1481 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04366

Ysc84

Las17-binding protein actin regulator

136

258

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d39-assembly1.cif.gz_A-2 photodissociable dimeric dronpa green fluorescent protein variant v (pddronpav) 0.5683 56 122
7oin-assembly1.cif.gz_B crystal structure of lssmscarlet - a genetically encoded red fluorescent protein with a large stokes shift 0.558 59 121
4q7r-assembly2.cif.gz_B crystal structure of large stokes shift fluorescent protein lssmorange 0.5487 57 117
2arl-assembly1.cif.gz_A the 2.0 angstroms crystal structure of a pocilloporin at ph 3.5: the structural basis for the linkage between color transition and halide binding 0.5454 56 117
7rfq-assembly1.cif.gz_A structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) 0.5437 14 186
ID Description Score Start End Superfamily
af_O18222_43_179_2.60.40.1210 Mainly Beta;Sandwich;Immunoglobulin-like;Cellobiose dehydrogenase, cytochrome domain 0.664 59 101 2.60.40.1210
af_P9WM93_4_131_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5796 49 105 3.10.450.50
1xaeB00 Mainly Beta;Beta Barrel;Green Fluorescent Protein;Green fluorescent protein 0.5674 57 117 2.40.155.10
af_A0A096RZ13_75_178_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.4987 46 101 3.30.390.80
af_Q54X63_513_688_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.4888 63 101 3.40.1110.10
ID Description Score Start End GO Terms
AF-A0A560HCQ8-F1-model_v4 Lipid-binding SYLF domain-containing protein 0.9071 27 208 GO:0035091
AF-A0A7V9SAA8-F1-model_v4 Lipid-binding SYLF domain-containing protein 0.9024 8 208 GO:0035091
AF-A0A248JVP7-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8853 24 208 GO:0035091
AF-A0A560GD08-F1-model_v4 Lipid-binding SYLF domain-containing protein 0.8851 27 208 GO:0035091
AF-A0A516H288-F1-model_v4 Lipid-binding SYLF domain-containing protein 0.8829 21 207 GO:0035091

Feature Viewer

pLDDT pTM Quality
76.28 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map