F429953

General Info

Members Datasets Scaffolds Average Seq Length
384 253 353 143

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0500065|Ga0395901_0500065_70_543
Length 157
Sequence VAQREALRASDSRLLANLKSACVVLVLTLLVPAVPAWAGSGPKVNTIKEVFARLLACWKPPPLSRANPIDITVIVSFNRAGEILGRPRITYESAGASDSDRLAYRIAVMEALQRCTPMPFTQSMAGAVAGHPFTVQFRNKRPPPAPEKRAWLLPKIL

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
8 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
11 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
12 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
13 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
14 2904699407
15 2906610324
16 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
17 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
18 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
19 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
20 2922425934
21 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
22 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
23 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
24 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
25 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
64 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
123 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
124 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
249 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
250 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
251 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
252 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
253 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.65
Metatranscriptomes 0
Isolates 7.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.21
Nodule 7.29
Rhizoplane 9.9
Rhizosphere 70.05
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100048659 3300005329 Bacteria 3920
2 Ga0070690_100182738 3300005330 Bacteria 1450
3 Ga0070690_100227485 3300005330 Bacteria 1310
4 Ga0070670_100510501 3300005331 Bacteria 1070
5 Ga0068869_100405762 3300005334 Bacteria 1122
6 Ga0068869_101207835 3300005334 Bacteria 665
7 Ga0070689_100171623 3300005340 Bacteria 1757
8 Ga0070661_100916672 3300005344 Bacteria 724
9 Ga0070688_100280422 3300005365 Bacteria 1197
10 Ga0070659_100875986 3300005366 Bacteria 784
11 Ga0070667_100974795 3300005367 Bacteria 791
12 Ga0070714_100235627 3300005435 Bacteria 1688
13 Ga0070713_100162580 3300005436 Bacteria 1994
14 Ga0070713_100243932 3300005436 Bacteria 1637
15 Ga0070710_10104663 3300005437 Bacteria 1691
16 Ga0070711_100216061 3300005439 Bacteria 1488
17 Ga0070663_100722097 3300005455 Bacteria 848
18 Ga0070662_101060446 3300005457 Bacteria 695
19 Ga0070681_10060782 3300005458 Bacteria 3754
20 Ga0070681_10956150 3300005458 Bacteria 776
21 Ga0068867_100374146 3300005459 Bacteria 1195
22 Ga0068867_101305600 3300005459 Bacteria 670
23 Ga0070679_100230907 3300005530 Bacteria 1810
24 Ga0070684_100107204 3300005535 Bacteria 2502
25 Ga0070684_100668917 3300005535 Bacteria 967
26 Ga0070686_100493512 3300005544 Bacteria 949
27 Ga0070665_100728482 3300005548 Bacteria 1005
28 Ga0070704_100261975 3300005549 Bacteria 1425
29 Ga0068855_100153494 3300005563 Bacteria 2617
30 Ga0068856_100063890 3300005614 Bacteria 3637
31 Ga0068852_100042941 3300005616 Bacteria 3831
32 Ga0068852_100246793 3300005616 Bacteria 1709
33 Ga0068863_101435798 3300005841 Bacteria 698
34 Ga0068860_100907911 3300005843 Bacteria 897
35 Ga0081540_1031911 3300005983 Bacteria 2885
36 Ga0070717_10426886 3300006028 Bacteria 1193
37 Ga0070717_11045264 3300006028 Bacteria 744
38 Ga0075365_10050716 3300006038 Bacteria 2738
39 Ga0075365_10262088 3300006038 Bacteria 1215
40 Ga0075365_10855682 3300006038 Bacteria 641
41 Ga0075363_100101253 3300006048 Bacteria 1594
42 Ga0075363_100330043 3300006048 Bacteria 888
43 Ga0075363_100537356 3300006048 Bacteria 697
44 Ga0075364_10610048 3300006051 Bacteria 745
45 Ga0070712_100168405 3300006175 Bacteria 1698
46 Ga0070712_100394634 3300006175 Bacteria 1141
47 Ga0075366_10143039 3300006195 Bacteria 1447
48 Ga0075366_10610022 3300006195 Bacteria 677
49 Ga0097621_100122553 3300006237 Bacteria 2207
50 Ga0097621_101036087 3300006237 Bacteria 769
51 Ga0097621_101107537 3300006237 Bacteria 743
52 Ga0097621_101312143 3300006237 Bacteria 684
53 Ga0097621_101787944 3300006237 Bacteria 586
54 Ga0075370_10318335 3300006353 Bacteria 926
55 Ga0068871_101193301 3300006358 Bacteria 714
56 Ga0099824_1018590 3300006942 Bacteria 5661
57 Ga0099822_1037903 3300006943 Bacteria 2894
58 Ga0099794_10437559 3300007265 Bacteria 685
59 Ga0099795_10366355 3300007788 Bacteria 648
60 Ga0105240_10094106 3300009093 Bacteria 3656
61 Ga0105245_10738238 3300009098 Bacteria 1020
62 Ga0105245_12415109 3300009098 Bacteria 579
63 Ga0105243_11640991 3300009148 Bacteria 670
64 Ga0105242_10078608 3300009176 Bacteria 2754
65 Ga0105242_11215289 3300009176 Bacteria 774
66 Ga0105242_11244830 3300009176 Bacteria 765
67 Ga0105248_10955210 3300009177 Bacteria 968
68 Ga0105237_10084963 3300009545 Bacteria 3154
69 Ga0105237_11553489 3300009545 Bacteria 669
70 Ga0105237_12578358 3300009545 Bacteria 519
71 Ga0105238_10391614 3300009551 Bacteria 1382
72 Ga0105238_10503103 3300009551 Bacteria 1213
73 Ga0105238_10559202 3300009551 Bacteria 1149
74 Ga0105238_11719849 3300009551 Bacteria 658
75 Ga0105249_12590425 3300009553 Bacteria 579
76 Ga0099796_10033016 3300010159 Bacteria 1700
77 Ga0099796_10214183 3300010159 Bacteria 787
78 Ga0105239_10080550 3300010375 Bacteria 3583
79 Ga0105239_11742366 3300010375 Bacteria 721
80 Ga0105246_10164765 3300011119 Bacteria 1692
81 Ga0105246_10559936 3300011119 Bacteria 981
82 Ga0105246_10785265 3300011119 Bacteria 843
83 Ga0157370_10023094 3300013104 Bacteria 6182
84 Ga0157369_10328364 3300013105 Bacteria 1589
85 Ga0157374_10089354 3300013296 Bacteria 2935
86 Ga0157374_10290426 3300013296 Bacteria 1616
87 Ga0157374_12295848 3300013296 Bacteria 567
88 Ga0163162_10105602 3300013306 Bacteria 2911
89 Ga0163162_10141312 3300013306 Bacteria 2521
90 Ga0163162_10384607 3300013306 Bacteria 1536
91 Ga0157372_10190321 3300013307 Bacteria 2377
92 Ga0157375_10046830 3300013308 Bacteria 4219
93 Ga0163163_10136031 3300014325 Bacteria 2499
94 Ga0163163_10143860 3300014325 Bacteria 2427
95 Ga0163163_10311535 3300014325 Bacteria 1627
96 Ga0157377_10516633 3300014745 Bacteria 837
97 Ga0157379_10155166 3300014968 Bacteria 2065
98 Ga0157379_10687100 3300014968 Bacteria 960
99 Ga0157376_10014758 3300014969 Bacteria 5876
100 Ga0163161_10330899 3300017792 Bacteria 1206
101 Ga0163161_10892627 3300017792 Bacteria 753
102 Ga0213874_10286314 3300021377 Bacteria 617
103 Ga0213876_10252529 3300021384 Bacteria 937
104 Ga0209233_1001858 3300025261 Bacteria 8116
105 Ga0207697_10100384 3300025315 Bacteria 1233
106 Ga0207692_10000385 3300025898 Bacteria 15247
107 Ga0207688_10074641 3300025901 Bacteria 1929
108 Ga0207699_10377963 3300025906 Bacteria 1005
109 Ga0207699_10425355 3300025906 Bacteria 949
110 Ga0207707_10232425 3300025912 Bacteria 1604
111 Ga0207695_11272478 3300025913 Bacteria 616
112 Ga0207671_10341583 3300025914 Bacteria 1186
113 Ga0207693_10004788 3300025915 Bacteria 11383
114 Ga0207693_10029787 3300025915 Bacteria 4309
115 Ga0207693_10245635 3300025915 Bacteria 1405
116 Ga0207663_10001068 3300025916 Bacteria 12564
117 Ga0207660_10405350 3300025917 Bacteria 1098
118 Ga0207649_10151563 3300025920 Bacteria 1597
119 Ga0207652_10120576 3300025921 Bacteria 2333
120 Ga0207694_10398808 3300025924 Bacteria 1144
121 Ga0207687_10299650 3300025927 Bacteria 1294
122 Ga0207700_10143451 3300025928 Bacteria 1965
123 Ga0207664_10603305 3300025929 Bacteria 986
124 Ga0207664_10731347 3300025929 Bacteria 890
125 Ga0207664_10787620 3300025929 Bacteria 855
126 Ga0207686_10151280 3300025934 Bacteria 1616
127 Ga0207665_10231471 3300025939 Bacteria 1358
128 Ga0207665_10506720 3300025939 Bacteria 933
129 Ga0207691_10361595 3300025940 Bacteria 1241
130 Ga0207711_10343584 3300025941 Bacteria 1381
131 Ga0207661_10231656 3300025944 Bacteria 1636
132 Ga0207679_10419543 3300025945 Bacteria 1181
133 Ga0207667_10037831 3300025949 Bacteria 5157
134 Ga0207668_10639937 3300025972 Bacteria 930
135 Ga0207658_10649212 3300025986 Bacteria 951
136 Ga0207678_10068408 3300026067 Bacteria 3047
137 Ga0207702_11796912 3300026078 Bacteria 605
138 Ga0207641_11298935 3300026088 Bacteria 728
139 Ga0207648_10080467 3300026089 Bacteria 2842
140 Ga0207698_10041587 3300026142 Bacteria 3426
141 Ga0207698_10201839 3300026142 Bacteria 1781
142 Ga0209589_1000003 3300027357 Bacteria 629130
143 Ga0209489_100003 3300027361 Bacteria 663105
144 Ga0209700_100003 3300027363 Bacteria 663105
145 Ga0209813_10295063 3300027866 Bacteria 628
146 Ga0265356_1023011 3300028017 Bacteria 674
147 Ga0268266_10543548 3300028379 Bacteria 1112
148 Ga0268266_10601345 3300028379 Bacteria 1056
149 Ga0307517_10000139 3300028786 Bacteria 111985
150 Ga0265330_10073433 3300031235 Bacteria 1479
151 Ga0265330_10236625 3300031235 Bacteria 770
152 Ga0265332_10032336 3300031238 Bacteria 2280
153 Ga0265325_10094207 3300031241 Bacteria 1473
154 Ga0265340_10003276 3300031247 Bacteria 9176
155 Ga0265340_10195036 3300031247 Bacteria 912
156 Ga0265339_10005909 3300031249 Bacteria 8103
157 Ga0265331_10186826 3300031250 Bacteria 935
158 Ga0265316_10189871 3300031344 Bacteria 1527
159 Ga0265316_10353329 3300031344 Bacteria 1064
160 Ga0307509_10446746 3300031507 Bacteria 988
161 Ga0265313_10135625 3300031595 Bacteria 1063
162 Ga0307508_10474027 3300031616 Bacteria 845
163 Ga0307508_10518622 3300031616 Bacteria 788
164 Ga0265314_10093505 3300031711 Bacteria 1952
165 Ga0265314_10094982 3300031711 Bacteria 1931
166 Ga0265342_10283239 3300031712 Bacteria 877
167 Ga0265342_10285801 3300031712 Bacteria 872
168 Ga0307516_10002141 3300031730 Bacteria 26772
169 Ga0307413_12139991 3300031824 Bacteria 506
170 Ga0307412_10199331 3300031911 Bacteria 1519
171 Ga0315911_1000001 3300033442 Bacteria 1088602
172 Ga0373929_0058818 3300035085 Bacteria 895
173 Ga0373934_0044521 3300035086 Bacteria 1754
174 Ga0373934_0183254 3300035086 Bacteria 861
175 Ga0373923_0168456 3300035111 Bacteria 1002
176 Ga0373936_0465002 3300035113 Bacteria 586
177 Ga0373945_0499085 3300035116 Bacteria 542
178 Ga0373953_0010564 3300035117 Bacteria 3218
179 Ga0373954_0002553 3300035118 Bacteria 7647
180 Ga0373954_0013691 3300035118 Bacteria 3614
181 Ga0373956_0021775 3300035119 Bacteria 2736
182 Ga0373956_0023024 3300035119 Bacteria 2670
183 Ga0373957_0018270 3300035120 Bacteria 2453
184 Ga0373957_0049484 3300035120 Bacteria 1604
185 Ga0373943_0021100 3300035170 Bacteria 3007
186 Ga0373943_0046879 3300035170 Bacteria 2111
187 Ga0373946_0036121 3300035171 Bacteria 2002
188 Ga0373946_0198529 3300035171 Bacteria 960
189 Ga0373955_0001258 3300035172 Bacteria 10776
190 Ga0373955_0054811 3300035172 Bacteria 2181
191 Ga0373924_0011125 3300035410 Bacteria 3334
192 Ga0373924_0196754 3300035410 Bacteria 888
193 Ga0373935_0324892 3300035692 Bacteria 1092
194 Ga0373927_0048772 3300035695 Bacteria 2739
195 Ga0373933_0000261 3300035724 Bacteria 34746
196 Ga0373933_0008115 3300035724 Bacteria 5728
197 Ga0373933_0516625 3300035724 Bacteria 783
198 Ga0373933_0753104 3300035724 Bacteria 641
199 Ga0373947_0044146 3300035725 Bacteria 2663
200 Ga0373937_0068520 3300036401 Bacteria 3272
201 Ga0373937_0313523 3300036401 Bacteria 1484
202 Ga0373937_1126842 3300036401 Bacteria 733
203 Ga0373925_0147147 3300037068 Bacteria 1847
204 Ga0373925_0614657 3300037068 Bacteria 895
205 Ga0373925_1181067 3300037068 Bacteria 629
206 Ga0395900_0294052 3300037418 Bacteria 1612
207 Ga0395898_0032214 3300037466 Bacteria 5232
208 Ga0395901_0311942 3300038443 Bacteria 1629
209 Ga0395901_0500065 3300038443 Bacteria 1238
210 Ga0436365_0197368 3300039437 Bacteria 3141
211 Ga0436360_0981735 3300039438 Bacteria 732
212 Ga0436363_0587449 3300039450 Bacteria 817
213 Ga0436363_0644424 3300039450 Bacteria 2640
214 Ga0436363_0823554 3300039450 Bacteria 969
215 Ga0451797_0535575 3300041453 Bacteria 1069
216 Ga0451807_0998415 3300041486 Bacteria 782
217 Ga0451843_1483276 3300041509 Bacteria 751
218 Ga0451853_0062218 3300041512 Bacteria 837
219 Ga0466969_0032266 3300044656 Bacteria 2663
220 Ga0466963_0245610 3300044694 Bacteria 1256
221 Ga0466959_0142718 3300045049 Bacteria 1691
222 Ga0495592_0010679 3300046454 Bacteria 6924
223 Ga0495592_0155593 3300046454 Bacteria 1577
224 Ga0495603_0340133 3300046455 Bacteria 861
225 Ga0495629_0017434 3300046459 Bacteria 5146
226 Ga0495629_0105765 3300046459 Bacteria 1963
227 Ga0495651_0002792 3300046462 Bacteria 13540
228 Ga0495651_0548754 3300046462 Bacteria 734
229 Ga0495653_0003251 3300046463 Bacteria 13038
230 Ga0495653_0073909 3300046463 Bacteria 2542
231 Ga0495653_0507843 3300046463 Bacteria 751
232 Ga0495639_0453996 3300046475 Bacteria 651
233 Ga0495662_0133744 3300046476 Bacteria 1220
234 Ga0495664_0108379 3300046477 Bacteria 1676
235 Ga0495606_0298093 3300046507 Bacteria 875
236 Ga0495608_0090650 3300046511 Bacteria 1977
237 Ga0495618_0376222 3300046514 Bacteria 872
238 Ga0495628_0083080 3300046516 Bacteria 2487
239 Ga0495628_0087568 3300046516 Bacteria 2414
240 Ga0495630_0210976 3300046517 Bacteria 1482
241 Ga0495642_0134997 3300046528 Bacteria 1064
242 Ga0495652_0015667 3300046529 Bacteria 6785
243 Ga0495640_0052586 3300046533 Bacteria 2796
244 Ga0495640_0071213 3300046533 Bacteria 2333
245 Ga0495640_0358160 3300046533 Bacteria 900
246 Ga0495586_0192301 3300046535 Bacteria 1156
247 Ga0495587_0023186 3300046536 Bacteria 3815
248 Ga0495645_0048982 3300046543 Bacteria 3077
249 Ga0495645_0056509 3300046543 Bacteria 2849
250 Ga0495667_0006545 3300046559 Bacteria 7906
251 Ga0495667_0074109 3300046559 Bacteria 2216
252 Ga0495668_0049858 3300046616 Bacteria 2322
253 Ga0495634_0012063 3300046642 Bacteria 6264
254 Ga0495634_0031122 3300046642 Bacteria 3677
255 Ga0495635_0000230 3300046663 Bacteria 35642
256 Ga0495635_0039433 3300046663 Bacteria 3267
257 Ga0495635_0159920 3300046663 Bacteria 1533
258 Ga0495657_0125889 3300046675 Bacteria 1609
259 Ga0495599_0003970 3300046678 Bacteria 8710
260 Ga0495599_0052139 3300046678 Bacteria 2563
261 Ga0495599_0445392 3300046678 Bacteria 767
262 Ga0495623_0040516 3300046679 Bacteria 2974
263 Ga0495623_0060952 3300046679 Bacteria 2366
264 Ga0495623_0086264 3300046679 Bacteria 1935
265 Ga0495623_0211534 3300046679 Bacteria 1110
266 Ga0495646_0011572 3300046680 Bacteria 5603
267 Ga0495646_0320197 3300046680 Bacteria 817
268 Ga0495646_0377716 3300046680 Bacteria 739
269 Ga0495624_0273560 3300046690 Bacteria 1020
270 Ga0495600_0004716 3300046809 Bacteria 8181
271 Ga0495600_0062366 3300046809 Bacteria 2435
272 Ga0495600_0271442 3300046809 Bacteria 1076
273 Ga0495581_0067754 3300047315 Bacteria 2064
274 Ga0495581_0562152 3300047315 Bacteria 662
275 Ga0495604_0017985 3300047317 Bacteria 5656
276 Ga0495604_0081745 3300047317 Bacteria 2417
277 Ga0495674_0008381 3300047319 Bacteria 9849
278 Ga0495674_0060825 3300047319 Bacteria 3294
279 Ga0495672_0023877 3300047320 Bacteria 3950
280 Ga0495680_0011451 3300047322 Bacteria 7852
281 Ga0495680_0054350 3300047322 Bacteria 3110
282 Ga0495675_0001005 3300047444 Bacteria 17160
283 Ga0495675_0027616 3300047444 Bacteria 3616
284 Ga0495677_0169315 3300047445 Bacteria 845
285 Ga0495684_0002802 3300047471 Bacteria 13754
286 Ga0495684_0098674 3300047471 Bacteria 2208
287 Ga0495686_0544795 3300047472 Bacteria 606
288 Ga0495593_0002243 3300047673 Bacteria 11592
289 Ga0495593_0218590 3300047673 Bacteria 956
290 Ga0495602_0023393 3300048088 Bacteria 6021
291 Ga0495602_0284758 3300048088 Bacteria 1216
292 Ga0495602_0307111 3300048088 Bacteria 1159
293 Ga0495602_0434736 3300048088 Bacteria 929
294 Ga0495602_0601806 3300048088 Bacteria 756
295 Ga0496102_0590876 3300048905 Bacteria 1033
296 Ga0496102_1359942 3300048905 Bacteria 629
297 Ga0496103_0062010 3300048906 Bacteria 2327
298 Ga0496104_0017952 3300048907 Bacteria 6450
299 Ga0496104_1882953 3300048907 Bacteria 500
300 Ga0496105_0020951 3300048908 Bacteria 5287
301 Ga0496106_0086371 3300048909 Bacteria 2416
302 Ga0496106_0288120 3300048909 Bacteria 1316
303 Ga0496106_0466490 3300048909 Bacteria 1014
304 Ga0496107_0018488 3300048910 Bacteria 4907
305 Ga0496107_0308223 3300048910 Bacteria 1178
306 Ga0496107_0696918 3300048910 Bacteria 747
307 Ga0496107_0990049 3300048910 Bacteria 610
308 Ga0496108_0069780 3300048911 Bacteria 2965
309 Ga0496108_0473568 3300048911 Bacteria 1094
310 Ga0496108_1038457 3300048911 Bacteria 699
311 Ga0496108_1713011 3300048911 Bacteria 517
312 Ga0496109_0074404 3300048912 Bacteria 3122
313 Ga0496110_0031895 3300048913 Bacteria 4547
314 Ga0496110_0071868 3300048913 Bacteria 3069
315 Ga0496110_0127526 3300048913 Bacteria 2296
316 Ga0496110_0903972 3300048913 Bacteria 789
317 Ga0496111_0105259 3300048914 Bacteria 2076
318 Ga0496111_0172837 3300048914 Bacteria 1605
319 Ga0496112_0010586 3300048915 Bacteria 8378
320 Ga0496112_0011660 3300048915 Bacteria 8040
321 Ga0496112_0939308 3300048915 Bacteria 786
322 Ga0496113_0315773 3300048916 Bacteria 1252
323 Ga0496114_0024702 3300048917 Bacteria 4906
324 Ga0496114_0186115 3300048917 Bacteria 1815
325 Ga0496114_1349353 3300048917 Bacteria 600
326 Ga0496115_0006501 3300048918 Bacteria 8570
327 Ga0496115_0083133 3300048918 Bacteria 2609
328 Ga0496115_0107052 3300048918 Bacteria 2295
329 Ga0496115_1329174 3300048918 Bacteria 534
330 Ga0496121_0003622 3300048924 Bacteria 21784
331 Ga0496121_0364056 3300048924 Bacteria 959
332 Ga0496122_0174916 3300048925 Bacteria 1288
333 Ga0496126_0003918 3300048929 Bacteria 18248
334 Ga0496126_0013307 3300048929 Bacteria 8379
335 Ga0496126_0137237 3300048929 Bacteria 2108
336 Ga0496126_0219747 3300048929 Bacteria 1596
337 Ga0496126_0324731 3300048929 Bacteria 1264
338 Ga0495682_0280926 3300049460 Bacteria 588
339 nmdc:mga03n38_30616_c1 3300050490 Bacteria 1668
340 nmdc:mga0yw44_187354_c1 3300050492 Bacteria 1364
341 nmdc:mga0k408_581348_c1 3300050493 Bacteria 661
342 nmdc:mga06z11_356778_c1 3300050494 Bacteria 876
343 nmdc:mga04h51_330499_c1 3300050495 Bacteria 627
344 Ga0495601_0030202 3300053077 Bacteria 3364
345 Ga0495601_0172296 3300053077 Bacteria 1415
346 Ga0495612_0481528 3300053078 Bacteria 568
347 Ga0500610_0335562 3300053079 Bacteria 648
348 Ga0495595_0001042 3300053084 Bacteria 10677
349 Ga0495595_0026371 3300053084 Bacteria 2581
350 Ga0495619_0002925 3300053085 Bacteria 11103
351 Ga0500595_007366 3300053119 Bacteria 4570
352 Ga0500568_0020463 3300053139 Bacteria 2860
353 Ga0466962_0269413 3300061719 Bacteria 839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006028 Ga0070717_10426886 Ga0070717_104268862 120
2 3300031241 Ga0265325_10094207 Ga0265325_100942072 123
3 3300031247 Ga0265340_10195036 Ga0265340_101950362 123
4 3300031250 Ga0265331_10186826 Ga0265331_101868262 123
5 3300031344 Ga0265316_10189871 Ga0265316_101898712 123
6 3300031711 Ga0265314_10093505 Ga0265314_100935052 123
7 3300031712 Ga0265342_10285801 Ga0265342_102858011 123
8 3300005614 Ga0068856_100063890 Ga0068856_1000638906 126
9 3300006028 Ga0070717_11045264 Ga0070717_110452642 126
10 3300025920 Ga0207649_10151563 Ga0207649_101515632 126
11 3300025924 Ga0207694_10398808 Ga0207694_103988082 126
12 3300026142 Ga0207698_10201839 Ga0207698_102018394 126
13 3300039438 Ga0436360_0981735 Ga0436360_0981735_20_505 126
14 3300007788 Ga0099795_10366355 Ga0099795_103663552 127
15 3300010159 Ga0099796_10033016 Ga0099796_100330163 130
16 3300014325 Ga0163163_10311535 Ga0163163_103115354 130
17 3300009553 Ga0105249_12590425 Ga0105249_125904251 131
18 iso_pu_bacteria 2908756301 2908760616 132
19 3300005436 Ga0070713_100243932 Ga0070713_1002439322 133
20 3300007265 Ga0099794_10437559 Ga0099794_104375592 133
21 3300025928 Ga0207700_10143451 Ga0207700_101434513 133
22 3300035724 Ga0373933_0000261 Ga0373933_0000261_19613_20017 133
23 3300048915 Ga0496112_0939308 Ga0496112_0939308_89_496 133
24 3300009098 Ga0105245_10738238 Ga0105245_107382382 134
25 3300011119 Ga0105246_10164765 Ga0105246_101647652 134
26 3300013296 Ga0157374_10290426 Ga0157374_102904263 134
27 3300013306 Ga0163162_10105602 Ga0163162_101056025 134
28 3300014325 Ga0163163_10143860 Ga0163163_101438603 134
29 3300021384 Ga0213876_10252529 Ga0213876_102525292 134
30 3300031595 Ga0265313_10135625 Ga0265313_101356252 134
31 3300037418 Ga0395900_0294052 Ga0395900_0294052_749_1159 134
32 3300038443 Ga0395901_0311942 Ga0395901_0311942_728_1138 134
33 3300039437 Ga0436365_0197368 Ga0436365_0197368_1961_2371 134
34 3300039450 Ga0436363_0823554 Ga0436363_0823554_356_766 134
35 3300044656 Ga0466969_0032266 Ga0466969_0032266_606_1016 134
36 3300045049 Ga0466959_0142718 Ga0466959_0142718_461_871 134
37 3300048907 Ga0496104_0017952 Ga0496104_0017952_762_1172 134
38 3300048909 Ga0496106_0086371 Ga0496106_0086371_1314_1724 134
39 3300048910 Ga0496107_0696918 Ga0496107_0696918_255_665 134
40 3300048913 Ga0496110_0071868 Ga0496110_0071868_738_1148 134
41 3300048914 Ga0496111_0105259 Ga0496111_0105259_755_1165 134
42 3300048915 Ga0496112_0010586 Ga0496112_0010586_4368_4778 134
43 3300048916 Ga0496113_0315773 Ga0496113_0315773_770_1180 134
44 3300048917 Ga0496114_1349353 Ga0496114_1349353_127_537 134
45 3300061719 Ga0466962_0269413 Ga0466962_0269413_381_791 134
46 3300025929 Ga0207664_10787620 Ga0207664_107876202 135
47 3300037068 Ga0373925_1181067 Ga0373925_1181067_188_613 135
48 3300048917 Ga0496114_0186115 Ga0496114_0186115_821_1234 135
49 3300048918 Ga0496115_0083133 Ga0496115_0083133_1455_1868 135
50 3300048929 Ga0496126_0219747 Ga0496126_0219747_143_556 135
51 3300009551 Ga0105238_10559202 Ga0105238_105592022 136
52 3300048929 Ga0496126_0137237 Ga0496126_0137237_696_1112 136
53 3300006237 Ga0097621_101107537 Ga0097621_1011075371 137
54 3300028017 Ga0265356_1023011 Ga0265356_10230111 137
55 3300036401 Ga0373937_1126842 Ga0373937_1126842_82_522 137
56 3300047315 Ga0495581_0067754 Ga0495581_0067754_1585_2025 137
57 3300048913 Ga0496110_0903972 Ga0496110_0903972_157_573 137
58 3300048088 Ga0495602_0307111 Ga0495602_0307111_323_757 138
59 3300005458 Ga0070681_10956150 Ga0070681_109561502 139
60 3300028786 Ga0307517_10000139 Ga0307517_1000013973 139
61 3300031249 Ga0265339_10005909 Ga0265339_100059092 139
62 3300037068 Ga0373925_0147147 Ga0373925_0147147_932_1363 139
63 iso_pu_bacteria 2524023210 2524470586 139
64 iso_pu_bacteria 2903768456 2903772626 139
65 iso_pu_bacteria 8056681323 8056685377 139
66 3300005330 Ga0070690_100227485 Ga0070690_1002274852 140
67 3300005334 Ga0068869_101207835 Ga0068869_1012078351 140
68 3300005340 Ga0070689_100171623 Ga0070689_1001716232 140
69 3300005365 Ga0070688_100280422 Ga0070688_1002804222 140
70 3300005535 Ga0070684_100668917 Ga0070684_1006689172 140
71 3300005549 Ga0070704_100261975 Ga0070704_1002619752 140
72 3300005616 Ga0068852_100042941 Ga0068852_1000429412 140
73 3300005841 Ga0068863_101435798 Ga0068863_1014357981 140
74 3300005843 Ga0068860_100907911 Ga0068860_1009079112 140
75 3300009177 Ga0105248_10955210 Ga0105248_109552102 140
76 3300009551 Ga0105238_10503103 Ga0105238_105031032 140
77 3300010159 Ga0099796_10214183 Ga0099796_102141831 140
78 3300013105 Ga0157369_10328364 Ga0157369_103283643 140
79 3300013307 Ga0157372_10190321 Ga0157372_101903214 140
80 3300025929 Ga0207664_10731347 Ga0207664_107313472 140
81 3300031235 Ga0265330_10073433 Ga0265330_100734333 140
82 3300031235 Ga0265330_10236625 Ga0265330_102366252 140
83 3300031238 Ga0265332_10032336 Ga0265332_100323363 140
84 3300031616 Ga0307508_10518622 Ga0307508_105186222 140
85 3300031712 Ga0265342_10283239 Ga0265342_102832391 140
86 3300035086 Ga0373934_0044521 Ga0373934_0044521_71_505 140
87 3300035086 Ga0373934_0183254 Ga0373934_0183254_388_828 140
88 3300035111 Ga0373923_0168456 Ga0373923_0168456_488_928 140
89 3300035113 Ga0373936_0465002 Ga0373936_0465002_62_502 140
90 3300035117 Ga0373953_0010564 Ga0373953_0010564_1416_1850 140
91 3300035118 Ga0373954_0002553 Ga0373954_0002553_1503_1937 140
92 3300035118 Ga0373954_0013691 Ga0373954_0013691_3100_3540 140
93 3300035119 Ga0373956_0021775 Ga0373956_0021775_579_1019 140
94 3300035119 Ga0373956_0023024 Ga0373956_0023024_389_823 140
95 3300035120 Ga0373957_0018270 Ga0373957_0018270_433_867 140
96 3300035120 Ga0373957_0049484 Ga0373957_0049484_353_793 140
97 3300035170 Ga0373943_0021100 Ga0373943_0021100_1429_1866 140
98 3300035172 Ga0373955_0001258 Ga0373955_0001258_1538_1972 140
99 3300035172 Ga0373955_0054811 Ga0373955_0054811_741_1181 140
100 3300035410 Ga0373924_0011125 Ga0373924_0011125_107_541 140
101 3300035410 Ga0373924_0196754 Ga0373924_0196754_421_861 140
102 3300035692 Ga0373935_0324892 Ga0373935_0324892_67_507 140
103 3300035724 Ga0373933_0008115 Ga0373933_0008115_120_554 140
104 3300035724 Ga0373933_0516625 Ga0373933_0516625_187_621 140
105 3300035724 Ga0373933_0753104 Ga0373933_0753104_76_510 140
106 3300036401 Ga0373937_0068520 Ga0373937_0068520_888_1322 140
107 3300036401 Ga0373937_0313523 Ga0373937_0313523_258_752 140
108 3300037466 Ga0395898_0032214 Ga0395898_0032214_2093_2533 140
109 3300044694 Ga0466963_0245610 Ga0466963_0245610_24_464 140
110 3300046454 Ga0495592_0010679 Ga0495592_0010679_1430_1864 140
111 3300046454 Ga0495592_0155593 Ga0495592_0155593_757_1197 140
112 3300046459 Ga0495629_0017434 Ga0495629_0017434_2919_3353 140
113 3300046459 Ga0495629_0105765 Ga0495629_0105765_1011_1451 140
114 3300046462 Ga0495651_0002792 Ga0495651_0002792_1992_2426 140
115 3300046463 Ga0495653_0003251 Ga0495653_0003251_1329_1763 140
116 3300046463 Ga0495653_0073909 Ga0495653_0073909_884_1324 140
117 3300046463 Ga0495653_0507843 Ga0495653_0507843_132_566 140
118 3300046476 Ga0495662_0133744 Ga0495662_0133744_303_743 140
119 3300046477 Ga0495664_0108379 Ga0495664_0108379_197_637 140
120 3300046511 Ga0495608_0090650 Ga0495608_0090650_888_1322 140
121 3300046516 Ga0495628_0083080 Ga0495628_0083080_207_641 140
122 3300046516 Ga0495628_0087568 Ga0495628_0087568_1911_2351 140
123 3300046529 Ga0495652_0015667 Ga0495652_0015667_5155_5589 140
124 3300046533 Ga0495640_0052586 Ga0495640_0052586_1237_1677 140
125 3300046533 Ga0495640_0071213 Ga0495640_0071213_495_929 140
126 3300046535 Ga0495586_0192301 Ga0495586_0192301_697_1137 140
127 3300046536 Ga0495587_0023186 Ga0495587_0023186_2096_2530 140
128 3300046543 Ga0495645_0048982 Ga0495645_0048982_17_457 140
129 3300046543 Ga0495645_0056509 Ga0495645_0056509_969_1403 140
130 3300046559 Ga0495667_0006545 Ga0495667_0006545_1539_1973 140
131 3300046559 Ga0495667_0074109 Ga0495667_0074109_1682_2122 140
132 3300046642 Ga0495634_0012063 Ga0495634_0012063_4023_4457 140
133 3300046642 Ga0495634_0031122 Ga0495634_0031122_2596_3036 140
134 3300046663 Ga0495635_0000230 Ga0495635_0000230_27050_27484 140
135 3300046663 Ga0495635_0039433 Ga0495635_0039433_850_1290 140
136 3300046663 Ga0495635_0159920 Ga0495635_0159920_874_1314 140
137 3300046675 Ga0495657_0125889 Ga0495657_0125889_1055_1489 140
138 3300046678 Ga0495599_0003970 Ga0495599_0003970_5421_5855 140
139 3300046678 Ga0495599_0052139 Ga0495599_0052139_509_949 140
140 3300046678 Ga0495599_0445392 Ga0495599_0445392_32_475 140
141 3300046679 Ga0495623_0040516 Ga0495623_0040516_1055_1489 140
142 3300046679 Ga0495623_0060952 Ga0495623_0060952_1521_1961 140
143 3300046679 Ga0495623_0211534 Ga0495623_0211534_56_496 140
144 3300046680 Ga0495646_0011572 Ga0495646_0011572_3175_3609 140
145 3300046680 Ga0495646_0320197 Ga0495646_0320197_202_642 140
146 3300046680 Ga0495646_0377716 Ga0495646_0377716_195_635 140
147 3300046809 Ga0495600_0004716 Ga0495600_0004716_5640_6074 140
148 3300046809 Ga0495600_0062366 Ga0495600_0062366_1327_1767 140
149 3300046809 Ga0495600_0271442 Ga0495600_0271442_382_816 140
150 3300047317 Ga0495604_0017985 Ga0495604_0017985_3696_4136 140
151 3300047317 Ga0495604_0081745 Ga0495604_0081745_1286_1720 140
152 3300047319 Ga0495674_0008381 Ga0495674_0008381_2343_2777 140
153 3300047319 Ga0495674_0060825 Ga0495674_0060825_1102_1542 140
154 3300047322 Ga0495680_0011451 Ga0495680_0011451_5475_5909 140
155 3300047322 Ga0495680_0054350 Ga0495680_0054350_1657_2097 140
156 3300047444 Ga0495675_0001005 Ga0495675_0001005_1964_2398 140
157 3300047444 Ga0495675_0027616 Ga0495675_0027616_1771_2211 140
158 3300047471 Ga0495684_0002802 Ga0495684_0002802_8053_8487 140
159 3300047471 Ga0495684_0098674 Ga0495684_0098674_1016_1456 140
160 3300047673 Ga0495593_0002243 Ga0495593_0002243_1036_1470 140
161 3300047673 Ga0495593_0218590 Ga0495593_0218590_425_865 140
162 3300048088 Ga0495602_0023393 Ga0495602_0023393_3601_4035 140
163 3300048088 Ga0495602_0434736 Ga0495602_0434736_338_832 140
164 3300048088 Ga0495602_0601806 Ga0495602_0601806_59_493 140
165 3300048911 Ga0496108_1038457 Ga0496108_1038457_191_637 140
166 3300048918 Ga0496115_0107052 Ga0496115_0107052_252_695 140
167 3300053077 Ga0495601_0030202 Ga0495601_0030202_1552_1986 140
168 3300053084 Ga0495595_0001042 Ga0495595_0001042_2730_3164 140
169 3300053084 Ga0495595_0026371 Ga0495595_0026371_1587_2027 140
170 3300053085 Ga0495619_0002925 Ga0495619_0002925_5349_5783 140
171 iso_pu_bacteria 2513237096 2513654491 140
172 iso_pu_bacteria 2513237137 2513859293 140
173 iso_pu_bacteria 2513237145 2513915330 140
174 iso_pu_bacteria 2517572143 2517892631 140
175 iso_pu_bacteria 2524023228 2524539023 140
176 iso_pu_bacteria 2667528175 2671117357 140
177 iso_pu_bacteria 2791355197 2793068533 140
178 iso_pu_bacteria 2885374607 2885382107 140
179 iso_pu_bacteria 2903748898 2903759049 140
180 iso_pu_bacteria 2904690495 2904695984 140
181 iso_pu_bacteria 2904699407 2904702745 140
182 iso_pu_bacteria 2906610324 2906618366 140
183 iso_pu_bacteria 2906635258 2906638672 140
184 iso_pu_bacteria 2906660503 2906664074 140
185 iso_pu_bacteria 2908739725 2908742964 140
186 iso_pu_bacteria 2922425934 2922429732 140
187 iso_pu_bacteria 2935630451 2935633366 140
188 iso_pu_bacteria 2941507105 2941510257 140
189 iso_pu_bacteria 2941515067 2941518006 140
190 iso_pu_bacteria 2941523033 2941526022 140
191 iso_pu_bacteria 3005474847 3005479962 140
192 iso_pu_bacteria 8006933436 8006941160 140
193 iso_pu_bacteria 8006973647 8006980634 140
194 iso_pu_bacteria 8019555841 8019557052 140
195 iso_pu_bacteria 8019565922 8019568248 140
196 3300005436 Ga0070713_100162580 Ga0070713_1001625803 141
197 3300025898 Ga0207692_10000385 Ga0207692_1000038510 141
198 3300025906 Ga0207699_10425355 Ga0207699_104253552 141
199 3300025915 Ga0207693_10004788 Ga0207693_100047887 141
200 3300025916 Ga0207663_10001068 Ga0207663_100010689 141
201 3300031247 Ga0265340_10003276 Ga0265340_100032763 141
202 3300031344 Ga0265316_10353329 Ga0265316_103533292 141
203 3300039450 Ga0436363_0644424 Ga0436363_0644424_1777_2217 141
204 3300048905 Ga0496102_0590876 Ga0496102_0590876_378_833 141
205 3300048911 Ga0496108_0473568 Ga0496108_0473568_143_598 141
206 3300048913 Ga0496110_0127526 Ga0496110_0127526_1105_1560 141
207 3300048915 Ga0496112_0011660 Ga0496112_0011660_1923_2378 141
208 iso_pu_bacteria 2728368998 2728750541 141
209 iso_pu_bacteria 8056689827 8056689995 141
210 3300005366 Ga0070659_100875986 Ga0070659_1008759862 142
211 3300005439 Ga0070711_100216061 Ga0070711_1002160613 142
212 3300005457 Ga0070662_101060446 Ga0070662_1010604461 142
213 3300006038 Ga0075365_10050716 Ga0075365_100507164 142
214 3300006051 Ga0075364_10610048 Ga0075364_106100482 142
215 3300006175 Ga0070712_100168405 Ga0070712_1001684053 142
216 3300006195 Ga0075366_10143039 Ga0075366_101430391 142
217 3300006237 Ga0097621_101312143 Ga0097621_1013121432 142
218 3300006237 Ga0097621_101787944 Ga0097621_1017879441 142
219 3300006942 Ga0099824_1018590 Ga0099824_10185905 142
220 3300009176 Ga0105242_10078608 Ga0105242_100786085 142
221 3300010375 Ga0105239_11742366 Ga0105239_117423662 142
222 3300011119 Ga0105246_10559936 Ga0105246_105599362 142
223 3300013306 Ga0163162_10384607 Ga0163162_103846073 142
224 3300017792 Ga0163161_10330899 Ga0163161_103308992 142
225 3300025261 Ga0209233_1001858 Ga0209233_10018587 142
226 3300025906 Ga0207699_10377963 Ga0207699_103779632 142
227 3300025915 Ga0207693_10029787 Ga0207693_100297874 142
228 3300025934 Ga0207686_10151280 Ga0207686_101512802 142
229 3300025939 Ga0207665_10231471 Ga0207665_102314712 142
230 3300025972 Ga0207668_10639937 Ga0207668_106399372 142
231 3300026088 Ga0207641_11298935 Ga0207641_112989352 142
232 3300027357 Ga0209589_1000003 Ga0209589_1000003202 142
233 3300027361 Ga0209489_100003 Ga0209489_100003253 142
234 3300027363 Ga0209700_100003 Ga0209700_100003253 142
235 3300031507 Ga0307509_10446746 Ga0307509_104467462 142
236 3300031616 Ga0307508_10474027 Ga0307508_104740272 142
237 3300033442 Ga0315911_1000001 Ga0315911_1000001647 142
238 3300035116 Ga0373945_0499085 Ga0373945_0499085_80_514 142
239 3300035170 Ga0373943_0046879 Ga0373943_0046879_1459_1893 142
240 3300035171 Ga0373946_0036121 Ga0373946_0036121_916_1350 142
241 3300035695 Ga0373927_0048772 Ga0373927_0048772_1009_1443 142
242 3300035725 Ga0373947_0044146 Ga0373947_0044146_1775_2209 142
243 3300037068 Ga0373925_0614657 Ga0373925_0614657_389_823 142
244 3300038443 Ga0395901_0500065 Ga0395901_0500065_70_543 142
245 3300041486 Ga0451807_0998415 Ga0451807_0998415_187_627 142
246 3300041512 Ga0451853_0062218 Ga0451853_0062218_55_495 142
247 3300046455 Ga0495603_0340133 Ga0495603_0340133_357_791 142
248 3300047315 Ga0495581_0562152 Ga0495581_0562152_115_549 142
249 3300047320 Ga0495672_0023877 Ga0495672_0023877_2846_3289 142
250 3300047472 Ga0495686_0544795 Ga0495686_0544795_35_469 142
251 3300048905 Ga0496102_1359942 Ga0496102_1359942_127_564 142
252 3300048909 Ga0496106_0466490 Ga0496106_0466490_321_755 142
253 3300048910 Ga0496107_0308223 Ga0496107_0308223_226_666 142
254 3300048910 Ga0496107_0990049 Ga0496107_0990049_106_543 142
255 3300048911 Ga0496108_1713011 Ga0496108_1713011_49_486 142
256 3300048918 Ga0496115_1329174 Ga0496115_1329174_32_466 142
257 3300048924 Ga0496121_0003622 Ga0496121_0003622_5443_5886 142
258 3300048924 Ga0496121_0364056 Ga0496121_0364056_25_465 142
259 3300048925 Ga0496122_0174916 Ga0496122_0174916_75_509 142
260 3300048929 Ga0496126_0003918 Ga0496126_0003918_1784_2218 142
261 3300048929 Ga0496126_0013307 Ga0496126_0013307_7432_7866 142
262 3300048929 Ga0496126_0324731 Ga0496126_0324731_445_885 142
263 3300053119 Ga0500595_007366 Ga0500595_007366_1613_2056 142
264 3300053139 Ga0500568_0020463 Ga0500568_0020463_666_1109 142
265 3300005329 Ga0070683_100048659 Ga0070683_1000486592 143
266 3300005330 Ga0070690_100182738 Ga0070690_1001827382 143
267 3300005331 Ga0070670_100510501 Ga0070670_1005105012 143
268 3300005334 Ga0068869_100405762 Ga0068869_1004057622 143
269 3300005344 Ga0070661_100916672 Ga0070661_1009166722 143
270 3300005367 Ga0070667_100974795 Ga0070667_1009747952 143
271 3300005435 Ga0070714_100235627 Ga0070714_1002356272 143
272 3300005437 Ga0070710_10104663 Ga0070710_101046632 143
273 3300005455 Ga0070663_100722097 Ga0070663_1007220972 143
274 3300005458 Ga0070681_10060782 Ga0070681_100607825 143
275 3300005459 Ga0068867_100374146 Ga0068867_1003741461 143
276 3300005459 Ga0068867_101305600 Ga0068867_1013056001 143
277 3300005530 Ga0070679_100230907 Ga0070679_1002309073 143
278 3300005535 Ga0070684_100107204 Ga0070684_1001072045 143
279 3300005544 Ga0070686_100493512 Ga0070686_1004935122 143
280 3300005548 Ga0070665_100728482 Ga0070665_1007284822 143
281 3300005563 Ga0068855_100153494 Ga0068855_1001534943 143
282 3300005616 Ga0068852_100246793 Ga0068852_1002467931 143
283 3300005983 Ga0081540_1031911 Ga0081540_10319113 143
284 3300006038 Ga0075365_10262088 Ga0075365_102620882 143
285 3300006038 Ga0075365_10855682 Ga0075365_108556822 143
286 3300006048 Ga0075363_100101253 Ga0075363_1001012532 143
287 3300006048 Ga0075363_100330043 Ga0075363_1003300432 143
288 3300006048 Ga0075363_100537356 Ga0075363_1005373562 143
289 3300006175 Ga0070712_100394634 Ga0070712_1003946342 143
290 3300006195 Ga0075366_10610022 Ga0075366_106100222 143
291 3300006237 Ga0097621_100122553 Ga0097621_1001225532 143
292 3300006237 Ga0097621_101036087 Ga0097621_1010360872 143
293 3300006353 Ga0075370_10318335 Ga0075370_103183352 143
294 3300006358 Ga0068871_101193301 Ga0068871_1011933012 143
295 3300006943 Ga0099822_1037903 Ga0099822_10379032 143
296 3300009093 Ga0105240_10094106 Ga0105240_100941062 143
297 3300009098 Ga0105245_12415109 Ga0105245_124151091 143
298 3300009148 Ga0105243_11640991 Ga0105243_116409912 143
299 3300009176 Ga0105242_11215289 Ga0105242_112152892 143
300 3300009176 Ga0105242_11244830 Ga0105242_112448301 143
301 3300009545 Ga0105237_10084963 Ga0105237_100849632 143
302 3300009545 Ga0105237_11553489 Ga0105237_115534891 143
303 3300009545 Ga0105237_12578358 Ga0105237_125783581 143
304 3300009551 Ga0105238_10391614 Ga0105238_103916143 143
305 3300009551 Ga0105238_11719849 Ga0105238_117198492 143
306 3300010375 Ga0105239_10080550 Ga0105239_100805506 143
307 3300011119 Ga0105246_10785265 Ga0105246_107852652 143
308 3300013104 Ga0157370_10023094 Ga0157370_100230946 143
309 3300013296 Ga0157374_10089354 Ga0157374_100893543 143
310 3300013296 Ga0157374_12295848 Ga0157374_122958481 143
311 3300013306 Ga0163162_10141312 Ga0163162_101413123 143
312 3300013308 Ga0157375_10046830 Ga0157375_100468305 143
313 3300014325 Ga0163163_10136031 Ga0163163_101360312 143
314 3300014745 Ga0157377_10516633 Ga0157377_105166331 143
315 3300014968 Ga0157379_10155166 Ga0157379_101551663 143
316 3300014968 Ga0157379_10687100 Ga0157379_106871002 143
317 3300014969 Ga0157376_10014758 Ga0157376_100147585 143
318 3300017792 Ga0163161_10892627 Ga0163161_108926272 143
319 3300021377 Ga0213874_10286314 Ga0213874_102863142 143
320 3300025315 Ga0207697_10100384 Ga0207697_101003842 143
321 3300025901 Ga0207688_10074641 Ga0207688_100746412 143
322 3300025912 Ga0207707_10232425 Ga0207707_102324252 143
323 3300025913 Ga0207695_11272478 Ga0207695_112724782 143
324 3300025914 Ga0207671_10341583 Ga0207671_103415833 143
325 3300025915 Ga0207693_10245635 Ga0207693_102456353 143
326 3300025917 Ga0207660_10405350 Ga0207660_104053502 143
327 3300025921 Ga0207652_10120576 Ga0207652_101205763 143
328 3300025927 Ga0207687_10299650 Ga0207687_102996502 143
329 3300025929 Ga0207664_10603305 Ga0207664_106033052 143
330 3300025939 Ga0207665_10506720 Ga0207665_105067202 143
331 3300025940 Ga0207691_10361595 Ga0207691_103615952 143
332 3300025941 Ga0207711_10343584 Ga0207711_103435842 143
333 3300025944 Ga0207661_10231656 Ga0207661_102316563 143
334 3300025945 Ga0207679_10419543 Ga0207679_104195432 143
335 3300025949 Ga0207667_10037831 Ga0207667_100378314 143
336 3300025986 Ga0207658_10649212 Ga0207658_106492122 143
337 3300026067 Ga0207678_10068408 Ga0207678_100684085 143
338 3300026078 Ga0207702_11796912 Ga0207702_117969122 143
339 3300026089 Ga0207648_10080467 Ga0207648_100804675 143
340 3300026142 Ga0207698_10041587 Ga0207698_100415871 143
341 3300027866 Ga0209813_10295063 Ga0209813_102950632 143
342 3300028379 Ga0268266_10543548 Ga0268266_105435482 143
343 3300028379 Ga0268266_10601345 Ga0268266_106013452 143
344 3300031711 Ga0265314_10094982 Ga0265314_100949823 143
345 3300031730 Ga0307516_10002141 Ga0307516_1000214111 143
346 3300031824 Ga0307413_12139991 Ga0307413_121399912 143
347 3300031911 Ga0307412_10199331 Ga0307412_101993313 143
348 3300035085 Ga0373929_0058818 Ga0373929_0058818_280_720 143
349 3300035171 Ga0373946_0198529 Ga0373946_0198529_198_638 143
350 3300039450 Ga0436363_0587449 Ga0436363_0587449_233_673 143
351 3300041453 Ga0451797_0535575 Ga0451797_0535575_199_639 143
352 3300041509 Ga0451843_1483276 Ga0451843_1483276_259_690 143
353 3300046462 Ga0495651_0548754 Ga0495651_0548754_204_644 143
354 3300046475 Ga0495639_0453996 Ga0495639_0453996_48_488 143
355 3300046507 Ga0495606_0298093 Ga0495606_0298093_376_816 143
356 3300046514 Ga0495618_0376222 Ga0495618_0376222_283_723 143
357 3300046517 Ga0495630_0210976 Ga0495630_0210976_983_1423 143
358 3300046528 Ga0495642_0134997 Ga0495642_0134997_447_887 143
359 3300046533 Ga0495640_0358160 Ga0495640_0358160_216_656 143
360 3300046616 Ga0495668_0049858 Ga0495668_0049858_1552_1992 143
361 3300046679 Ga0495623_0086264 Ga0495623_0086264_1465_1905 143
362 3300046690 Ga0495624_0273560 Ga0495624_0273560_196_636 143
363 3300047445 Ga0495677_0169315 Ga0495677_0169315_14_454 143
364 3300048088 Ga0495602_0284758 Ga0495602_0284758_560_1000 143
365 3300048906 Ga0496103_0062010 Ga0496103_0062010_1012_1443 143
366 3300048907 Ga0496104_1882953 Ga0496104_1882953_13_453 143
367 3300048908 Ga0496105_0020951 Ga0496105_0020951_1022_1453 143
368 3300048909 Ga0496106_0288120 Ga0496106_0288120_569_1000 143
369 3300048910 Ga0496107_0018488 Ga0496107_0018488_2967_3398 143
370 3300048911 Ga0496108_0069780 Ga0496108_0069780_1797_2228 143
371 3300048912 Ga0496109_0074404 Ga0496109_0074404_1427_1858 143
372 3300048913 Ga0496110_0031895 Ga0496110_0031895_2506_2937 143
373 3300048914 Ga0496111_0172837 Ga0496111_0172837_632_1063 143
374 3300048917 Ga0496114_0024702 Ga0496114_0024702_1084_1515 143
375 3300048918 Ga0496115_0006501 Ga0496115_0006501_3679_4110 143
376 3300049460 Ga0495682_0280926 Ga0495682_0280926_117_557 143
377 3300050490 nmdc:mga03n38_30616_c1 nmdc:mga03n38_30616_c1_115_555 143
378 3300050492 nmdc:mga0yw44_187354_c1 nmdc:mga0yw44_187354_c1_77_517 143
379 3300050493 nmdc:mga0k408_581348_c1 nmdc:mga0k408_581348_c1_156_596 143
380 3300050494 nmdc:mga06z11_356778_c1 nmdc:mga06z11_356778_c1_352_792 143
381 3300050495 nmdc:mga04h51_330499_c1 nmdc:mga04h51_330499_c1_156_596 143
382 3300053077 Ga0495601_0172296 Ga0495601_0172296_656_1096 143
383 3300053078 Ga0495612_0481528 Ga0495612_0481528_81_521 143
384 3300053079 Ga0500610_0335562 Ga0500610_0335562_178_618 143

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lw8-assembly1.cif.gz_A nmr solution structure of helicobacter pylori tonb-ctd (residues 194-285) 0.6658 32 125
1tol-assembly1.cif.gz_A fusion of n-terminal domain of the minor coat protein from gene iii in phage m13, and c-terminal domain of e. coli protein-tola 0.6527 37 123
7zc8-assembly1.cif.gz_B crystal structure of the c-terminal domain of fusb, a tonb homologue 0.6327 44 123
5lw8-assembly1.cif.gz_A nmr solution structure of helicobacter pylori tonb-ctd (residues 194-285) 0.6157 32 125
3qdr-assembly1.cif.gz_A structural characterization of the interaction of colicin a, colicin n, and tolb with the tolaiii translocon 0.6145 35 123
ID Description Score Start End Superfamily
af_Q4DRR0_31_165_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6955 49 78 2.60.120.200
af_A0A1D6H212_50_143_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.6777 68 99 3.90.1150.10
3qdpA00 Alpha Beta;2-Layer Sandwich;Fusion Protein Consisting Of Minor Coat Protein, Glycine Rich Linker, Tola, And A His Tag; Chain: A; Domain 2; 0.6257 31 123 3.30.1150.10
af_A4HWC2_27_146_2.60.120.230 Mainly Beta;Sandwich;Jelly Rolls; 0.6099 43 81 2.60.120.230
1u07A00 Alpha Beta;2-Layer Sandwich;TolA/TonB C-terminal domain;TonB 0.6088 52 93 3.30.2420.10
ID Description Score Start End GO Terms
AF-A0A0S3PXK8-F1-model_v4 Gram-negative bacterial tonB protein 0.943 25 123
AF-A0A258CT68-F1-model_v4 TonB C-terminal domain-containing protein 0.9426 56 126
AF-A0A1M3NSZ7-F1-model_v4 TonB C-terminal domain-containing protein 0.9389 28 122
AF-A0A4R3TS82-F1-model_v4 Uncharacterized protein 0.9384 57 126
AF-A0A2V2RI18-F1-model_v4 deleted 0.9377 25 123

Feature Viewer

pLDDT pTM Quality
83.48 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map