F429908

General Info

Members Datasets Scaffolds Average Seq Length
384 203 768 205

Family's Representative Sequence

Representative Sequence 3300024227|Ga0228598_1019549|Ga0228598_10195492
Length 237
Sequence VICPRDGCRVEWKVEKHLERNQIGATMSSLFPMFVKLEGKRCLVVGAGKVGEPKIHGLIDTGARIHVIALEASEAVHEWANAGKITLEVRAFDAGDLEGTFLTVVATPSRVLNGSIYREAQRRGVLCNVVDDPEYCDFYYPAVVRRGDLQIAISTNGQSPSLAQKLRQQLERQFGPGYAQWVAELGETRRLVLASDLDPQRKSDLLHSLASREALNAALAEQAAKEESAKDDRRVTV

Samples

Sample ID Description Type Environment
1 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
84 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
85 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
130 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
162 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
165 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
166 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 2.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.86
Rhizosphere 96.35
Stem 0
Stem Tuber 0
Unclassified 27.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0228598_1019549 3300024227 Bacteria 1334
2 LJNas_1001020 3300000546 Bacteria 4441
3 Ga0068869_100040722 3300005334 Unclassified 3324
4 Ga0068869_100304925 3300005334 Bacteria 1287
5 Ga0070666_10119810 3300005335 Unclassified 1824
6 Ga0070680_100264552 3300005336 Unclassified 1455
7 Ga0070682_100017845 3300005337 Unclassified 4140
8 Ga0068868_100001499 3300005338 Bacteria 16091
9 Ga0068868_100210834 3300005338 Bacteria 1623
10 Ga0068868_100211948 3300005338 Bacteria 1619
11 Ga0070660_100094963 3300005339 Unclassified 2356
12 Ga0070661_100058280 3300005344 Unclassified 2830
13 Ga0070668_100028548 3300005347 Unclassified 4235
14 Ga0070669_100434064 3300005353 Bacteria 1080
15 Ga0070671_100216275 3300005355 Bacteria 1626
16 Ga0070667_100099053 3300005367 Bacteria 2516
17 Ga0070709_10064414 3300005434 Bacteria 2344
18 Ga0070709_10256077 3300005434 Unclassified 1263
19 Ga0070714_100000085 3300005435 Bacteria 79813
20 Ga0070714_100050027 3300005435 Bacteria 3558
21 Ga0070714_100065282 3300005435 Bacteria 3135
22 Ga0070714_100174741 3300005435 Bacteria 1951
23 Ga0070713_100000125 3300005436 Bacteria 50351
24 Ga0070713_100001364 3300005436 Bacteria 15622
25 Ga0070713_100017878 3300005436 Bacteria 5378
26 Ga0070713_100019028 3300005436 Bacteria 5230
27 Ga0070713_100026793 3300005436 Unclassified 4532
28 Ga0070713_100027446 3300005436 Bacteria 4482
29 Ga0070713_100057584 3300005436 Unclassified 3237
30 Ga0070713_100062274 3300005436 Unclassified 3124
31 Ga0070713_100139876 3300005436 Bacteria 2143
32 Ga0070713_100171739 3300005436 Bacteria 1942
33 Ga0070713_100528835 3300005436 Unclassified 1115
34 Ga0070710_10012784 3300005437 Bacteria 4180
35 Ga0070710_10132481 3300005437 Bacteria 1521
36 Ga0070710_10198160 3300005437 Bacteria 1266
37 Ga0070701_10403052 3300005438 Unclassified 867
38 Ga0070711_100000242 3300005439 Bacteria 28114
39 Ga0070711_100001023 3300005439 Bacteria 14886
40 Ga0070711_100024458 3300005439 Unclassified 3939
41 Ga0070711_100101052 3300005439 Bacteria 2098
42 Ga0070711_100517994 3300005439 Bacteria 985
43 Ga0070708_100026229 3300005445 Bacteria 4986
44 Ga0070708_100158013 3300005445 Bacteria 2111
45 Ga0070708_100247290 3300005445 Bacteria 1675
46 Ga0070708_100456081 3300005445 Bacteria 1206
47 Ga0070708_100503303 3300005445 Bacteria 1143
48 Ga0070663_100073183 3300005455 Unclassified 2499
49 Ga0070662_100000637 3300005457 Bacteria 21215
50 Ga0070681_10037475 3300005458 Bacteria 4865
51 Ga0070681_10125414 3300005458 Bacteria 2500
52 Ga0070681_10469634 3300005458 Unclassified 1171
53 Ga0070706_100000811 3300005467 Bacteria 34629
54 Ga0070706_100213146 3300005467 Bacteria 1803
55 Ga0070706_100353983 3300005467 Unclassified 1368
56 Ga0070707_100098257 3300005468 Bacteria 2836
57 Ga0070707_100331696 3300005468 Bacteria 1478
58 Ga0070707_100533957 3300005468 Bacteria 1135
59 Ga0070698_100023847 3300005471 Bacteria 6389
60 Ga0070698_100430574 3300005471 Bacteria 1254
61 Ga0070699_100019868 3300005518 Bacteria 5791
62 Ga0070699_100307866 3300005518 Bacteria 1422
63 Ga0070679_100257964 3300005530 Bacteria 1699
64 Ga0070679_100292622 3300005530 Bacteria 1580
65 Ga0070679_100649607 3300005530 Bacteria 997
66 Ga0070684_100123260 3300005535 Bacteria 2332
67 Ga0070684_100627833 3300005535 Bacteria 999
68 Ga0070697_100000282 3300005536 Bacteria 41048
69 Ga0068853_100080676 3300005539 Unclassified 2847
70 Ga0070695_100180645 3300005545 Bacteria 1495
71 Ga0070696_100130173 3300005546 Bacteria 1830
72 Ga0070696_100252022 3300005546 Bacteria 1335
73 Ga0070693_100030979 3300005547 Bacteria 2928
74 Ga0070693_100073784 3300005547 Unclassified 2016
75 Ga0070665_100144547 3300005548 Unclassified 2382
76 Ga0068855_100092040 3300005563 Unclassified 3497
77 Ga0068855_100128992 3300005563 Unclassified 2889
78 Ga0068855_100688984 3300005563 Bacteria 1094
79 Ga0068857_100112325 3300005577 Unclassified 2449
80 Ga0068854_100141216 3300005578 Unclassified 1848
81 Ga0068856_100068914 3300005614 Unclassified 3497
82 Ga0068856_100082431 3300005614 Unclassified 3192
83 Ga0070702_100130975 3300005615 Bacteria 1584
84 Ga0070702_100172257 3300005615 Unclassified 1409
85 Ga0068859_100037326 3300005617 Bacteria 4876
86 Ga0068864_100226133 3300005618 Unclassified 1728
87 Ga0068866_10182402 3300005718 Bacteria 1241
88 Ga0068861_100565912 3300005719 Bacteria 1038
89 Ga0068863_100021951 3300005841 Bacteria 6091
90 Ga0068863_100055191 3300005841 Bacteria 3763
91 Ga0068863_101190734 3300005841 Unclassified 768
92 Ga0068858_100080253 3300005842 Unclassified 3031
93 Ga0068858_100109553 3300005842 Bacteria 2578
94 Ga0068860_100125623 3300005843 Unclassified 2458
95 Ga0068860_100796284 3300005843 Bacteria 958
96 Ga0068862_100485217 3300005844 Bacteria 1170
97 Ga0070717_10021145 3300006028 Bacteria 5126
98 Ga0070717_10024346 3300006028 Bacteria 4806
99 Ga0070717_10052231 3300006028 Bacteria 3366
100 Ga0070717_10060243 3300006028 Bacteria 3143
101 Ga0070717_10093105 3300006028 Bacteria 2547
102 Ga0070717_10146451 3300006028 Bacteria 2040
103 Ga0070717_10156941 3300006028 Bacteria 1972
104 Ga0070717_10164605 3300006028 Bacteria 1926
105 Ga0070717_10636237 3300006028 Bacteria 968
106 Ga0070715_10000779 3300006163 Bacteria 8634
107 Ga0070715_10040395 3300006163 Bacteria 1950
108 Ga0070716_100015296 3300006173 Bacteria 3940
109 Ga0070716_100022363 3300006173 Bacteria 3341
110 Ga0070716_100032377 3300006173 Bacteria 2851
111 Ga0070716_100337183 3300006173 Bacteria 1062
112 Ga0070716_100378880 3300006173 Unclassified 1010
113 Ga0070712_100000067 3300006175 Bacteria 53056
114 Ga0070712_100001219 3300006175 Bacteria 15564
115 Ga0070712_100001661 3300006175 Bacteria 13613
116 Ga0097621_100005223 3300006237 Bacteria 9133
117 Ga0097621_100046998 3300006237 Unclassified 3495
118 Ga0097621_100068139 3300006237 Bacteria 2934
119 Ga0068871_100002547 3300006358 Bacteria 12437
120 Ga0068871_100007018 3300006358 Bacteria 8026
121 Ga0075434_100006904 3300006871 Bacteria 10460
122 Ga0075434_100059716 3300006871 Bacteria 3791
123 Ga0075434_100162375 3300006871 Bacteria 2254
124 Ga0075436_100001052 3300006914 Bacteria 18604
125 Ga0075436_100128156 3300006914 Bacteria 1778
126 Ga0075436_100185488 3300006914 Bacteria 1471
127 Ga0097620_100037327 3300006931 Bacteria 4876
128 Ga0075435_100113432 3300007076 Bacteria 2256
129 Ga0075435_100335479 3300007076 Bacteria 1295
130 Ga0099795_10014496 3300007788 Unclassified 2446
131 Ga0105240_10021385 3300009093 Bacteria 8605
132 Ga0105240_10032517 3300009093 Bacteria 6754
133 Ga0105240_10091681 3300009093 Bacteria 3712
134 Ga0105240_10655681 3300009093 Bacteria 1150
135 Ga0105240_11345069 3300009093 Unclassified 752
136 Ga0105245_10457043 3300009098 Unclassified 1286
137 Ga0105247_10369811 3300009101 Bacteria 1013
138 Ga0105243_10790129 3300009148 Unclassified 934
139 Ga0105241_10072878 3300009174 Unclassified 2670
140 Ga0105241_11419418 3300009174 Unclassified 665
141 Ga0105242_10018352 3300009176 Bacteria 5467
142 Ga0105248_10120925 3300009177 Unclassified 2954
143 Ga0105237_10107454 3300009545 Bacteria 2782
144 Ga0105238_10635126 3300009551 Unclassified 1077
145 Ga0105249_10009943 3300009553 Bacteria 8344
146 Ga0105239_10240991 3300010375 Bacteria 2029
147 Ga0105239_10265526 3300010375 Unclassified 1930
148 Ga0105239_10391218 3300010375 Bacteria 1573
149 Ga0157373_10058970 3300013100 Bacteria 2720
150 Ga0157373_10155480 3300013100 Unclassified 1609
151 Ga0157373_10166370 3300013100 Bacteria 1552
152 Ga0157373_10566032 3300013100 Unclassified 825
153 Ga0157371_10036409 3300013102 Bacteria 3524
154 Ga0157371_10293339 3300013102 Bacteria 1176
155 Ga0157369_10098454 3300013105 Bacteria 3119
156 Ga0157369_10934562 3300013105 Bacteria 889
157 Ga0157374_10008117 3300013296 Bacteria 8972
158 Ga0157374_10030067 3300013296 Unclassified 4929
159 Ga0157374_10062016 3300013296 Unclassified 3503
160 Ga0157374_10085092 3300013296 Unclassified 3006
161 Ga0157374_10530207 3300013296 Bacteria 1184
162 Ga0157378_10042320 3300013297 Bacteria 4043
163 Ga0157378_10056327 3300013297 Unclassified 3503
164 Ga0157378_10115158 3300013297 Bacteria 2470
165 Ga0157378_10309612 3300013297 Bacteria 1531
166 Ga0163162_10003176 3300013306 Bacteria 15711
167 Ga0163162_10003288 3300013306 Bacteria 15465
168 Ga0163162_10033156 3300013306 Bacteria 5130
169 Ga0157372_10010660 3300013307 Bacteria 9776
170 Ga0157372_10089195 3300013307 Unclassified 3503
171 Ga0157372_10231279 3300013307 Unclassified 2143
172 Ga0157372_11777216 3300013307 Unclassified 709
173 Ga0157375_10543014 3300013308 Unclassified 1324
174 Ga0163163_10151449 3300014325 Unclassified 2363
175 Ga0163163_10265312 3300014325 Bacteria 1768
176 Ga0163163_10509793 3300014325 Unclassified 1265
177 Ga0157379_10113044 3300014968 Bacteria 2440
178 Ga0157379_10228100 3300014968 Bacteria 1688
179 Ga0157376_10089022 3300014969 Bacteria 2668
180 Ga0157376_10560043 3300014969 Bacteria 1132
181 Ga0182005_1090293 3300015265 Bacteria 851
182 Ga0224570_100283 3300022730 Bacteria 3829
183 Ga0224571_106322 3300022734 Unclassified 788
184 Ga0224572_1004998 3300024225 Bacteria 2345
185 Ga0224572_1015195 3300024225 Bacteria 1472
186 Ga0224572_1018468 3300024225 Bacteria 1340
187 Ga0228598_1000075 3300024227 Bacteria 15071
188 Ga0207692_10049665 3300025898 Bacteria 2118
189 Ga0207642_10138947 3300025899 Bacteria 1278
190 Ga0207710_10099710 3300025900 Bacteria 1368
191 Ga0207685_10000405 3300025905 Bacteria 7112
192 Ga0207699_10000327 3300025906 Bacteria 25260
193 Ga0207699_10008330 3300025906 Bacteria 5111
194 Ga0207699_10020674 3300025906 Bacteria 3533
195 Ga0207699_10097418 3300025906 Bacteria 1859
196 Ga0207699_10137421 3300025906 Unclassified 1602
197 Ga0207645_10199988 3300025907 Unclassified 1314
198 Ga0207684_10002531 3300025910 Bacteria 18371
199 Ga0207684_10075851 3300025910 Bacteria 2858
200 Ga0207654_10047414 3300025911 Unclassified 2455
201 Ga0207707_10024276 3300025912 Bacteria 5306
202 Ga0207707_10192239 3300025912 Bacteria 1780
203 Ga0207695_10006844 3300025913 Bacteria 14679
204 Ga0207695_10040769 3300025913 Bacteria 4974
205 Ga0207671_10015558 3300025914 Bacteria 5952
206 Ga0207671_10112916 3300025914 Bacteria 2069
207 Ga0207693_10000160 3300025915 Bacteria 62687
208 Ga0207693_10000252 3300025915 Bacteria 49630
209 Ga0207693_10001575 3300025915 Bacteria 20159
210 Ga0207693_10012108 3300025915 Bacteria 6974
211 Ga0207693_10043671 3300025915 Bacteria 3524
212 Ga0207693_10602285 3300025915 Unclassified 855
213 Ga0207663_10001186 3300025916 Bacteria 12025
214 Ga0207663_10003158 3300025916 Bacteria 8009
215 Ga0207663_10017427 3300025916 Unclassified 4002
216 Ga0207663_10089646 3300025916 Bacteria 2037
217 Ga0207660_10493939 3300025917 Bacteria 993
218 Ga0207657_10000343 3300025919 Bacteria 49280
219 Ga0207649_10104926 3300025920 Unclassified 1877
220 Ga0207652_10021306 3300025921 Bacteria 5349
221 Ga0207652_10191470 3300025921 Bacteria 1840
222 Ga0207652_10628732 3300025921 Unclassified 961
223 Ga0207646_10048833 3300025922 Bacteria 3792
224 Ga0207646_10405986 3300025922 Bacteria 1230
225 Ga0207646_10575092 3300025922 Unclassified 1012
226 Ga0207646_11027280 3300025922 Bacteria 728
227 Ga0207694_10341940 3300025924 Bacteria 1237
228 Ga0207694_10451133 3300025924 Unclassified 1074
229 Ga0207687_10012503 3300025927 Bacteria 5545
230 Ga0207700_10005900 3300025928 Bacteria 7364
231 Ga0207700_10020858 3300025928 Bacteria 4461
232 Ga0207700_10042316 3300025928 Bacteria 3339
233 Ga0207700_10053087 3300025928 Unclassified 3034
234 Ga0207700_10076060 3300025928 Bacteria 2604
235 Ga0207700_10093378 3300025928 Bacteria 2381
236 Ga0207700_10247534 3300025928 Bacteria 1521
237 Ga0207700_10461179 3300025928 Bacteria 1121
238 Ga0207664_10000179 3300025929 Bacteria 49014
239 Ga0207664_10101759 3300025929 Bacteria 2375
240 Ga0207706_10001333 3300025933 Bacteria 24708
241 Ga0207686_10460127 3300025934 Bacteria 980
242 Ga0207670_10213933 3300025936 Bacteria 1472
243 Ga0207665_10000743 3300025939 Bacteria 21958
244 Ga0207665_10006159 3300025939 Bacteria 7967
245 Ga0207665_10018071 3300025939 Bacteria 4633
246 Ga0207665_10035948 3300025939 Bacteria 3291
247 Ga0207665_10054187 3300025939 Bacteria 2704
248 Ga0207711_10000528 3300025941 Bacteria 39213
249 Ga0207689_10047875 3300025942 Bacteria 3527
250 Ga0207689_10127272 3300025942 Bacteria 2095
251 Ga0207679_10041593 3300025945 Unclassified 3297
252 Ga0207667_10002363 3300025949 Bacteria 23638
253 Ga0207667_10019886 3300025949 Bacteria 7481
254 Ga0207667_10350442 3300025949 Bacteria 1506
255 Ga0207712_10126663 3300025961 Unclassified 1940
256 Ga0207668_10124391 3300025972 Unclassified 1958
257 Ga0207640_10022691 3300025981 Unclassified 3760
258 Ga0207640_10109929 3300025981 Bacteria 1951
259 Ga0207658_10085478 3300025986 Bacteria 2430
260 Ga0207677_10037935 3300026023 Bacteria 3154
261 Ga0207677_10064070 3300026023 Bacteria 2558
262 Ga0207703_10071679 3300026035 Bacteria 2862
263 Ga0207703_10118060 3300026035 Unclassified 2273
264 Ga0207678_10008808 3300026067 Bacteria 8880
265 Ga0207702_10002110 3300026078 Bacteria 19148
266 Ga0207702_10050532 3300026078 Unclassified 3511
267 Ga0207641_10006333 3300026088 Bacteria 9998
268 Ga0207641_10018658 3300026088 Bacteria 5687
269 Ga0207641_10980775 3300026088 Unclassified 841
270 Ga0207676_10146742 3300026095 Unclassified 2027
271 Ga0207674_10182522 3300026116 Unclassified 2049
272 Ga0207675_100019478 3300026118 Bacteria 6332
273 Ga0207698_10270481 3300026142 Bacteria 1566
274 Ga0265356_1004024 3300028017 Bacteria 1816
275 Ga0265356_1004685 3300028017 Bacteria 1658
276 Ga0265355_1001264 3300028036 Bacteria 1603
277 Ga0268266_10098006 3300028379 Unclassified 2579
278 Ga0268264_10320640 3300028381 Unclassified 1465
279 Ga0268264_10470435 3300028381 Bacteria 1221
280 Ga0265338_10000762 3300028800 Bacteria 54962
281 Ga0265338_10093169 3300028800 Bacteria 2483
282 Ga0265338_10279022 3300028800 Bacteria 1221
283 Ga0265762_1000129 3300030760 Bacteria 11439
284 Ga0265762_1004823 3300030760 Bacteria 2415
285 Ga0265770_1019818 3300030878 Bacteria 1058
286 Ga0265765_1008452 3300030879 Unclassified 1122
287 Ga0265771_1005631 3300031010 Unclassified 803
288 Ga0265760_10000082 3300031090 Bacteria 24708
289 Ga0265760_10023205 3300031090 Bacteria 1802
290 Ga0265760_10170770 3300031090 Unclassified 722
291 Ga0265330_10006351 3300031235 Bacteria 5843
292 Ga0265325_10021840 3300031241 Bacteria 3510
293 Ga0265340_10034585 3300031247 Bacteria 2512
294 Ga0265340_10079026 3300031247 Bacteria 1551
295 Ga0265340_10121047 3300031247 Bacteria 1204
296 Ga0265339_10024369 3300031249 Bacteria 3487
297 Ga0265339_10025187 3300031249 Bacteria 3418
298 Ga0265339_10043151 3300031249 Bacteria 2495
299 Ga0265316_10027437 3300031344 Bacteria 4715
300 Ga0265314_10002351 3300031711 Bacteria 19515
301 Ga0265314_10017920 3300031711 Bacteria 5543
302 Ga0265314_10154267 3300031711 Bacteria 1404
303 Ga0316214_1015909 3300033545 Bacteria 1039
304 Ga0373934_0083661 3300035086 Unclassified 1283
305 Ga0373923_0039099 3300035111 Unclassified 1947
306 Ga0373923_0103231 3300035111 Unclassified 1259
307 Ga0373923_0131831 3300035111 Bacteria 1124
308 Ga0373936_0002893 3300035113 Bacteria 6410
309 Ga0373936_0006130 3300035113 Bacteria 4528
310 Ga0373945_0007969 3300035116 Unclassified 3439
311 Ga0373945_0054590 3300035116 Bacteria 1477
312 Ga0373945_0308446 3300035116 Bacteria 679
313 Ga0373954_0072930 3300035118 Unclassified 1633
314 Ga0373956_0135684 3300035119 Unclassified 1154
315 Ga0373957_0015949 3300035120 Unclassified 2594
316 Ga0373943_0001007 3300035170 Bacteria 12527
317 Ga0373955_0185484 3300035172 Unclassified 1235
318 Ga0373931_0071653 3300035691 Unclassified 1893
319 Ga0373935_0000847 3300035692 Bacteria 16465
320 Ga0373935_0013183 3300035692 Bacteria 4984
321 Ga0373927_0000150 3300035695 Bacteria 54680
322 Ga0373927_0026022 3300035695 Unclassified 3825
323 Ga0373927_0082760 3300035695 Bacteria 2081
324 Ga0373933_0053038 3300035724 Bacteria 2428
325 Ga0373933_0061808 3300035724 Unclassified 2260
326 Ga0373947_0000459 3300035725 Bacteria 23262
327 Ga0373947_0160967 3300035725 Unclassified 1452
328 Ga0373937_0066510 3300036401 Unclassified 3319
329 Ga0373937_0257922 3300036401 Unclassified 1644
330 Ga0316582_0136881 3300036647 Bacteria 1649
331 Ga0316582_0434936 3300036647 Unclassified 904
332 Ga0316584_0208225 3300036712 Unclassified 1440
333 Ga0373925_0000673 3300037068 Bacteria 32089
334 Ga0373925_0006117 3300037068 Bacteria 8895
335 Ga0373925_0078453 3300037068 Bacteria 2508
336 Ga0242420_009530 3300038996 Bacteria 1595
337 Ga0400483_135423 3300039062 Bacteria 1333
338 Ga0400489_10544 3300039093 Bacteria 1303
339 Ga0466964_0011562 3300044706 Bacteria 3336
340 Ga0453684_0271143 3300044712 Bacteria 1939
341 Ga0466958_0330042 3300045836 Bacteria 981
342 Ga0495592_0533360 3300046454 Bacteria 724
343 Ga0495653_0244470 3300046463 Unclassified 1194
344 Ga0495580_0009801 3300046472 Bacteria 7512
345 Ga0495582_0001119 3300046473 Bacteria 15067
346 Ga0495664_0015084 3300046477 Bacteria 4390
347 Ga0495664_0131318 3300046477 Bacteria 1516
348 Ga0495608_0110814 3300046511 Unclassified 1765
349 Ga0495618_0333806 3300046514 Bacteria 937
350 Ga0495628_0221163 3300046516 Bacteria 1422
351 Ga0495630_0035037 3300046517 Bacteria 3751
352 Ga0495630_0080743 3300046517 Bacteria 2454
353 Ga0495630_0178303 3300046517 Bacteria 1620
354 Ga0495630_0509789 3300046517 Bacteria 922
355 Ga0495652_0539287 3300046529 Bacteria 804
356 Ga0495586_0239113 3300046535 Bacteria 1035
357 Ga0495645_0078415 3300046543 Bacteria 2374
358 Ga0495658_0105586 3300046683 Bacteria 1687
359 Ga0495613_0049143 3300046689 Bacteria 3114
360 Ga0495624_0144811 3300046690 Bacteria 1454
361 Ga0495581_0031249 3300047315 Bacteria 3086
362 Ga0495674_0012763 3300047319 Bacteria 7911
363 Ga0495674_0019434 3300047319 Bacteria 6305
364 Ga0495674_0720853 3300047319 Unclassified 781
365 Ga0495684_0031223 3300047471 Bacteria 4090
366 Ga0495602_0072809 3300048088 Unclassified 2928
367 Ga0496101_0171830 3300048904 Bacteria 1666
368 Ga0496102_0084403 3300048905 Unclassified 2931
369 Ga0496103_0183221 3300048906 Unclassified 1346
370 Ga0496104_0974518 3300048907 Unclassified 752
371 Ga0496105_0018561 3300048908 Bacteria 5597
372 Ga0496108_0116728 3300048911 Bacteria 2287
373 Ga0496110_0283757 3300048913 Unclassified 1508
374 Ga0496112_0035554 3300048915 Bacteria 4854
375 Ga0496112_0802731 3300048915 Unclassified 866
376 Ga0496114_0649975 3300048917 Unclassified 927
377 Ga0496115_0312385 3300048918 Bacteria 1287
378 nmdc:mga0n895_315137_c1 3300050512 Bacteria 1585
379 nmdc:mga0rr50_175379_c1 3300050513 Bacteria 1749
380 nmdc:mga08x19_22383_c1 3300050514 Bacteria 3915
381 nmdc:mga08x19_308375_c1 3300050514 Bacteria 1100
382 nmdc:mga08x19_6283_c1 3300050514 Bacteria 7032
383 nmdc:mga0a205_60278_c1 3300050515 Bacteria 3665
384 Ga0495601_0208344 3300053077 Bacteria 1277
385 Ga0228598_1019549
386 LJNas_1001020
387 Ga0068869_100040722
388 Ga0068869_100304925
389 Ga0070666_10119810
390 Ga0070680_100264552
391 Ga0070682_100017845
392 Ga0068868_100001499
393 Ga0068868_100210834
394 Ga0068868_100211948
395 Ga0070660_100094963
396 Ga0070661_100058280
397 Ga0070668_100028548
398 Ga0070669_100434064
399 Ga0070671_100216275
400 Ga0070667_100099053
401 Ga0070709_10064414
402 Ga0070709_10256077
403 Ga0070714_100000085
404 Ga0070714_100050027
405 Ga0070714_100065282
406 Ga0070714_100174741
407 Ga0070713_100000125
408 Ga0070713_100001364
409 Ga0070713_100017878
410 Ga0070713_100019028
411 Ga0070713_100026793
412 Ga0070713_100027446
413 Ga0070713_100057584
414 Ga0070713_100062274
415 Ga0070713_100139876
416 Ga0070713_100171739
417 Ga0070713_100528835
418 Ga0070710_10012784
419 Ga0070710_10132481
420 Ga0070710_10198160
421 Ga0070701_10403052
422 Ga0070711_100000242
423 Ga0070711_100001023
424 Ga0070711_100024458
425 Ga0070711_100101052
426 Ga0070711_100517994
427 Ga0070708_100026229
428 Ga0070708_100158013
429 Ga0070708_100247290
430 Ga0070708_100456081
431 Ga0070708_100503303
432 Ga0070663_100073183
433 Ga0070662_100000637
434 Ga0070681_10037475
435 Ga0070681_10125414
436 Ga0070681_10469634
437 Ga0070706_100000811
438 Ga0070706_100213146
439 Ga0070706_100353983
440 Ga0070707_100098257
441 Ga0070707_100331696
442 Ga0070707_100533957
443 Ga0070698_100023847
444 Ga0070698_100430574
445 Ga0070699_100019868
446 Ga0070699_100307866
447 Ga0070679_100257964
448 Ga0070679_100292622
449 Ga0070679_100649607
450 Ga0070684_100123260
451 Ga0070684_100627833
452 Ga0070697_100000282
453 Ga0068853_100080676
454 Ga0070695_100180645
455 Ga0070696_100130173
456 Ga0070696_100252022
457 Ga0070693_100030979
458 Ga0070693_100073784
459 Ga0070665_100144547
460 Ga0068855_100092040
461 Ga0068855_100128992
462 Ga0068855_100688984
463 Ga0068857_100112325
464 Ga0068854_100141216
465 Ga0068856_100068914
466 Ga0068856_100082431
467 Ga0070702_100130975
468 Ga0070702_100172257
469 Ga0068859_100037326
470 Ga0068864_100226133
471 Ga0068866_10182402
472 Ga0068861_100565912
473 Ga0068863_100021951
474 Ga0068863_100055191
475 Ga0068863_101190734
476 Ga0068858_100080253
477 Ga0068858_100109553
478 Ga0068860_100125623
479 Ga0068860_100796284
480 Ga0068862_100485217
481 Ga0070717_10021145
482 Ga0070717_10024346
483 Ga0070717_10052231
484 Ga0070717_10060243
485 Ga0070717_10093105
486 Ga0070717_10146451
487 Ga0070717_10156941
488 Ga0070717_10164605
489 Ga0070717_10636237
490 Ga0070715_10000779
491 Ga0070715_10040395
492 Ga0070716_100015296
493 Ga0070716_100022363
494 Ga0070716_100032377
495 Ga0070716_100337183
496 Ga0070716_100378880
497 Ga0070712_100000067
498 Ga0070712_100001219
499 Ga0070712_100001661
500 Ga0097621_100005223
501 Ga0097621_100046998
502 Ga0097621_100068139
503 Ga0068871_100002547
504 Ga0068871_100007018
505 Ga0075434_100006904
506 Ga0075434_100059716
507 Ga0075434_100162375
508 Ga0075436_100001052
509 Ga0075436_100128156
510 Ga0075436_100185488
511 Ga0097620_100037327
512 Ga0075435_100113432
513 Ga0075435_100335479
514 Ga0099795_10014496
515 Ga0105240_10021385
516 Ga0105240_10032517
517 Ga0105240_10091681
518 Ga0105240_10655681
519 Ga0105240_11345069
520 Ga0105245_10457043
521 Ga0105247_10369811
522 Ga0105243_10790129
523 Ga0105241_10072878
524 Ga0105241_11419418
525 Ga0105242_10018352
526 Ga0105248_10120925
527 Ga0105237_10107454
528 Ga0105238_10635126
529 Ga0105249_10009943
530 Ga0105239_10240991
531 Ga0105239_10265526
532 Ga0105239_10391218
533 Ga0157373_10058970
534 Ga0157373_10155480
535 Ga0157373_10166370
536 Ga0157373_10566032
537 Ga0157371_10036409
538 Ga0157371_10293339
539 Ga0157369_10098454
540 Ga0157369_10934562
541 Ga0157374_10008117
542 Ga0157374_10030067
543 Ga0157374_10062016
544 Ga0157374_10085092
545 Ga0157374_10530207
546 Ga0157378_10042320
547 Ga0157378_10056327
548 Ga0157378_10115158
549 Ga0157378_10309612
550 Ga0163162_10003176
551 Ga0163162_10003288
552 Ga0163162_10033156
553 Ga0157372_10010660
554 Ga0157372_10089195
555 Ga0157372_10231279
556 Ga0157372_11777216
557 Ga0157375_10543014
558 Ga0163163_10151449
559 Ga0163163_10265312
560 Ga0163163_10509793
561 Ga0157379_10113044
562 Ga0157379_10228100
563 Ga0157376_10089022
564 Ga0157376_10560043
565 Ga0182005_1090293
566 Ga0224570_100283
567 Ga0224571_106322
568 Ga0224572_1004998
569 Ga0224572_1015195
570 Ga0224572_1018468
571 Ga0228598_1000075
572 Ga0207692_10049665
573 Ga0207642_10138947
574 Ga0207710_10099710
575 Ga0207685_10000405
576 Ga0207699_10000327
577 Ga0207699_10008330
578 Ga0207699_10020674
579 Ga0207699_10097418
580 Ga0207699_10137421
581 Ga0207645_10199988
582 Ga0207684_10002531
583 Ga0207684_10075851
584 Ga0207654_10047414
585 Ga0207707_10024276
586 Ga0207707_10192239
587 Ga0207695_10006844
588 Ga0207695_10040769
589 Ga0207671_10015558
590 Ga0207671_10112916
591 Ga0207693_10000160
592 Ga0207693_10000252
593 Ga0207693_10001575
594 Ga0207693_10012108
595 Ga0207693_10043671
596 Ga0207693_10602285
597 Ga0207663_10001186
598 Ga0207663_10003158
599 Ga0207663_10017427
600 Ga0207663_10089646
601 Ga0207660_10493939
602 Ga0207657_10000343
603 Ga0207649_10104926
604 Ga0207652_10021306
605 Ga0207652_10191470
606 Ga0207652_10628732
607 Ga0207646_10048833
608 Ga0207646_10405986
609 Ga0207646_10575092
610 Ga0207646_11027280
611 Ga0207694_10341940
612 Ga0207694_10451133
613 Ga0207687_10012503
614 Ga0207700_10005900
615 Ga0207700_10020858
616 Ga0207700_10042316
617 Ga0207700_10053087
618 Ga0207700_10076060
619 Ga0207700_10093378
620 Ga0207700_10247534
621 Ga0207700_10461179
622 Ga0207664_10000179
623 Ga0207664_10101759
624 Ga0207706_10001333
625 Ga0207686_10460127
626 Ga0207670_10213933
627 Ga0207665_10000743
628 Ga0207665_10006159
629 Ga0207665_10018071
630 Ga0207665_10035948
631 Ga0207665_10054187
632 Ga0207711_10000528
633 Ga0207689_10047875
634 Ga0207689_10127272
635 Ga0207679_10041593
636 Ga0207667_10002363
637 Ga0207667_10019886
638 Ga0207667_10350442
639 Ga0207712_10126663
640 Ga0207668_10124391
641 Ga0207640_10022691
642 Ga0207640_10109929
643 Ga0207658_10085478
644 Ga0207677_10037935
645 Ga0207677_10064070
646 Ga0207703_10071679
647 Ga0207703_10118060
648 Ga0207678_10008808
649 Ga0207702_10002110
650 Ga0207702_10050532
651 Ga0207641_10006333
652 Ga0207641_10018658
653 Ga0207641_10980775
654 Ga0207676_10146742
655 Ga0207674_10182522
656 Ga0207675_100019478
657 Ga0207698_10270481
658 Ga0265356_1004024
659 Ga0265356_1004685
660 Ga0265355_1001264
661 Ga0268266_10098006
662 Ga0268264_10320640
663 Ga0268264_10470435
664 Ga0265338_10000762
665 Ga0265338_10093169
666 Ga0265338_10279022
667 Ga0265762_1000129
668 Ga0265762_1004823
669 Ga0265770_1019818
670 Ga0265765_1008452
671 Ga0265771_1005631
672 Ga0265760_10000082
673 Ga0265760_10023205
674 Ga0265760_10170770
675 Ga0265330_10006351
676 Ga0265325_10021840
677 Ga0265340_10034585
678 Ga0265340_10079026
679 Ga0265340_10121047
680 Ga0265339_10024369
681 Ga0265339_10025187
682 Ga0265339_10043151
683 Ga0265316_10027437
684 Ga0265314_10002351
685 Ga0265314_10017920
686 Ga0265314_10154267
687 Ga0316214_1015909
688 Ga0373934_0083661
689 Ga0373923_0039099
690 Ga0373923_0103231
691 Ga0373923_0131831
692 Ga0373936_0002893
693 Ga0373936_0006130
694 Ga0373945_0007969
695 Ga0373945_0054590
696 Ga0373945_0308446
697 Ga0373954_0072930
698 Ga0373956_0135684
699 Ga0373957_0015949
700 Ga0373943_0001007
701 Ga0373955_0185484
702 Ga0373931_0071653
703 Ga0373935_0000847
704 Ga0373935_0013183
705 Ga0373927_0000150
706 Ga0373927_0026022
707 Ga0373927_0082760
708 Ga0373933_0053038
709 Ga0373933_0061808
710 Ga0373947_0000459
711 Ga0373947_0160967
712 Ga0373937_0066510
713 Ga0373937_0257922
714 Ga0316582_0136881
715 Ga0316582_0434936
716 Ga0316584_0208225
717 Ga0373925_0000673
718 Ga0373925_0006117
719 Ga0373925_0078453
720 Ga0242420_009530
721 Ga0400483_135423
722 Ga0400489_10544
723 Ga0466964_0011562
724 Ga0453684_0271143
725 Ga0466958_0330042
726 Ga0495592_0533360
727 Ga0495653_0244470
728 Ga0495580_0009801
729 Ga0495582_0001119
730 Ga0495664_0015084
731 Ga0495664_0131318
732 Ga0495608_0110814
733 Ga0495618_0333806
734 Ga0495628_0221163
735 Ga0495630_0035037
736 Ga0495630_0080743
737 Ga0495630_0178303
738 Ga0495630_0509789
739 Ga0495652_0539287
740 Ga0495586_0239113
741 Ga0495645_0078415
742 Ga0495658_0105586
743 Ga0495613_0049143
744 Ga0495624_0144811
745 Ga0495581_0031249
746 Ga0495674_0012763
747 Ga0495674_0019434
748 Ga0495674_0720853
749 Ga0495684_0031223
750 Ga0495602_0072809
751 Ga0496101_0171830
752 Ga0496102_0084403
753 Ga0496103_0183221
754 Ga0496104_0974518
755 Ga0496105_0018561
756 Ga0496108_0116728
757 Ga0496110_0283757
758 Ga0496112_0035554
759 Ga0496112_0802731
760 Ga0496114_0649975
761 Ga0496115_0312385
762 nmdc:mga0n895_315137_c1
763 nmdc:mga0rr50_175379_c1
764 nmdc:mga08x19_22383_c1
765 nmdc:mga08x19_308375_c1
766 nmdc:mga08x19_6283_c1
767 nmdc:mga0a205_60278_c1
768 Ga0495601_0208344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14824

Sirohm_synth_M

Sirohaem biosynthesis protein central

146

173

0.97

PF13241

NAD_binding_7

Putative NAD(P)-binding

33

142

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pr0-assembly1.cif.gz_A p133h-s128a s. typhimurium siroheme synthase 0.8644 1 200
6pr4-assembly1.cif.gz_A d262n/s128a s. typhimurium siroheme synthase 0.859 1 200
6pr3-assembly1.cif.gz_A d262a/s128a s. typhimurium siroheme synthase 0.858 1 200
6pr2-assembly1.cif.gz_A r261a/s128a s. typhimurium siroheme synthase 0.8564 1 200
6veb-assembly1.cif.gz_A precorrin-2-bound s128a s. typhimurium siroheme synthase 0.8561 1 200
ID Description Score Start End Superfamily
af_P0AEA8_1_112_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9749 1 107 3.40.50.720
af_Q5ADR1_10_155_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9651 1 108 3.40.50.720
af_I6X5I7_6_129_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9423 1 125 3.40.50.720
af_Q2FUZ9_3_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9386 1 125 3.40.50.720
af_O14172_11_78_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9349 1 61 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V9KTV5-F1-model_v4 precorrin-2 dehydrogenase (EC 1.3.1.76) 0.9825 1 161 GO:0004325
GO:0019354
GO:0043115
AF-A0A2V9ACM2-F1-model_v4 precorrin-2 dehydrogenase (EC 1.3.1.76) 0.978 1 194 GO:0004325
GO:0019354
GO:0043115
AF-A0A2U3JXV0-F1-model_v4 precorrin-2 dehydrogenase (EC 1.3.1.76) 0.9776 1 179 GO:0004325
GO:0019354
GO:0043115
AF-A0A2V8Y0L7-F1-model_v4 precorrin-2 dehydrogenase (EC 1.3.1.76) 0.977 1 194 GO:0004325
GO:0019354
GO:0043115
AF-A0A349T8C6-F1-model_v4 deleted 0.9763 1 123

Map