F429858

General Info

Members Datasets Scaffolds Average Seq Length
384 199 768 109

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100002322|Ga0068871_10000232212
Length 109
Sequence MKNSLSFALALMLISATAQADTIEMKVYGLVCGFCAQGIEKTLRKNPATADVVVSLEDKLVAIETRAGHDISDADLTRALTESGYDVKAIAHTQRSMAEIRASLKSGNH

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
195 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 2.08
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 12.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100002322 3300006358 Bacteria 12954
2 JGI24736J21556_1017789 3300001904 Bacteria 1127
3 rootH1_10321975 3300003323 Unclassified 1564
4 Ga0065704_10723016 3300005289 Unclassified 552
5 Ga0065707_10648945 3300005295 Unclassified 664
6 Ga0070658_10457544 3300005327 Bacteria 1100
7 Ga0070658_10579404 3300005327 Bacteria 972
8 Ga0070676_10100050 3300005328 Bacteria 1789
9 Ga0070683_100043159 3300005329 Bacteria 4156
10 Ga0070670_100046377 3300005331 Bacteria 3736
11 Ga0070670_100105354 3300005331 Bacteria 2429
12 Ga0070670_101044875 3300005331 Bacteria 744
13 Ga0068869_100358709 3300005334 Bacteria 1190
14 Ga0068869_100681109 3300005334 Bacteria 875
15 Ga0068869_101306887 3300005334 Bacteria 640
16 Ga0068869_101311073 3300005334 Bacteria 639
17 Ga0070666_10004540 3300005335 Bacteria 8458
18 Ga0070666_10233983 3300005335 Bacteria 1298
19 Ga0070680_101086802 3300005336 Unclassified 691
20 Ga0070682_101419336 3300005337 Bacteria 594
21 Ga0068868_100008763 3300005338 Bacteria 7246
22 Ga0068868_100012667 3300005338 Bacteria 6169
23 Ga0070689_100609794 3300005340 Bacteria 946
24 Ga0070691_10168509 3300005341 Bacteria 1133
25 Ga0070661_100134304 3300005344 Bacteria 1860
26 Ga0070661_100136724 3300005344 Bacteria 1844
27 Ga0070661_100252822 3300005344 Bacteria 1360
28 Ga0070661_100269186 3300005344 Unclassified 1319
29 Ga0070668_100001316 3300005347 Bacteria 17792
30 Ga0070668_100011189 3300005347 Bacteria 6681
31 Ga0070668_100256050 3300005347 Bacteria 1454
32 Ga0070668_100528145 3300005347 Bacteria 1025
33 Ga0070668_100601104 3300005347 Bacteria 962
34 Ga0070669_100065509 3300005353 Bacteria 2677
35 Ga0070669_100107756 3300005353 Bacteria 2111
36 Ga0070675_100169926 3300005354 Bacteria 1879
37 Ga0070675_101427945 3300005354 Unclassified 638
38 Ga0070671_100167768 3300005355 Bacteria 1856
39 Ga0070671_100373925 3300005355 Bacteria 1217
40 Ga0070671_101467552 3300005355 Bacteria 603
41 Ga0070674_100257956 3300005356 Bacteria 1372
42 Ga0070673_102299501 3300005364 Bacteria 512
43 Ga0070688_100439969 3300005365 Unclassified 973
44 Ga0070659_100464493 3300005366 Bacteria 1075
45 Ga0070667_100032844 3300005367 Bacteria 4331
46 Ga0070667_100047661 3300005367 Bacteria 3606
47 Ga0070667_100142885 3300005367 Bacteria 2097
48 Ga0070667_100345268 3300005367 Bacteria 1346
49 Ga0070667_100542129 3300005367 Bacteria 1069
50 Ga0070667_101506202 3300005367 Bacteria 632
51 Ga0070701_10161385 3300005438 Bacteria 1299
52 Ga0070694_100214408 3300005444 Unclassified 1441
53 Ga0070663_100151042 3300005455 Bacteria 1781
54 Ga0070663_100157584 3300005455 Bacteria 1746
55 Ga0070678_100070165 3300005456 Bacteria 2618
56 Ga0070662_100007866 3300005457 Bacteria 6925
57 Ga0070662_100532516 3300005457 Unclassified 983
58 Ga0070662_100591309 3300005457 Bacteria 933
59 Ga0070662_100612164 3300005457 Unclassified 917
60 Ga0070681_10155448 3300005458 Bacteria 2212
61 Ga0068867_100187206 3300005459 Bacteria 1649
62 Ga0068867_100354746 3300005459 Bacteria 1225
63 Ga0068867_100842097 3300005459 Bacteria 821
64 Ga0070684_100371398 3300005535 Bacteria 1317
65 Ga0068853_100001468 3300005539 Bacteria 17108
66 Ga0068853_100099486 3300005539 Bacteria 2569
67 Ga0068853_100112798 3300005539 Bacteria 2416
68 Ga0068853_100488827 3300005539 Bacteria 1161
69 Ga0070672_100232004 3300005543 Bacteria 1551
70 Ga0070672_100912685 3300005543 Unclassified 776
71 Ga0070686_101173832 3300005544 Unclassified 637
72 Ga0070695_101324387 3300005545 Unclassified 595
73 Ga0070693_100017532 3300005547 Bacteria 3724
74 Ga0070665_100017562 3300005548 Bacteria 7185
75 Ga0070665_100145239 3300005548 Bacteria 2375
76 Ga0070665_100301691 3300005548 Bacteria 1605
77 Ga0070665_100965207 3300005548 Bacteria 865
78 Ga0070665_101053848 3300005548 Unclassified 825
79 Ga0070665_101877409 3300005548 Bacteria 605
80 Ga0070704_100314786 3300005549 Unclassified 1309
81 Ga0070704_100346103 3300005549 Bacteria 1253
82 Ga0068855_100209949 3300005563 Bacteria 2188
83 Ga0068855_100322054 3300005563 Bacteria 1708
84 Ga0068855_101158310 3300005563 Bacteria 806
85 Ga0070664_100011825 3300005564 Bacteria 7085
86 Ga0070664_100065468 3300005564 Bacteria 3101
87 Ga0070664_100756688 3300005564 Bacteria 907
88 Ga0068857_100087353 3300005577 Bacteria 2789
89 Ga0068857_100108318 3300005577 Bacteria 2496
90 Ga0068857_100371480 3300005577 Bacteria 1327
91 Ga0068857_100622069 3300005577 Unclassified 1022
92 Ga0068854_100009595 3300005578 Bacteria 6247
93 Ga0068854_100756906 3300005578 Bacteria 843
94 Ga0068854_101530209 3300005578 Bacteria 606
95 Ga0068854_102202346 3300005578 Bacteria 510
96 Ga0068856_100053675 3300005614 Bacteria 3974
97 Ga0068852_100114304 3300005616 Unclassified 2459
98 Ga0068852_100881579 3300005616 Bacteria 911
99 Ga0068859_100000199 3300005617 Bacteria 58723
100 Ga0068859_100246071 3300005617 Bacteria 1878
101 Ga0068864_100397606 3300005618 Bacteria 1309
102 Ga0068864_100751200 3300005618 Bacteria 956
103 Ga0068864_100763401 3300005618 Bacteria 948
104 Ga0068861_100173889 3300005719 Bacteria 1787
105 Ga0068861_100213097 3300005719 Bacteria 1628
106 Ga0068851_10012657 3300005834 Bacteria 3982
107 Ga0068851_10056731 3300005834 Bacteria 1998
108 Ga0068870_10167927 3300005840 Bacteria 1307
109 Ga0068870_10836399 3300005840 Bacteria 646
110 Ga0068863_100099971 3300005841 Bacteria 2756
111 Ga0068863_100108994 3300005841 Bacteria 2636
112 Ga0068863_100221223 3300005841 Bacteria 1824
113 Ga0068863_100521198 3300005841 Bacteria 1172
114 Ga0068863_100738839 3300005841 Bacteria 979
115 Ga0068863_101367225 3300005841 Bacteria 716
116 Ga0068863_102235742 3300005841 Unclassified 557
117 Ga0068858_100504733 3300005842 Bacteria 1169
118 Ga0068860_100107613 3300005843 Bacteria 2665
119 Ga0068860_100190752 3300005843 Bacteria 1983
120 Ga0068860_100297123 3300005843 Bacteria 1581
121 Ga0068862_100002129 3300005844 Bacteria 17837
122 Ga0068862_100174197 3300005844 Bacteria 1927
123 Ga0081455_10040721 3300005937 Bacteria 4094
124 Ga0097621_100002041 3300006237 Bacteria 13816
125 Ga0097621_100008803 3300006237 Bacteria 7294
126 Ga0097621_100025028 3300006237 Bacteria 4666
127 Ga0097621_100150965 3300006237 Bacteria 1992
128 Ga0068871_100011256 3300006358 Bacteria 6558
129 Ga0068871_100033258 3300006358 Bacteria 4082
130 Ga0068871_100128674 3300006358 Bacteria 2145
131 Ga0068871_100192365 3300006358 Bacteria 1758
132 Ga0068871_100571538 3300006358 Bacteria 1026
133 Ga0068871_100726279 3300006358 Unclassified 911
134 Ga0068871_101712583 3300006358 Unclassified 596
135 Ga0075428_100003523 3300006844 Bacteria 17142
136 Ga0075434_100030048 3300006871 Bacteria 5349
137 Ga0075429_100195011 3300006880 Unclassified 1774
138 Ga0068865_100000766 3300006881 Bacteria 18028
139 Ga0068865_100016761 3300006881 Bacteria 4696
140 Ga0068865_100035728 3300006881 Bacteria 3345
141 Ga0068865_100502774 3300006881 Unclassified 1011
142 Ga0097620_100000199 3300006931 Bacteria 58723
143 Ga0097620_100246081 3300006931 Bacteria 1878
144 Ga0105240_10600864 3300009093 Bacteria 1211
145 Ga0105240_12095786 3300009093 Unclassified 587
146 Ga0111539_10000667 3300009094 Bacteria 44305
147 Ga0111539_10077063 3300009094 Bacteria 3925
148 Ga0105245_10198616 3300009098 Bacteria 1925
149 Ga0105245_10587128 3300009098 Bacteria 1139
150 Ga0105247_10252045 3300009101 Bacteria 1207
151 Ga0114129_10026312 3300009147 Bacteria 8239
152 Ga0105241_10055306 3300009174 Bacteria 3040
153 Ga0105241_11606145 3300009174 Bacteria 629
154 Ga0105242_10001705 3300009176 Bacteria 17368
155 Ga0105242_10444415 3300009176 Bacteria 1221
156 Ga0105242_12489010 3300009176 Bacteria 566
157 Ga0105248_10063079 3300009177 Bacteria 4159
158 Ga0105248_10748770 3300009177 Bacteria 1102
159 Ga0105248_11003721 3300009177 Bacteria 943
160 Ga0105237_10043600 3300009545 Bacteria 4519
161 Ga0105237_10098005 3300009545 Bacteria 2923
162 Ga0105237_10151186 3300009545 Bacteria 2318
163 Ga0105237_10725578 3300009545 Bacteria 1000
164 Ga0105238_10027145 3300009551 Bacteria 5836
165 Ga0105238_10143508 3300009551 Bacteria 2364
166 Ga0105238_10314744 3300009551 Bacteria 1550
167 Ga0105249_10508376 3300009553 Bacteria 1251
168 Ga0105249_11561486 3300009553 Bacteria 732
169 Ga0105249_11598070 3300009553 Unclassified 724
170 Ga0105239_10037362 3300010375 Bacteria 5324
171 Ga0105239_10062375 3300010375 Bacteria 4091
172 Ga0105239_11290372 3300010375 Bacteria 842
173 Ga0105246_10218586 3300011119 Bacteria 1492
174 Ga0105246_10842860 3300011119 Bacteria 817
175 Ga0157373_10239485 3300013100 Bacteria 1282
176 Ga0157370_10312924 3300013104 Bacteria 1449
177 Ga0157370_10702508 3300013104 Bacteria 923
178 Ga0157370_10930587 3300013104 Bacteria 788
179 Ga0157370_11594662 3300013104 Bacteria 586
180 Ga0157374_10096666 3300013296 Bacteria 2825
181 Ga0157374_10534876 3300013296 Bacteria 1179
182 Ga0157374_11102820 3300013296 Unclassified 814
183 Ga0157378_10114574 3300013297 Bacteria 2476
184 Ga0163162_10040442 3300013306 Bacteria 4662
185 Ga0157372_10776901 3300013307 Bacteria 1113
186 Ga0157375_10000345 3300013308 Bacteria 41921
187 Ga0157375_10091171 3300013308 Bacteria 3109
188 Ga0157375_10558324 3300013308 Bacteria 1306
189 Ga0157375_11267446 3300013308 Bacteria 866
190 Ga0163163_10453130 3300014325 Unclassified 1343
191 Ga0163163_11012021 3300014325 Unclassified 894
192 Ga0157380_10029420 3300014326 Bacteria 4198
193 Ga0157380_10038743 3300014326 Bacteria 3703
194 Ga0157377_10666210 3300014745 Archaea 751
195 Ga0157379_10608850 3300014968 Bacteria 1020
196 Ga0157379_10613409 3300014968 Bacteria 1016
197 Ga0157379_11295249 3300014968 Bacteria 703
198 Ga0157376_10008127 3300014969 Bacteria 7542
199 Ga0157376_10150063 3300014969 Bacteria 2101
200 Ga0157376_10257815 3300014969 Bacteria 1632
201 Ga0157376_10265834 3300014969 Unclassified 1609
202 Ga0163161_10092270 3300017792 Unclassified 2242
203 Ga0163161_10948919 3300017792 Bacteria 731
204 Ga0209233_1001223 3300025261 Bacteria 10345
205 Ga0207656_10036916 3300025321 Bacteria 2053
206 Ga0207656_10707388 3300025321 Bacteria 516
207 Ga0207680_10596222 3300025903 Bacteria 790
208 Ga0207680_10622069 3300025903 Bacteria 773
209 Ga0207647_10251526 3300025904 Bacteria 1013
210 Ga0207685_10270996 3300025905 Bacteria 829
211 Ga0207645_10032873 3300025907 Bacteria 3334
212 Ga0207645_10087760 3300025907 Bacteria 1999
213 Ga0207643_10565162 3300025908 Bacteria 730
214 Ga0207705_10192304 3300025909 Bacteria 1544
215 Ga0207705_11059519 3300025909 Bacteria 625
216 Ga0207654_10005290 3300025911 Bacteria 6516
217 Ga0207707_10280856 3300025912 Bacteria 1442
218 Ga0207671_10268130 3300025914 Bacteria 1345
219 Ga0207671_10383464 3300025914 Bacteria 1117
220 Ga0207660_11588108 3300025917 Bacteria 527
221 Ga0207649_10040206 3300025920 Bacteria 2841
222 Ga0207649_11527524 3300025920 Unclassified 528
223 Ga0207652_10410279 3300025921 Bacteria 1222
224 Ga0207681_10060926 3300025923 Bacteria 2592
225 Ga0207681_10069423 3300025923 Bacteria 2451
226 Ga0207694_10035408 3300025924 Bacteria 3829
227 Ga0207650_10313492 3300025925 Bacteria 1283
228 Ga0207650_10441979 3300025925 Bacteria 1081
229 Ga0207650_11242800 3300025925 Unclassified 634
230 Ga0207659_10088126 3300025926 Bacteria 2311
231 Ga0207659_11217271 3300025926 Unclassified 647
232 Ga0207659_11654294 3300025926 Unclassified 546
233 Ga0207687_10222958 3300025927 Bacteria 1485
234 Ga0207644_10164703 3300025931 Bacteria 1726
235 Ga0207644_10312459 3300025931 Bacteria 1269
236 Ga0207690_10862420 3300025932 Bacteria 750
237 Ga0207690_11021420 3300025932 Bacteria 688
238 Ga0207690_11045328 3300025932 Unclassified 680
239 Ga0207706_10011960 3300025933 Bacteria 7902
240 Ga0207706_10103267 3300025933 Bacteria 2507
241 Ga0207706_10541893 3300025933 Bacteria 1002
242 Ga0207706_10665576 3300025933 Unclassified 891
243 Ga0207686_10016318 3300025934 Bacteria 4168
244 Ga0207686_10678462 3300025934 Bacteria 817
245 Ga0207670_10833988 3300025936 Bacteria 769
246 Ga0207670_10952234 3300025936 Bacteria 721
247 Ga0207669_10706710 3300025937 Unclassified 829
248 Ga0207704_10053709 3300025938 Bacteria 2451
249 Ga0207704_10071136 3300025938 Unclassified 2206
250 Ga0207691_10038355 3300025940 Bacteria 4434
251 Ga0207691_10048200 3300025940 Bacteria 3907
252 Ga0207711_10304743 3300025941 Bacteria 1470
253 Ga0207689_10027737 3300025942 Bacteria 4739
254 Ga0207689_10084398 3300025942 Bacteria 2611
255 Ga0207689_10936417 3300025942 Bacteria 731
256 Ga0207661_10153755 3300025944 Bacteria 1991
257 Ga0207679_10269638 3300025945 Bacteria 1455
258 Ga0207679_11609459 3300025945 Bacteria 595
259 Ga0207667_10180475 3300025949 Bacteria 2168
260 Ga0207667_10342438 3300025949 Bacteria 1526
261 Ga0207667_11037030 3300025949 Bacteria 806
262 Ga0207667_11320871 3300025949 Bacteria 697
263 Ga0207651_10017390 3300025960 Bacteria 4249
264 Ga0207712_10000339 3300025961 Bacteria 42473
265 Ga0207712_10651418 3300025961 Bacteria 915
266 Ga0207712_11100796 3300025961 Bacteria 707
267 Ga0207668_10041123 3300025972 Bacteria 3123
268 Ga0207668_10380056 3300025972 Unclassified 1189
269 Ga0207668_11476065 3300025972 Unclassified 613
270 Ga0207640_10003559 3300025981 Bacteria 8401
271 Ga0207640_10107417 3300025981 Bacteria 1970
272 Ga0207640_10275959 3300025981 Bacteria 1318
273 Ga0207640_11019762 3300025981 Bacteria 729
274 Ga0207658_10043812 3300025986 Bacteria 3255
275 Ga0207658_10097668 3300025986 Bacteria 2294
276 Ga0207658_10125960 3300025986 Bacteria 2050
277 Ga0207658_10242789 3300025986 Bacteria 1527
278 Ga0207658_10985059 3300025986 Bacteria 769
279 Ga0207677_10354699 3300026023 Bacteria 1230
280 Ga0207703_10620060 3300026035 Bacteria 1024
281 Ga0207639_10007109 3300026041 Bacteria 7635
282 Ga0207639_10100285 3300026041 Bacteria 2338
283 Ga0207639_10219479 3300026041 Bacteria 1641
284 Ga0207639_10537480 3300026041 Bacteria 1072
285 Ga0207639_11241409 3300026041 Bacteria 699
286 Ga0207678_10060488 3300026067 Bacteria 3258
287 Ga0207678_10183343 3300026067 Bacteria 1788
288 Ga0207678_10271817 3300026067 Bacteria 1453
289 Ga0207678_10556581 3300026067 Bacteria 1003
290 Ga0207708_10129317 3300026075 Bacteria 1973
291 Ga0207702_10380598 3300026078 Bacteria 1357
292 Ga0207641_10019451 3300026088 Bacteria 5575
293 Ga0207641_10378859 3300026088 Bacteria 1354
294 Ga0207641_10768723 3300026088 Bacteria 952
295 Ga0207641_11047490 3300026088 Bacteria 813
296 Ga0207648_10066669 3300026089 Bacteria 3139
297 Ga0207648_10100527 3300026089 Bacteria 2534
298 Ga0207648_10559317 3300026089 Bacteria 1051
299 Ga0207676_10442076 3300026095 Bacteria 1224
300 Ga0207676_10478208 3300026095 Bacteria 1179
301 Ga0207674_10035430 3300026116 Bacteria 5207
302 Ga0207674_10333220 3300026116 Bacteria 1467
303 Ga0207674_10441417 3300026116 Bacteria 1258
304 Ga0207674_10700030 3300026116 Bacteria 978
305 Ga0207675_100075111 3300026118 Bacteria 3163
306 Ga0207675_100275587 3300026118 Bacteria 1633
307 Ga0207683_10006929 3300026121 Bacteria 9706
308 Ga0207428_10002094 3300027907 Bacteria 20108
309 Ga0268266_10000001 3300028379 Bacteria 4040580
310 Ga0268266_10287599 3300028379 Unclassified 1530
311 Ga0268266_10343260 3300028379 Bacteria 1402
312 Ga0268266_10621012 3300028379 Bacteria 1039
313 Ga0268266_10905832 3300028379 Bacteria 853
314 Ga0268265_10002152 3300028380 Bacteria 15254
315 Ga0268265_10692791 3300028380 Bacteria 984
316 Ga0268264_10281000 3300028381 Bacteria 1559
317 Ga0268264_12558167 3300028381 Unclassified 515
318 Ga0307408_100557506 3300031548 Bacteria 1012
319 Ga0307413_10639170 3300031824 Bacteria 876
320 Ga0307412_11606226 3300031911 Bacteria 594
321 Ga0307416_100547279 3300032002 Bacteria 1230
322 Ga0307411_12165201 3300032005 Bacteria 521
323 Ga0307415_101867772 3300032126 Bacteria 582
324 Ga0307507_10341824 3300033179 Bacteria 886
325 Ga0373940_0269465 3300035088 Bacteria 579
326 Ga0451789_0724962 3300041443 Unclassified 558
327 Ga0451798_0185228 3300041458 Unclassified 601
328 Ga0451800_1406790 3300041459 Unclassified 1091
329 Ga0451807_2711958 3300041486 Bacteria 997
330 Ga0451853_2629089 3300041512 Bacteria 1002
331 Ga0439448_0015792 3300042005 Bacteria 2290
332 Ga0495625_0636010 3300046660 Bacteria 637
333 Ga0495649_0381355 3300046694 Bacteria 709
334 Ga0495686_0239515 3300047472 Bacteria 1024
335 Ga0496101_0327403 3300048904 Bacteria 1202
336 Ga0496104_0000011 3300048907 Bacteria 459358
337 Ga0496105_0000014 3300048908 Bacteria 220911
338 Ga0496115_0388484 3300048918 Bacteria 1134
339 Ga0496126_0493443 3300048929 Bacteria 980
340 Ga0501032_0002676 3300049569 Bacteria 13902
341 Ga0501033_0008098 3300049570 Bacteria 8143
342 Ga0501034_0074938 3300049571 Bacteria 3391
343 Ga0501036_0004188 3300049572 Bacteria 11620
344 Ga0501037_0003347 3300049573 Bacteria 11652
345 Ga0501038_0005332 3300049574 Bacteria 11946
346 Ga0501039_0005791 3300049575 Bacteria 9359
347 Ga0501040_0436791 3300049576 Bacteria 942
348 Ga0501043_0001981 3300049579 Bacteria 17472
349 Ga0501046_0222017 3300049580 Bacteria 1398
350 Ga0501046_0481432 3300049580 Bacteria 890
351 Ga0501047_0005277 3300049581 Bacteria 12142
352 Ga0501048_0448527 3300049582 Bacteria 924
353 Ga0501069_0063664 3300049585 Bacteria 2060
354 Ga0501070_0003814 3300049586 Bacteria 13008
355 Ga0501072_0407072 3300049588 Bacteria 1079
356 Ga0501073_0002996 3300049589 Bacteria 12660
357 Ga0501073_0725712 3300049589 Bacteria 685
358 Ga0501074_0003717 3300049590 Bacteria 10824
359 Ga0501079_0143208 3300049741 Bacteria 1862
360 Ga0501079_0796818 3300049741 Unclassified 744
361 Ga0501079_0977640 3300049741 Unclassified 667
362 Ga0501080_0003838 3300049742 Bacteria 13271
363 Ga0501083_0101194 3300049744 Bacteria 1900
364 Ga0501083_0128245 3300049744 Bacteria 1663
365 Ga0501035_0005778 3300049822 Bacteria 11663
366 Ga0501044_0007944 3300049823 Bacteria 11661
367 Ga0501044_0247330 3300049823 Bacteria 1726
368 nmdc:mga05p37_28502_c1 3300050507 Bacteria 6808
369 nmdc:mga09592_594781_c1 3300050508 Bacteria 948
370 nmdc:mga08y16_116514_c1 3300050511 Bacteria 2781
371 nmdc:mga08y16_523_c1 3300050511 Bacteria 35463
372 nmdc:mga0rr50_95761_c1 3300050513 Bacteria 2321
373 nmdc:mga0a205_101383_c1 3300050515 Bacteria 2778
374 nmdc:mga0a205_487586_c1 3300050515 Bacteria 1090
375 Ga0500610_0275832 3300053079 Bacteria 757
376 Ga0500651_0000774 3300053093 Bacteria 15630
377 Ga0500651_0003657 3300053093 Bacteria 8459
378 Ga0500620_228822 3300053155 Bacteria 625
379 Ga0500638_054498 3300053162 Bacteria 1929
380 Ga0501084_0108697 3300054114 Bacteria 2330
381 Ga0501084_1055696 3300054114 Bacteria 682
382 Ga0590074_104450 3300059423 Unclassified 555
383 Ga0501082_0000029 3300060353 Bacteria 100004
384 Ga0530510_0595888 3300061734 Bacteria 840
385 Ga0068871_100002322
386 JGI24736J21556_1017789
387 rootH1_10321975
388 Ga0065704_10723016
389 Ga0065707_10648945
390 Ga0070658_10457544
391 Ga0070658_10579404
392 Ga0070676_10100050
393 Ga0070683_100043159
394 Ga0070670_100046377
395 Ga0070670_100105354
396 Ga0070670_101044875
397 Ga0068869_100358709
398 Ga0068869_100681109
399 Ga0068869_101306887
400 Ga0068869_101311073
401 Ga0070666_10004540
402 Ga0070666_10233983
403 Ga0070680_101086802
404 Ga0070682_101419336
405 Ga0068868_100008763
406 Ga0068868_100012667
407 Ga0070689_100609794
408 Ga0070691_10168509
409 Ga0070661_100134304
410 Ga0070661_100136724
411 Ga0070661_100252822
412 Ga0070661_100269186
413 Ga0070668_100001316
414 Ga0070668_100011189
415 Ga0070668_100256050
416 Ga0070668_100528145
417 Ga0070668_100601104
418 Ga0070669_100065509
419 Ga0070669_100107756
420 Ga0070675_100169926
421 Ga0070675_101427945
422 Ga0070671_100167768
423 Ga0070671_100373925
424 Ga0070671_101467552
425 Ga0070674_100257956
426 Ga0070673_102299501
427 Ga0070688_100439969
428 Ga0070659_100464493
429 Ga0070667_100032844
430 Ga0070667_100047661
431 Ga0070667_100142885
432 Ga0070667_100345268
433 Ga0070667_100542129
434 Ga0070667_101506202
435 Ga0070701_10161385
436 Ga0070694_100214408
437 Ga0070663_100151042
438 Ga0070663_100157584
439 Ga0070678_100070165
440 Ga0070662_100007866
441 Ga0070662_100532516
442 Ga0070662_100591309
443 Ga0070662_100612164
444 Ga0070681_10155448
445 Ga0068867_100187206
446 Ga0068867_100354746
447 Ga0068867_100842097
448 Ga0070684_100371398
449 Ga0068853_100001468
450 Ga0068853_100099486
451 Ga0068853_100112798
452 Ga0068853_100488827
453 Ga0070672_100232004
454 Ga0070672_100912685
455 Ga0070686_101173832
456 Ga0070695_101324387
457 Ga0070693_100017532
458 Ga0070665_100017562
459 Ga0070665_100145239
460 Ga0070665_100301691
461 Ga0070665_100965207
462 Ga0070665_101053848
463 Ga0070665_101877409
464 Ga0070704_100314786
465 Ga0070704_100346103
466 Ga0068855_100209949
467 Ga0068855_100322054
468 Ga0068855_101158310
469 Ga0070664_100011825
470 Ga0070664_100065468
471 Ga0070664_100756688
472 Ga0068857_100087353
473 Ga0068857_100108318
474 Ga0068857_100371480
475 Ga0068857_100622069
476 Ga0068854_100009595
477 Ga0068854_100756906
478 Ga0068854_101530209
479 Ga0068854_102202346
480 Ga0068856_100053675
481 Ga0068852_100114304
482 Ga0068852_100881579
483 Ga0068859_100000199
484 Ga0068859_100246071
485 Ga0068864_100397606
486 Ga0068864_100751200
487 Ga0068864_100763401
488 Ga0068861_100173889
489 Ga0068861_100213097
490 Ga0068851_10012657
491 Ga0068851_10056731
492 Ga0068870_10167927
493 Ga0068870_10836399
494 Ga0068863_100099971
495 Ga0068863_100108994
496 Ga0068863_100221223
497 Ga0068863_100521198
498 Ga0068863_100738839
499 Ga0068863_101367225
500 Ga0068863_102235742
501 Ga0068858_100504733
502 Ga0068860_100107613
503 Ga0068860_100190752
504 Ga0068860_100297123
505 Ga0068862_100002129
506 Ga0068862_100174197
507 Ga0081455_10040721
508 Ga0097621_100002041
509 Ga0097621_100008803
510 Ga0097621_100025028
511 Ga0097621_100150965
512 Ga0068871_100011256
513 Ga0068871_100033258
514 Ga0068871_100128674
515 Ga0068871_100192365
516 Ga0068871_100571538
517 Ga0068871_100726279
518 Ga0068871_101712583
519 Ga0075428_100003523
520 Ga0075434_100030048
521 Ga0075429_100195011
522 Ga0068865_100000766
523 Ga0068865_100016761
524 Ga0068865_100035728
525 Ga0068865_100502774
526 Ga0097620_100000199
527 Ga0097620_100246081
528 Ga0105240_10600864
529 Ga0105240_12095786
530 Ga0111539_10000667
531 Ga0111539_10077063
532 Ga0105245_10198616
533 Ga0105245_10587128
534 Ga0105247_10252045
535 Ga0114129_10026312
536 Ga0105241_10055306
537 Ga0105241_11606145
538 Ga0105242_10001705
539 Ga0105242_10444415
540 Ga0105242_12489010
541 Ga0105248_10063079
542 Ga0105248_10748770
543 Ga0105248_11003721
544 Ga0105237_10043600
545 Ga0105237_10098005
546 Ga0105237_10151186
547 Ga0105237_10725578
548 Ga0105238_10027145
549 Ga0105238_10143508
550 Ga0105238_10314744
551 Ga0105249_10508376
552 Ga0105249_11561486
553 Ga0105249_11598070
554 Ga0105239_10037362
555 Ga0105239_10062375
556 Ga0105239_11290372
557 Ga0105246_10218586
558 Ga0105246_10842860
559 Ga0157373_10239485
560 Ga0157370_10312924
561 Ga0157370_10702508
562 Ga0157370_10930587
563 Ga0157370_11594662
564 Ga0157374_10096666
565 Ga0157374_10534876
566 Ga0157374_11102820
567 Ga0157378_10114574
568 Ga0163162_10040442
569 Ga0157372_10776901
570 Ga0157375_10000345
571 Ga0157375_10091171
572 Ga0157375_10558324
573 Ga0157375_11267446
574 Ga0163163_10453130
575 Ga0163163_11012021
576 Ga0157380_10029420
577 Ga0157380_10038743
578 Ga0157377_10666210
579 Ga0157379_10608850
580 Ga0157379_10613409
581 Ga0157379_11295249
582 Ga0157376_10008127
583 Ga0157376_10150063
584 Ga0157376_10257815
585 Ga0157376_10265834
586 Ga0163161_10092270
587 Ga0163161_10948919
588 Ga0209233_1001223
589 Ga0207656_10036916
590 Ga0207656_10707388
591 Ga0207680_10596222
592 Ga0207680_10622069
593 Ga0207647_10251526
594 Ga0207685_10270996
595 Ga0207645_10032873
596 Ga0207645_10087760
597 Ga0207643_10565162
598 Ga0207705_10192304
599 Ga0207705_11059519
600 Ga0207654_10005290
601 Ga0207707_10280856
602 Ga0207671_10268130
603 Ga0207671_10383464
604 Ga0207660_11588108
605 Ga0207649_10040206
606 Ga0207649_11527524
607 Ga0207652_10410279
608 Ga0207681_10060926
609 Ga0207681_10069423
610 Ga0207694_10035408
611 Ga0207650_10313492
612 Ga0207650_10441979
613 Ga0207650_11242800
614 Ga0207659_10088126
615 Ga0207659_11217271
616 Ga0207659_11654294
617 Ga0207687_10222958
618 Ga0207644_10164703
619 Ga0207644_10312459
620 Ga0207690_10862420
621 Ga0207690_11021420
622 Ga0207690_11045328
623 Ga0207706_10011960
624 Ga0207706_10103267
625 Ga0207706_10541893
626 Ga0207706_10665576
627 Ga0207686_10016318
628 Ga0207686_10678462
629 Ga0207670_10833988
630 Ga0207670_10952234
631 Ga0207669_10706710
632 Ga0207704_10053709
633 Ga0207704_10071136
634 Ga0207691_10038355
635 Ga0207691_10048200
636 Ga0207711_10304743
637 Ga0207689_10027737
638 Ga0207689_10084398
639 Ga0207689_10936417
640 Ga0207661_10153755
641 Ga0207679_10269638
642 Ga0207679_11609459
643 Ga0207667_10180475
644 Ga0207667_10342438
645 Ga0207667_11037030
646 Ga0207667_11320871
647 Ga0207651_10017390
648 Ga0207712_10000339
649 Ga0207712_10651418
650 Ga0207712_11100796
651 Ga0207668_10041123
652 Ga0207668_10380056
653 Ga0207668_11476065
654 Ga0207640_10003559
655 Ga0207640_10107417
656 Ga0207640_10275959
657 Ga0207640_11019762
658 Ga0207658_10043812
659 Ga0207658_10097668
660 Ga0207658_10125960
661 Ga0207658_10242789
662 Ga0207658_10985059
663 Ga0207677_10354699
664 Ga0207703_10620060
665 Ga0207639_10007109
666 Ga0207639_10100285
667 Ga0207639_10219479
668 Ga0207639_10537480
669 Ga0207639_11241409
670 Ga0207678_10060488
671 Ga0207678_10183343
672 Ga0207678_10271817
673 Ga0207678_10556581
674 Ga0207708_10129317
675 Ga0207702_10380598
676 Ga0207641_10019451
677 Ga0207641_10378859
678 Ga0207641_10768723
679 Ga0207641_11047490
680 Ga0207648_10066669
681 Ga0207648_10100527
682 Ga0207648_10559317
683 Ga0207676_10442076
684 Ga0207676_10478208
685 Ga0207674_10035430
686 Ga0207674_10333220
687 Ga0207674_10441417
688 Ga0207674_10700030
689 Ga0207675_100075111
690 Ga0207675_100275587
691 Ga0207683_10006929
692 Ga0207428_10002094
693 Ga0268266_10000001
694 Ga0268266_10287599
695 Ga0268266_10343260
696 Ga0268266_10621012
697 Ga0268266_10905832
698 Ga0268265_10002152
699 Ga0268265_10692791
700 Ga0268264_10281000
701 Ga0268264_12558167
702 Ga0307408_100557506
703 Ga0307413_10639170
704 Ga0307412_11606226
705 Ga0307416_100547279
706 Ga0307411_12165201
707 Ga0307415_101867772
708 Ga0307507_10341824
709 Ga0373940_0269465
710 Ga0451789_0724962
711 Ga0451798_0185228
712 Ga0451800_1406790
713 Ga0451807_2711958
714 Ga0451853_2629089
715 Ga0439448_0015792
716 Ga0495625_0636010
717 Ga0495649_0381355
718 Ga0495686_0239515
719 Ga0496101_0327403
720 Ga0496104_0000011
721 Ga0496105_0000014
722 Ga0496115_0388484
723 Ga0496126_0493443
724 Ga0501032_0002676
725 Ga0501033_0008098
726 Ga0501034_0074938
727 Ga0501036_0004188
728 Ga0501037_0003347
729 Ga0501038_0005332
730 Ga0501039_0005791
731 Ga0501040_0436791
732 Ga0501043_0001981
733 Ga0501046_0222017
734 Ga0501046_0481432
735 Ga0501047_0005277
736 Ga0501048_0448527
737 Ga0501069_0063664
738 Ga0501070_0003814
739 Ga0501072_0407072
740 Ga0501073_0002996
741 Ga0501073_0725712
742 Ga0501074_0003717
743 Ga0501079_0143208
744 Ga0501079_0796818
745 Ga0501079_0977640
746 Ga0501080_0003838
747 Ga0501083_0101194
748 Ga0501083_0128245
749 Ga0501035_0005778
750 Ga0501044_0007944
751 Ga0501044_0247330
752 nmdc:mga05p37_28502_c1
753 nmdc:mga09592_594781_c1
754 nmdc:mga08y16_116514_c1
755 nmdc:mga08y16_523_c1
756 nmdc:mga0rr50_95761_c1
757 nmdc:mga0a205_101383_c1
758 nmdc:mga0a205_487586_c1
759 Ga0500610_0275832
760 Ga0500651_0000774
761 Ga0500651_0003657
762 Ga0500620_228822
763 Ga0500638_054498
764 Ga0501084_0108697
765 Ga0501084_1055696
766 Ga0590074_104450
767 Ga0501082_0000029
768 Ga0530510_0595888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00403

HMA

Heavy-metal-associated domain

24

86

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ff2-assembly1.cif.gz_B copz metallochaperone 0.8937 26 92
6ff1-assembly1.cif.gz_A csoz metallochaperone 0.8912 26 93
1fvs-assembly1.cif.gz_A solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) load states 0.8832 24 97
2qif-assembly1.cif.gz_A crystal structure of a metallochaperone with a tetranuclear cu(i) cluster 0.8822 26 93
1mwz-assembly1.cif.gz_A solution structure of the n-terminal domain of znta in the zn(ii)-form 0.8743 24 92
ID Description Score Start End Superfamily
af_Q7XTY9_89_153_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8945 26 93 3.30.70.100
6ff2B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8938 26 92 3.30.70.100
af_Q5AG51_176_245_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8914 28 93 3.30.70.100
af_I1MPT9_2_67_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8906 26 92 3.30.70.100
af_Q55DN5_348_418_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.885 26 92 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A520V8C6-F1-model_v4 Heavy-metal-associated domain-containing protein 0.9641 24 97 GO:0046872
AF-A0A2E5MVX6-F1-model_v4 HMA domain-containing protein 0.9553 23 97 GO:0046872
AF-A0A2D8XYW0-F1-model_v4 deleted 0.9437 24 97
AF-A0A849MBL1-F1-model_v4 Heavy-metal-associated domain-containing protein 0.9376 24 98 GO:0016020
GO:0046872
AF-A0A328RIN7-F1-model_v4 deleted 0.9322 25 97

Map