F429830
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 384 | 228 | 384 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300005547|Ga0070693_101286691|Ga0070693_1012866911 |
| Length | 123 |
| Sequence | LRSFQHRLSEFEARGVRVVGISVDPPEINRRQSLKQGYTFPLLSDPKMHVIRRYDVLHPGAGPKGADIARPAEFLLDSNGIVRWVNLTDNIAARARPEQVLQAFEQLEHAANAGTTRPLTTDN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 135 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 138 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 139 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 145 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 146 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 154 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 155 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 156 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 157 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 158 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 159 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 160 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 161 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 162 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 163 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0 |
| Rhizoplane | 6.77 |
| Rhizosphere | 92.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1035204 | 3300002070 | Unclassified | 746 |
| 2 | JGI24035J26624_1002017 | 3300002126 | Unclassified | 1892 |
| 3 | JGI25404J52841_10002044 | 3300003659 | Bacteria | 3734 |
| 4 | JGI25405J52794_10001945 | 3300003911 | Bacteria | 3497 |
| 5 | JGI25405J52794_10003290 | 3300003911 | Unclassified | 2825 |
| 6 | JGI25405J52794_10005775 | 3300003911 | Bacteria | 2245 |
| 7 | Ga0065704_10016968 | 3300005289 | Unclassified | 1746 |
| 8 | Ga0065704_10021650 | 3300005289 | Unclassified | 1748 |
| 9 | Ga0065712_10012527 | 3300005290 | Bacteria | 2617 |
| 10 | Ga0065712_10106115 | 3300005290 | Bacteria | 1924 |
| 11 | Ga0065712_10130478 | 3300005290 | Unclassified | 1555 |
| 12 | Ga0065712_10362308 | 3300005290 | Bacteria | 768 |
| 13 | Ga0065715_10013663 | 3300005293 | Bacteria | 2191 |
| 14 | Ga0065715_10034859 | 3300005293 | Unclassified | 1097 |
| 15 | Ga0065715_10092216 | 3300005293 | Bacteria | 5241 |
| 16 | Ga0065715_10210809 | 3300005293 | Bacteria | 1304 |
| 17 | Ga0065707_10289683 | 3300005295 | Unclassified | 988 |
| 18 | Ga0070676_10016388 | 3300005328 | Bacteria | 4096 |
| 19 | Ga0070690_100024947 | 3300005330 | Bacteria | 3680 |
| 20 | Ga0070690_100741073 | 3300005330 | Unclassified | 758 |
| 21 | Ga0068869_100090669 | 3300005334 | Bacteria | 2298 |
| 22 | Ga0068868_100026635 | 3300005338 | Bacteria | 4409 |
| 23 | Ga0070660_100096264 | 3300005339 | Bacteria | 2341 |
| 24 | Ga0070660_100143352 | 3300005339 | Bacteria | 1918 |
| 25 | Ga0070660_100314325 | 3300005339 | Unclassified | 1286 |
| 26 | Ga0070689_100063647 | 3300005340 | Bacteria | 2870 |
| 27 | Ga0070687_100009204 | 3300005343 | Bacteria | 4223 |
| 28 | Ga0070687_100289786 | 3300005343 | Bacteria | 1034 |
| 29 | Ga0070668_100053439 | 3300005347 | Bacteria | 3115 |
| 30 | Ga0070668_100164961 | 3300005347 | Bacteria | 1800 |
| 31 | Ga0070669_100014070 | 3300005353 | Bacteria | 5690 |
| 32 | Ga0070669_100822944 | 3300005353 | Unclassified | 790 |
| 33 | Ga0070669_101376371 | 3300005353 | Unclassified | 612 |
| 34 | Ga0070675_100014117 | 3300005354 | Bacteria | 6294 |
| 35 | Ga0070675_100052030 | 3300005354 | Bacteria | 3366 |
| 36 | Ga0070671_100315484 | 3300005355 | Unclassified | 1332 |
| 37 | Ga0070674_100465198 | 3300005356 | Unclassified | 1046 |
| 38 | Ga0070673_100013906 | 3300005364 | Bacteria | 5587 |
| 39 | Ga0070688_100002909 | 3300005365 | Bacteria | 8734 |
| 40 | Ga0070688_100117531 | 3300005365 | Bacteria | 1777 |
| 41 | Ga0070659_100063482 | 3300005366 | Bacteria | 2922 |
| 42 | Ga0070659_100599434 | 3300005366 | Bacteria | 947 |
| 43 | Ga0070667_100022923 | 3300005367 | Bacteria | 5176 |
| 44 | Ga0070709_10357024 | 3300005434 | Unclassified | 1081 |
| 45 | Ga0070714_100028174 | 3300005435 | Bacteria | 4657 |
| 46 | Ga0070714_100986418 | 3300005435 | Unclassified | 819 |
| 47 | Ga0070713_100186959 | 3300005436 | Unclassified | 1865 |
| 48 | Ga0070713_100303021 | 3300005436 | Bacteria | 1471 |
| 49 | Ga0070711_100034274 | 3300005439 | Bacteria | 3385 |
| 50 | Ga0070711_100435901 | 3300005439 | Bacteria | 1070 |
| 51 | Ga0070694_101111696 | 3300005444 | Bacteria | 659 |
| 52 | Ga0070708_100039602 | 3300005445 | Bacteria | 4124 |
| 53 | Ga0070708_100060962 | 3300005445 | Bacteria | 3369 |
| 54 | Ga0070708_100075874 | 3300005445 | Bacteria | 3035 |
| 55 | Ga0070708_100729315 | 3300005445 | Unclassified | 932 |
| 56 | Ga0070662_100003843 | 3300005457 | Bacteria | 9407 |
| 57 | Ga0070681_10064747 | 3300005458 | Bacteria | 3625 |
| 58 | Ga0070685_10017145 | 3300005466 | Bacteria | 3873 |
| 59 | Ga0070706_100071363 | 3300005467 | Bacteria | 3212 |
| 60 | Ga0070706_101628936 | 3300005467 | Unclassified | 589 |
| 61 | Ga0070707_100444518 | 3300005468 | Unclassified | 1257 |
| 62 | Ga0070707_100449996 | 3300005468 | Bacteria | 1248 |
| 63 | Ga0070699_100087948 | 3300005518 | Unclassified | 2713 |
| 64 | Ga0070679_100494308 | 3300005530 | Unclassified | 1167 |
| 65 | Ga0070684_100008739 | 3300005535 | Bacteria | 7940 |
| 66 | Ga0070697_100009878 | 3300005536 | Bacteria | 7443 |
| 67 | Ga0070697_100045133 | 3300005536 | Unclassified | 3571 |
| 68 | Ga0070697_100617087 | 3300005536 | Bacteria | 954 |
| 69 | Ga0070672_100383548 | 3300005543 | Unclassified | 1202 |
| 70 | Ga0070693_101286691 | 3300005547 | Unclassified | 565 |
| 71 | Ga0070665_100163593 | 3300005548 | Unclassified | 2227 |
| 72 | Ga0070665_100295840 | 3300005548 | Unclassified | 1621 |
| 73 | Ga0068855_101743426 | 3300005563 | Unclassified | 634 |
| 74 | Ga0070664_100131337 | 3300005564 | Unclassified | 2200 |
| 75 | Ga0070664_100339708 | 3300005564 | Unclassified | 1364 |
| 76 | Ga0068864_101993780 | 3300005618 | Unclassified | 587 |
| 77 | Ga0068866_10975019 | 3300005718 | Unclassified | 601 |
| 78 | Ga0068861_100154629 | 3300005719 | Unclassified | 1885 |
| 79 | Ga0068861_102116336 | 3300005719 | Unclassified | 563 |
| 80 | Ga0068863_101486392 | 3300005841 | Unclassified | 686 |
| 81 | Ga0068858_100008431 | 3300005842 | Bacteria | 9908 |
| 82 | Ga0068858_102265996 | 3300005842 | Unclassified | 537 |
| 83 | Ga0068860_100028648 | 3300005843 | Bacteria | 5361 |
| 84 | Ga0068860_101405999 | 3300005843 | Unclassified | 719 |
| 85 | Ga0081455_10001323 | 3300005937 | Bacteria | 30691 |
| 86 | Ga0081455_10001390 | 3300005937 | Bacteria | 29896 |
| 87 | Ga0081455_10016344 | 3300005937 | Bacteria | 7169 |
| 88 | Ga0081455_10041310 | 3300005937 | Unclassified | 4057 |
| 89 | Ga0081455_10325070 | 3300005937 | Unclassified | 1094 |
| 90 | Ga0081540_1000196 | 3300005983 | Bacteria | 62801 |
| 91 | Ga0081540_1007057 | 3300005983 | Bacteria | 8073 |
| 92 | Ga0081539_10033155 | 3300005985 | Unclassified | 3151 |
| 93 | Ga0081539_10053030 | 3300005985 | Bacteria | 2273 |
| 94 | Ga0081539_10253996 | 3300005985 | Unclassified | 779 |
| 95 | Ga0070717_11262279 | 3300006028 | Unclassified | 672 |
| 96 | Ga0070715_10047937 | 3300006163 | Unclassified | 1824 |
| 97 | Ga0070715_10450307 | 3300006163 | Bacteria | 727 |
| 98 | Ga0070716_100636466 | 3300006173 | Unclassified | 807 |
| 99 | Ga0070716_101198638 | 3300006173 | Unclassified | 610 |
| 100 | Ga0070716_101721340 | 3300006173 | Unclassified | 518 |
| 101 | Ga0070712_100179072 | 3300006175 | Bacteria | 1651 |
| 102 | Ga0070712_100413534 | 3300006175 | Bacteria | 1116 |
| 103 | Ga0097621_100043840 | 3300006237 | Bacteria | 3607 |
| 104 | Ga0068871_100675170 | 3300006358 | Unclassified | 945 |
| 105 | Ga0075428_100342571 | 3300006844 | Bacteria | 1605 |
| 106 | Ga0075428_100802726 | 3300006844 | Bacteria | 1000 |
| 107 | Ga0075433_10673268 | 3300006852 | Bacteria | 907 |
| 108 | Ga0075434_100072758 | 3300006871 | Bacteria | 3429 |
| 109 | Ga0075434_100219362 | 3300006871 | Bacteria | 1921 |
| 110 | Ga0075435_101671309 | 3300007076 | Unclassified | 559 |
| 111 | Ga0099794_10121247 | 3300007265 | Unclassified | 1316 |
| 112 | Ga0111539_10205777 | 3300009094 | Bacteria | 2294 |
| 113 | Ga0111539_10834189 | 3300009094 | Unclassified | 1073 |
| 114 | Ga0111539_12615479 | 3300009094 | Unclassified | 585 |
| 115 | Ga0105245_10100001 | 3300009098 | Bacteria | 2682 |
| 116 | Ga0114129_10186439 | 3300009147 | Bacteria | 2819 |
| 117 | Ga0114129_10883147 | 3300009147 | Unclassified | 1134 |
| 118 | Ga0114129_13349256 | 3300009147 | Unclassified | 517 |
| 119 | Ga0105243_10230980 | 3300009148 | Bacteria | 1641 |
| 120 | Ga0105242_10383547 | 3300009176 | Bacteria | 1307 |
| 121 | Ga0105242_10464475 | 3300009176 | Bacteria | 1196 |
| 122 | Ga0105242_10504468 | 3300009176 | Unclassified | 1151 |
| 123 | Ga0105242_10645087 | 3300009176 | Bacteria | 1029 |
| 124 | Ga0105248_10883110 | 3300009177 | Unclassified | 1009 |
| 125 | Ga0105249_10037271 | 3300009553 | Bacteria | 4413 |
| 126 | Ga0105249_11993506 | 3300009553 | Unclassified | 653 |
| 127 | Ga0105249_12222038 | 3300009553 | Bacteria | 621 |
| 128 | Ga0099796_10483026 | 3300010159 | Bacteria | 554 |
| 129 | Ga0105239_10013545 | 3300010375 | Bacteria | 9053 |
| 130 | Ga0105239_10283108 | 3300010375 | Bacteria | 1867 |
| 131 | Ga0105239_11870196 | 3300010375 | Unclassified | 696 |
| 132 | Ga0105246_11403606 | 3300011119 | Unclassified | 652 |
| 133 | Ga0105246_12407945 | 3300011119 | Unclassified | 516 |
| 134 | Ga0157314_1012691 | 3300012500 | Bacteria | 761 |
| 135 | Ga0157370_10292817 | 3300013104 | Bacteria | 1503 |
| 136 | Ga0157369_10147017 | 3300013105 | Bacteria | 2492 |
| 137 | Ga0157374_10093423 | 3300013296 | Bacteria | 2872 |
| 138 | Ga0157374_10159284 | 3300013296 | Unclassified | 2198 |
| 139 | Ga0157374_10231540 | 3300013296 | Unclassified | 1815 |
| 140 | Ga0157374_10408428 | 3300013296 | Unclassified | 1355 |
| 141 | Ga0157374_11260202 | 3300013296 | Unclassified | 761 |
| 142 | Ga0157374_11518174 | 3300013296 | Bacteria | 693 |
| 143 | Ga0157378_10022768 | 3300013297 | Bacteria | 5514 |
| 144 | Ga0157378_10982232 | 3300013297 | Unclassified | 878 |
| 145 | Ga0157378_12605647 | 3300013297 | Unclassified | 558 |
| 146 | Ga0163162_10000001 | 3300013306 | Bacteria | 751833 |
| 147 | Ga0163162_10050775 | 3300013306 | Bacteria | 4159 |
| 148 | Ga0163162_10710846 | 3300013306 | Bacteria | 1126 |
| 149 | Ga0163162_10934439 | 3300013306 | Unclassified | 979 |
| 150 | Ga0163162_11728954 | 3300013306 | Unclassified | 714 |
| 151 | Ga0157372_10825154 | 3300013307 | Unclassified | 1077 |
| 152 | Ga0157375_10110313 | 3300013308 | Bacteria | 2848 |
| 153 | Ga0157375_10703738 | 3300013308 | Unclassified | 1164 |
| 154 | Ga0163163_10434975 | 3300014325 | Unclassified | 1371 |
| 155 | Ga0163163_10555644 | 3300014325 | Unclassified | 1210 |
| 156 | Ga0157380_10026011 | 3300014326 | Unclassified | 4442 |
| 157 | Ga0157376_10927737 | 3300014969 | Unclassified | 890 |
| 158 | Ga0163161_10124681 | 3300017792 | Bacteria | 1938 |
| 159 | Ga0207673_1001943 | 3300025290 | Bacteria | 2311 |
| 160 | Ga0207697_10001371 | 3300025315 | Bacteria | 13337 |
| 161 | Ga0207697_10004423 | 3300025315 | Bacteria | 6720 |
| 162 | Ga0207697_10366383 | 3300025315 | Bacteria | 640 |
| 163 | Ga0207692_10233555 | 3300025898 | Bacteria | 1095 |
| 164 | Ga0207692_10406279 | 3300025898 | Unclassified | 850 |
| 165 | Ga0207688_10121572 | 3300025901 | Bacteria | 1524 |
| 166 | Ga0207688_10195563 | 3300025901 | Unclassified | 1211 |
| 167 | Ga0207680_10051547 | 3300025903 | Unclassified | 2461 |
| 168 | Ga0207685_10076977 | 3300025905 | Bacteria | 1369 |
| 169 | Ga0207645_10002029 | 3300025907 | Bacteria | 16261 |
| 170 | Ga0207645_10156009 | 3300025907 | Bacteria | 1491 |
| 171 | Ga0207684_10263550 | 3300025910 | Bacteria | 1487 |
| 172 | Ga0207684_11272693 | 3300025910 | Bacteria | 606 |
| 173 | Ga0207693_10005201 | 3300025915 | Bacteria | 10893 |
| 174 | Ga0207693_10062084 | 3300025915 | Bacteria | 2927 |
| 175 | Ga0207693_10073229 | 3300025915 | Bacteria | 2682 |
| 176 | Ga0207693_10084656 | 3300025915 | Bacteria | 2484 |
| 177 | Ga0207663_10102246 | 3300025916 | Unclassified | 1927 |
| 178 | Ga0207663_10294709 | 3300025916 | Bacteria | 1210 |
| 179 | Ga0207662_10005797 | 3300025918 | Bacteria | 6613 |
| 180 | Ga0207657_10181090 | 3300025919 | Unclassified | 1703 |
| 181 | Ga0207657_10290226 | 3300025919 | Bacteria | 1297 |
| 182 | Ga0207652_10016457 | 3300025921 | Bacteria | 6039 |
| 183 | Ga0207646_10048096 | 3300025922 | Bacteria | 3824 |
| 184 | Ga0207646_10162521 | 3300025922 | Bacteria | 2015 |
| 185 | Ga0207646_11077932 | 3300025922 | Unclassified | 708 |
| 186 | Ga0207681_10217706 | 3300025923 | Unclassified | 1475 |
| 187 | Ga0207659_10026187 | 3300025926 | Bacteria | 3932 |
| 188 | Ga0207659_10032120 | 3300025926 | Bacteria | 3600 |
| 189 | Ga0207700_10197358 | 3300025928 | Unclassified | 1694 |
| 190 | Ga0207700_11263017 | 3300025928 | Unclassified | 658 |
| 191 | Ga0207664_10314162 | 3300025929 | Bacteria | 1381 |
| 192 | Ga0207664_11139938 | 3300025929 | Unclassified | 696 |
| 193 | Ga0207664_11363062 | 3300025929 | Bacteria | 630 |
| 194 | Ga0207690_10119401 | 3300025932 | Bacteria | 1912 |
| 195 | Ga0207690_10442139 | 3300025932 | Bacteria | 1044 |
| 196 | Ga0207706_10004327 | 3300025933 | Bacteria | 13329 |
| 197 | Ga0207706_10285643 | 3300025933 | Bacteria | 1439 |
| 198 | Ga0207686_10390462 | 3300025934 | Bacteria | 1057 |
| 199 | Ga0207686_11286388 | 3300025934 | Unclassified | 600 |
| 200 | Ga0207709_10284828 | 3300025935 | Unclassified | 1222 |
| 201 | Ga0207670_10063830 | 3300025936 | Bacteria | 2522 |
| 202 | Ga0207670_10380885 | 3300025936 | Unclassified | 1124 |
| 203 | Ga0207670_11673338 | 3300025936 | Unclassified | 541 |
| 204 | Ga0207669_10785637 | 3300025937 | Bacteria | 789 |
| 205 | Ga0207704_10054712 | 3300025938 | Bacteria | 2435 |
| 206 | Ga0207704_10317314 | 3300025938 | Unclassified | 1201 |
| 207 | Ga0207665_10351009 | 3300025939 | Bacteria | 1113 |
| 208 | Ga0207665_10941144 | 3300025939 | Unclassified | 686 |
| 209 | Ga0207665_11244358 | 3300025939 | Unclassified | 594 |
| 210 | Ga0207691_10373041 | 3300025940 | Unclassified | 1219 |
| 211 | Ga0207711_10716249 | 3300025941 | Unclassified | 933 |
| 212 | Ga0207689_10226615 | 3300025942 | Bacteria | 1545 |
| 213 | Ga0207689_11020942 | 3300025942 | Unclassified | 698 |
| 214 | Ga0207661_10334500 | 3300025944 | Unclassified | 1364 |
| 215 | Ga0207679_10222013 | 3300025945 | Unclassified | 1590 |
| 216 | Ga0207679_10277829 | 3300025945 | Unclassified | 1435 |
| 217 | Ga0207667_11411777 | 3300025949 | Unclassified | 669 |
| 218 | Ga0207667_11539946 | 3300025949 | Unclassified | 635 |
| 219 | Ga0207651_10106659 | 3300025960 | Unclassified | 2092 |
| 220 | Ga0207712_10000022 | 3300025961 | Bacteria | 284365 |
| 221 | Ga0207712_10018923 | 3300025961 | Bacteria | 4493 |
| 222 | Ga0207712_11564799 | 3300025961 | Unclassified | 591 |
| 223 | Ga0207668_10041625 | 3300025972 | Bacteria | 3107 |
| 224 | Ga0207668_10907468 | 3300025972 | Unclassified | 784 |
| 225 | Ga0207658_10031332 | 3300025986 | Bacteria | 3774 |
| 226 | Ga0207658_11339085 | 3300025986 | Unclassified | 655 |
| 227 | Ga0207677_10117612 | 3300026023 | Bacteria | 1993 |
| 228 | Ga0207677_10462390 | 3300026023 | Unclassified | 1089 |
| 229 | Ga0207703_10760338 | 3300026035 | Unclassified | 924 |
| 230 | Ga0207703_12037159 | 3300026035 | Unclassified | 550 |
| 231 | Ga0207678_10606219 | 3300026067 | Unclassified | 960 |
| 232 | Ga0207678_10720227 | 3300026067 | Bacteria | 879 |
| 233 | Ga0207708_11441331 | 3300026075 | Unclassified | 605 |
| 234 | Ga0207702_10046096 | 3300026078 | Bacteria | 3669 |
| 235 | Ga0207641_12110420 | 3300026088 | Unclassified | 564 |
| 236 | Ga0207683_10025154 | 3300026121 | Bacteria | 5134 |
| 237 | Ga0209974_10082301 | 3300027876 | Unclassified | 1109 |
| 238 | Ga0268265_10014620 | 3300028380 | Bacteria | 5351 |
| 239 | Ga0268264_10063969 | 3300028381 | Bacteria | 3095 |
| 240 | Ga0268264_11862044 | 3300028381 | Unclassified | 612 |
| 241 | Ga0265316_10629108 | 3300031344 | Bacteria | 760 |
| 242 | Ga0373926_0263077 | 3300035083 | Unclassified | 670 |
| 243 | Ga0373934_0042587 | 3300035086 | Unclassified | 1794 |
| 244 | Ga0373923_0110191 | 3300035111 | Unclassified | 1222 |
| 245 | Ga0373953_0044191 | 3300035117 | Bacteria | 1781 |
| 246 | Ga0373953_0514339 | 3300035117 | Unclassified | 531 |
| 247 | Ga0373956_0149811 | 3300035119 | Unclassified | 1098 |
| 248 | Ga0373943_0027058 | 3300035170 | Bacteria | 2692 |
| 249 | Ga0373943_0110350 | 3300035170 | Bacteria | 1450 |
| 250 | Ga0373946_0245557 | 3300035171 | Unclassified | 872 |
| 251 | Ga0373946_0593759 | 3300035171 | Unclassified | 574 |
| 252 | Ga0373955_0264000 | 3300035172 | Unclassified | 1034 |
| 253 | Ga0373924_0336885 | 3300035410 | Unclassified | 672 |
| 254 | Ga0373935_0103562 | 3300035692 | Bacteria | 1880 |
| 255 | Ga0373935_0831308 | 3300035692 | Unclassified | 682 |
| 256 | Ga0373935_1123075 | 3300035692 | Unclassified | 585 |
| 257 | Ga0373927_0331820 | 3300035695 | Bacteria | 1002 |
| 258 | Ga0373927_0430498 | 3300035695 | Bacteria | 871 |
| 259 | Ga0373933_0244499 | 3300035724 | Unclassified | 1155 |
| 260 | Ga0373947_0015772 | 3300035725 | Bacteria | 4340 |
| 261 | Ga0373947_0131143 | 3300035725 | Bacteria | 1600 |
| 262 | Ga0373947_0255211 | 3300035725 | Unclassified | 1160 |
| 263 | Ga0373947_0692445 | 3300035725 | Bacteria | 695 |
| 264 | Ga0373937_0457969 | 3300036401 | Unclassified | 1211 |
| 265 | Ga0373937_1266380 | 3300036401 | Unclassified | 686 |
| 266 | Ga0373925_0098072 | 3300037068 | Bacteria | 2249 |
| 267 | Ga0373925_0171724 | 3300037068 | Bacteria | 1712 |
| 268 | Ga0373925_0298330 | 3300037068 | Unclassified | 1301 |
| 269 | Ga0373925_1130057 | 3300037068 | Unclassified | 644 |
| 270 | Ga0395900_0001895 | 3300037418 | Bacteria | 23792 |
| 271 | Ga0395900_0637667 | 3300037418 | Bacteria | 1003 |
| 272 | Ga0395900_0965830 | 3300037418 | Unclassified | 773 |
| 273 | Ga0395898_0003099 | 3300037466 | Bacteria | 18810 |
| 274 | Ga0395898_0476832 | 3300037466 | Unclassified | 1187 |
| 275 | Ga0395898_0506296 | 3300037466 | Bacteria | 1148 |
| 276 | Ga0395905_0133237 | 3300037471 | Bacteria | 2337 |
| 277 | Ga0395905_0174307 | 3300037471 | Unclassified | 2020 |
| 278 | Ga0395901_0000371 | 3300038443 | Bacteria | 53982 |
| 279 | Ga0451853_0028516 | 3300041512 | Bacteria | 1636 |
| 280 | Ga0439448_0059839 | 3300042005 | Unclassified | 1258 |
| 281 | Ga0439450_126550 | 3300042008 | Unclassified | 660 |
| 282 | Ga0439455_0004722 | 3300042012 | Bacteria | 2718 |
| 283 | Ga0439455_0020004 | 3300042012 | Bacteria | 1583 |
| 284 | Ga0439458_0018641 | 3300042157 | Bacteria | 1592 |
| 285 | Ga0439444_0044806 | 3300042437 | Unclassified | 881 |
| 286 | Ga0439464_0061716 | 3300042439 | Bacteria | 1098 |
| 287 | Ga0453683_0007570 | 3300044673 | Bacteria | 7356 |
| 288 | Ga0453683_0016215 | 3300044673 | Bacteria | 4813 |
| 289 | Ga0453683_0037174 | 3300044673 | Unclassified | 3063 |
| 290 | Ga0453684_0025477 | 3300044712 | Bacteria | 8586 |
| 291 | Ga0453684_0253018 | 3300044712 | Bacteria | 2022 |
| 292 | Ga0466968_0334561 | 3300044735 | Unclassified | 733 |
| 293 | Ga0451576_0055294 | 3300045051 | Bacteria | 4153 |
| 294 | Ga0466967_1387864 | 3300045976 | Unclassified | 700 |
| 295 | Ga0495592_0022814 | 3300046454 | Bacteria | 4760 |
| 296 | Ga0495592_0410089 | 3300046454 | Unclassified | 856 |
| 297 | Ga0495603_0098743 | 3300046455 | Bacteria | 1705 |
| 298 | Ga0495629_0130007 | 3300046459 | Unclassified | 1754 |
| 299 | Ga0495629_0535136 | 3300046459 | Unclassified | 787 |
| 300 | Ga0495641_0574611 | 3300046461 | Unclassified | 515 |
| 301 | Ga0495651_0087861 | 3300046462 | Bacteria | 2337 |
| 302 | Ga0495651_0419293 | 3300046462 | Unclassified | 870 |
| 303 | Ga0495580_0259399 | 3300046472 | Bacteria | 1189 |
| 304 | Ga0495582_0292857 | 3300046473 | Bacteria | 935 |
| 305 | Ga0495639_0223233 | 3300046475 | Unclassified | 927 |
| 306 | Ga0495664_0099095 | 3300046477 | Bacteria | 1755 |
| 307 | Ga0495608_0268889 | 3300046511 | Bacteria | 1060 |
| 308 | Ga0495618_0558823 | 3300046514 | Unclassified | 684 |
| 309 | Ga0495628_0012240 | 3300046516 | Bacteria | 7232 |
| 310 | Ga0495630_0080701 | 3300046517 | Bacteria | 2454 |
| 311 | Ga0495630_0497717 | 3300046517 | Bacteria | 934 |
| 312 | Ga0495666_0564996 | 3300046526 | Unclassified | 507 |
| 313 | Ga0495652_0065704 | 3300046529 | Bacteria | 3046 |
| 314 | Ga0495586_0057853 | 3300046535 | Bacteria | 2104 |
| 315 | Ga0495587_0030224 | 3300046536 | Bacteria | 3286 |
| 316 | Ga0495645_0045527 | 3300046543 | Bacteria | 3201 |
| 317 | Ga0495667_0174456 | 3300046559 | Bacteria | 1381 |
| 318 | Ga0495667_0210427 | 3300046559 | Bacteria | 1243 |
| 319 | Ga0495634_0032382 | 3300046642 | Bacteria | 3596 |
| 320 | Ga0495635_0072370 | 3300046663 | Bacteria | 2362 |
| 321 | Ga0495588_0345902 | 3300046674 | Bacteria | 782 |
| 322 | Ga0495657_0087276 | 3300046675 | Bacteria | 2008 |
| 323 | Ga0495657_0436609 | 3300046675 | Unclassified | 768 |
| 324 | Ga0495599_0028798 | 3300046678 | Bacteria | 3480 |
| 325 | Ga0495623_0039288 | 3300046679 | Bacteria | 3025 |
| 326 | Ga0495646_0039584 | 3300046680 | Bacteria | 2905 |
| 327 | Ga0495647_0409563 | 3300046681 | Unclassified | 624 |
| 328 | Ga0495658_0066942 | 3300046683 | Bacteria | 2076 |
| 329 | Ga0495669_0481960 | 3300046684 | Unclassified | 603 |
| 330 | Ga0495613_0082171 | 3300046689 | Bacteria | 2340 |
| 331 | Ga0495613_0367039 | 3300046689 | Unclassified | 986 |
| 332 | Ga0495624_0384958 | 3300046690 | Bacteria | 842 |
| 333 | Ga0495600_0284668 | 3300046809 | Bacteria | 1046 |
| 334 | Ga0495581_0170976 | 3300047315 | Bacteria | 1271 |
| 335 | Ga0495604_0018871 | 3300047317 | Bacteria | 5522 |
| 336 | Ga0495604_0449305 | 3300047317 | Bacteria | 842 |
| 337 | Ga0495674_0056331 | 3300047319 | Unclassified | 3443 |
| 338 | Ga0495674_0186989 | 3300047319 | Bacteria | 1723 |
| 339 | Ga0495676_0098381 | 3300047321 | Bacteria | 2171 |
| 340 | Ga0495680_0085405 | 3300047322 | Unclassified | 2376 |
| 341 | Ga0495680_0261557 | 3300047322 | Unclassified | 1224 |
| 342 | Ga0495675_0282466 | 3300047444 | Unclassified | 989 |
| 343 | Ga0495684_0005807 | 3300047471 | Bacteria | 9596 |
| 344 | Ga0495602_0075530 | 3300048088 | Bacteria | 2860 |
| 345 | Ga0495614_0085783 | 3300048089 | Bacteria | 1367 |
| 346 | Ga0496100_0659467 | 3300048903 | Unclassified | 815 |
| 347 | Ga0496100_0673113 | 3300048903 | Unclassified | 807 |
| 348 | Ga0496102_0289446 | 3300048905 | Unclassified | 1544 |
| 349 | Ga0496102_0643447 | 3300048905 | Unclassified | 983 |
| 350 | Ga0496102_1567941 | 3300048905 | Unclassified | 577 |
| 351 | Ga0496103_0118887 | 3300048906 | Bacteria | 1683 |
| 352 | Ga0496104_0065517 | 3300048907 | Bacteria | 3448 |
| 353 | Ga0496104_0222499 | 3300048907 | Unclassified | 1800 |
| 354 | Ga0496104_0619457 | 3300048907 | Unclassified | 992 |
| 355 | Ga0496105_0772776 | 3300048908 | Unclassified | 732 |
| 356 | Ga0496106_1195155 | 3300048909 | Unclassified | 593 |
| 357 | Ga0496108_0073609 | 3300048911 | Bacteria | 2884 |
| 358 | Ga0496109_0098314 | 3300048912 | Bacteria | 2713 |
| 359 | Ga0496109_0109234 | 3300048912 | Unclassified | 2571 |
| 360 | Ga0496109_0722596 | 3300048912 | Unclassified | 934 |
| 361 | Ga0496111_0488363 | 3300048914 | Unclassified | 907 |
| 362 | Ga0496112_0071613 | 3300048915 | Bacteria | 3426 |
| 363 | Ga0496112_0503685 | 3300048915 | Bacteria | 1146 |
| 364 | Ga0496112_0511276 | 3300048915 | Unclassified | 1136 |
| 365 | Ga0496112_0560500 | 3300048915 | Unclassified | 1076 |
| 366 | Ga0496112_0913951 | 3300048915 | Unclassified | 799 |
| 367 | Ga0496113_0090192 | 3300048916 | Bacteria | 2361 |
| 368 | Ga0496113_1364613 | 3300048916 | Unclassified | 550 |
| 369 | Ga0496114_0031379 | 3300048917 | Bacteria | 4373 |
| 370 | Ga0496115_0174648 | 3300048918 | Unclassified | 1776 |
| 371 | Ga0496115_0227203 | 3300048918 | Unclassified | 1539 |
| 372 | Ga0501079_0576364 | 3300049741 | Bacteria | 885 |
| 373 | nmdc:mga05p37_319151_c1 | 3300050507 | Bacteria | 1839 |
| 374 | nmdc:mga05p37_469574_c1 | 3300050507 | Bacteria | 1452 |
| 375 | nmdc:mga06r32_1499332_c1 | 3300050510 | Unclassified | 614 |
| 376 | nmdc:mga08y16_323866_c1 | 3300050511 | Bacteria | 1586 |
| 377 | nmdc:mga0n895_627853_c1 | 3300050512 | Unclassified | 1075 |
| 378 | Ga0495601_0019355 | 3300053077 | Bacteria | 4152 |
| 379 | Ga0495612_0106062 | 3300053078 | Bacteria | 1200 |
| 380 | Ga0495595_0234119 | 3300053084 | Unclassified | 918 |
| 381 | Ga0495619_0501990 | 3300053085 | Unclassified | 834 |
| 382 | Ga0495619_0539414 | 3300053085 | Unclassified | 801 |
| 383 | Ga0495619_0597320 | 3300053085 | Bacteria | 755 |
| 384 | Ga0500566_0321694 | 3300053094 | Unclassified | 720 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003659 | JGI25404J52841_10002044 | JGI25404J52841_100020442 | 96 |
| 2 | 3300005983 | Ga0081540_1000196 | Ga0081540_100019633 | 96 |
| 3 | 3300006173 | Ga0070716_100636466 | Ga0070716_1006364662 | 100 |
| 4 | 3300005719 | Ga0068861_100154629 | Ga0068861_1001546291 | 101 |
| 5 | 3300014326 | Ga0157380_10026011 | Ga0157380_100260115 | 101 |
| 6 | 3300025961 | Ga0207712_10000022 | Ga0207712_1000002234 | 101 |
| 7 | 3300049741 | Ga0501079_0576364 | Ga0501079_0576364_46_354 | 101 |
| 8 | 3300005289 | Ga0065704_10016968 | Ga0065704_100169683 | 103 |
| 9 | 3300017792 | Ga0163161_10124681 | Ga0163161_101246813 | 104 |
| 10 | 3300009147 | Ga0114129_13349256 | Ga0114129_133492562 | 107 |
| 11 | 3300025910 | Ga0207684_10263550 | Ga0207684_102635502 | 107 |
| 12 | 3300025922 | Ga0207646_10162521 | Ga0207646_101625212 | 107 |
| 13 | 3300005290 | Ga0065712_10106115 | Ga0065712_101061152 | 108 |
| 14 | 3300005445 | Ga0070708_100060962 | Ga0070708_1000609623 | 108 |
| 15 | 3300005467 | Ga0070706_100071363 | Ga0070706_1000713633 | 108 |
| 16 | 3300013306 | Ga0163162_10000001 | Ga0163162_10000001136 | 108 |
| 17 | 3300031344 | Ga0265316_10629108 | Ga0265316_106291082 | 109 |
| 18 | 3300005444 | Ga0070694_101111696 | Ga0070694_1011116962 | 110 |
| 19 | 3300005445 | Ga0070708_100729315 | Ga0070708_1007293151 | 111 |
| 20 | 3300005518 | Ga0070699_100087948 | Ga0070699_1000879484 | 111 |
| 21 | 3300005536 | Ga0070697_100045133 | Ga0070697_1000451334 | 111 |
| 22 | 3300007265 | Ga0099794_10121247 | Ga0099794_101212473 | 111 |
| 23 | 3300041512 | Ga0451853_0028516 | Ga0451853_0028516_379_714 | 111 |
| 24 | 3300044735 | Ga0466968_0334561 | Ga0466968_0334561_166_501 | 111 |
| 25 | 3300045976 | Ga0466967_1387864 | Ga0466967_1387864_128_463 | 111 |
| 26 | 3300005289 | Ga0065704_10021650 | Ga0065704_100216503 | 112 |
| 27 | 3300005290 | Ga0065712_10012527 | Ga0065712_100125272 | 112 |
| 28 | 3300005290 | Ga0065712_10130478 | Ga0065712_101304782 | 112 |
| 29 | 3300005290 | Ga0065712_10362308 | Ga0065712_103623082 | 112 |
| 30 | 3300005293 | Ga0065715_10013663 | Ga0065715_100136632 | 112 |
| 31 | 3300005293 | Ga0065715_10034859 | Ga0065715_100348592 | 112 |
| 32 | 3300005293 | Ga0065715_10092216 | Ga0065715_100922165 | 112 |
| 33 | 3300005295 | Ga0065707_10289683 | Ga0065707_102896832 | 112 |
| 34 | 3300005330 | Ga0070690_100024947 | Ga0070690_1000249474 | 112 |
| 35 | 3300005330 | Ga0070690_100741073 | Ga0070690_1007410731 | 112 |
| 36 | 3300005339 | Ga0070660_100096264 | Ga0070660_1000962643 | 112 |
| 37 | 3300005339 | Ga0070660_100314325 | Ga0070660_1003143252 | 112 |
| 38 | 3300005343 | Ga0070687_100289786 | Ga0070687_1002897861 | 112 |
| 39 | 3300005347 | Ga0070668_100164961 | Ga0070668_1001649613 | 112 |
| 40 | 3300005353 | Ga0070669_100822944 | Ga0070669_1008229442 | 112 |
| 41 | 3300005353 | Ga0070669_101376371 | Ga0070669_1013763712 | 112 |
| 42 | 3300005354 | Ga0070675_100052030 | Ga0070675_1000520304 | 112 |
| 43 | 3300005355 | Ga0070671_100315484 | Ga0070671_1003154842 | 112 |
| 44 | 3300005356 | Ga0070674_100465198 | Ga0070674_1004651981 | 112 |
| 45 | 3300005364 | Ga0070673_100013906 | Ga0070673_1000139063 | 112 |
| 46 | 3300005365 | Ga0070688_100117531 | Ga0070688_1001175313 | 112 |
| 47 | 3300005366 | Ga0070659_100599434 | Ga0070659_1005994342 | 112 |
| 48 | 3300005434 | Ga0070709_10357024 | Ga0070709_103570243 | 112 |
| 49 | 3300005435 | Ga0070714_100028174 | Ga0070714_1000281744 | 112 |
| 50 | 3300005435 | Ga0070714_100986418 | Ga0070714_1009864182 | 112 |
| 51 | 3300005436 | Ga0070713_100186959 | Ga0070713_1001869593 | 112 |
| 52 | 3300005436 | Ga0070713_100303021 | Ga0070713_1003030212 | 112 |
| 53 | 3300005439 | Ga0070711_100034274 | Ga0070711_1000342743 | 112 |
| 54 | 3300005439 | Ga0070711_100435901 | Ga0070711_1004359012 | 112 |
| 55 | 3300005445 | Ga0070708_100039602 | Ga0070708_1000396025 | 112 |
| 56 | 3300005458 | Ga0070681_10064747 | Ga0070681_100647474 | 112 |
| 57 | 3300005466 | Ga0070685_10017145 | Ga0070685_100171452 | 112 |
| 58 | 3300005467 | Ga0070706_101628936 | Ga0070706_1016289361 | 112 |
| 59 | 3300005468 | Ga0070707_100444518 | Ga0070707_1004445182 | 112 |
| 60 | 3300005530 | Ga0070679_100494308 | Ga0070679_1004943082 | 112 |
| 61 | 3300005535 | Ga0070684_100008739 | Ga0070684_1000087394 | 112 |
| 62 | 3300005536 | Ga0070697_100009878 | Ga0070697_1000098783 | 112 |
| 63 | 3300005536 | Ga0070697_100617087 | Ga0070697_1006170872 | 112 |
| 64 | 3300005548 | Ga0070665_100163593 | Ga0070665_1001635933 | 112 |
| 65 | 3300005548 | Ga0070665_100295840 | Ga0070665_1002958402 | 112 |
| 66 | 3300005564 | Ga0070664_100131337 | Ga0070664_1001313373 | 112 |
| 67 | 3300005564 | Ga0070664_100339708 | Ga0070664_1003397082 | 112 |
| 68 | 3300005618 | Ga0068864_101993780 | Ga0068864_1019937801 | 112 |
| 69 | 3300005718 | Ga0068866_10975019 | Ga0068866_109750192 | 112 |
| 70 | 3300005719 | Ga0068861_102116336 | Ga0068861_1021163361 | 112 |
| 71 | 3300005841 | Ga0068863_101486392 | Ga0068863_1014863922 | 112 |
| 72 | 3300005842 | Ga0068858_100008431 | Ga0068858_1000084311 | 112 |
| 73 | 3300005843 | Ga0068860_101405999 | Ga0068860_1014059992 | 112 |
| 74 | 3300005937 | Ga0081455_10016344 | Ga0081455_100163446 | 112 |
| 75 | 3300005937 | Ga0081455_10041310 | Ga0081455_100413103 | 112 |
| 76 | 3300005937 | Ga0081455_10325070 | Ga0081455_103250703 | 112 |
| 77 | 3300005985 | Ga0081539_10053030 | Ga0081539_100530303 | 112 |
| 78 | 3300005985 | Ga0081539_10253996 | Ga0081539_102539962 | 112 |
| 79 | 3300006028 | Ga0070717_11262279 | Ga0070717_112622791 | 112 |
| 80 | 3300006163 | Ga0070715_10047937 | Ga0070715_100479373 | 112 |
| 81 | 3300006163 | Ga0070715_10450307 | Ga0070715_104503071 | 112 |
| 82 | 3300006173 | Ga0070716_101721340 | Ga0070716_1017213401 | 112 |
| 83 | 3300006175 | Ga0070712_100413534 | Ga0070712_1004135342 | 112 |
| 84 | 3300006237 | Ga0097621_100043840 | Ga0097621_1000438403 | 112 |
| 85 | 3300006358 | Ga0068871_100675170 | Ga0068871_1006751701 | 112 |
| 86 | 3300006844 | Ga0075428_100342571 | Ga0075428_1003425712 | 112 |
| 87 | 3300006852 | Ga0075433_10673268 | Ga0075433_106732682 | 112 |
| 88 | 3300006871 | Ga0075434_100072758 | Ga0075434_1000727584 | 112 |
| 89 | 3300006871 | Ga0075434_100219362 | Ga0075434_1002193621 | 112 |
| 90 | 3300007076 | Ga0075435_101671309 | Ga0075435_1016713091 | 112 |
| 91 | 3300009094 | Ga0111539_10205777 | Ga0111539_102057772 | 112 |
| 92 | 3300009094 | Ga0111539_10834189 | Ga0111539_108341892 | 112 |
| 93 | 3300009147 | Ga0114129_10186439 | Ga0114129_101864393 | 112 |
| 94 | 3300009147 | Ga0114129_10883147 | Ga0114129_108831472 | 112 |
| 95 | 3300009176 | Ga0105242_10383547 | Ga0105242_103835472 | 112 |
| 96 | 3300009176 | Ga0105242_10504468 | Ga0105242_105044682 | 112 |
| 97 | 3300009176 | Ga0105242_10645087 | Ga0105242_106450872 | 112 |
| 98 | 3300009177 | Ga0105248_10883110 | Ga0105248_108831102 | 112 |
| 99 | 3300009553 | Ga0105249_11993506 | Ga0105249_119935062 | 112 |
| 100 | 3300009553 | Ga0105249_12222038 | Ga0105249_122220382 | 112 |
| 101 | 3300010159 | Ga0099796_10483026 | Ga0099796_104830261 | 112 |
| 102 | 3300010375 | Ga0105239_10283108 | Ga0105239_102831083 | 112 |
| 103 | 3300010375 | Ga0105239_11870196 | Ga0105239_118701961 | 112 |
| 104 | 3300011119 | Ga0105246_11403606 | Ga0105246_114036062 | 112 |
| 105 | 3300011119 | Ga0105246_12407945 | Ga0105246_124079451 | 112 |
| 106 | 3300012500 | Ga0157314_1012691 | Ga0157314_10126912 | 112 |
| 107 | 3300013104 | Ga0157370_10292817 | Ga0157370_102928172 | 112 |
| 108 | 3300013105 | Ga0157369_10147017 | Ga0157369_101470173 | 112 |
| 109 | 3300013296 | Ga0157374_10159284 | Ga0157374_101592842 | 112 |
| 110 | 3300013296 | Ga0157374_10231540 | Ga0157374_102315403 | 112 |
| 111 | 3300013296 | Ga0157374_10408428 | Ga0157374_104084282 | 112 |
| 112 | 3300013296 | Ga0157374_11260202 | Ga0157374_112602022 | 112 |
| 113 | 3300013296 | Ga0157374_11518174 | Ga0157374_115181741 | 112 |
| 114 | 3300013297 | Ga0157378_10982232 | Ga0157378_109822322 | 112 |
| 115 | 3300013297 | Ga0157378_12605647 | Ga0157378_126056472 | 112 |
| 116 | 3300013306 | Ga0163162_10710846 | Ga0163162_107108462 | 112 |
| 117 | 3300013306 | Ga0163162_10934439 | Ga0163162_109344392 | 112 |
| 118 | 3300013306 | Ga0163162_11728954 | Ga0163162_117289542 | 112 |
| 119 | 3300013308 | Ga0157375_10703738 | Ga0157375_107037383 | 112 |
| 120 | 3300014325 | Ga0163163_10434975 | Ga0163163_104349752 | 112 |
| 121 | 3300014325 | Ga0163163_10555644 | Ga0163163_105556443 | 112 |
| 122 | 3300014969 | Ga0157376_10927737 | Ga0157376_109277372 | 112 |
| 123 | 3300025315 | Ga0207697_10004423 | Ga0207697_100044234 | 112 |
| 124 | 3300025315 | Ga0207697_10366383 | Ga0207697_103663832 | 112 |
| 125 | 3300025898 | Ga0207692_10233555 | Ga0207692_102335552 | 112 |
| 126 | 3300025901 | Ga0207688_10121572 | Ga0207688_101215723 | 112 |
| 127 | 3300025903 | Ga0207680_10051547 | Ga0207680_100515471 | 112 |
| 128 | 3300025905 | Ga0207685_10076977 | Ga0207685_100769771 | 112 |
| 129 | 3300025907 | Ga0207645_10156009 | Ga0207645_101560092 | 112 |
| 130 | 3300025910 | Ga0207684_11272693 | Ga0207684_112726932 | 112 |
| 131 | 3300025915 | Ga0207693_10062084 | Ga0207693_100620843 | 112 |
| 132 | 3300025915 | Ga0207693_10073229 | Ga0207693_100732293 | 112 |
| 133 | 3300025915 | Ga0207693_10084656 | Ga0207693_100846562 | 112 |
| 134 | 3300025916 | Ga0207663_10102246 | Ga0207663_101022462 | 112 |
| 135 | 3300025916 | Ga0207663_10294709 | Ga0207663_102947092 | 112 |
| 136 | 3300025919 | Ga0207657_10290226 | Ga0207657_102902262 | 112 |
| 137 | 3300025921 | Ga0207652_10016457 | Ga0207652_100164573 | 112 |
| 138 | 3300025922 | Ga0207646_11077932 | Ga0207646_110779322 | 112 |
| 139 | 3300025926 | Ga0207659_10032120 | Ga0207659_100321205 | 112 |
| 140 | 3300025928 | Ga0207700_10197358 | Ga0207700_101973583 | 112 |
| 141 | 3300025928 | Ga0207700_11263017 | Ga0207700_112630171 | 112 |
| 142 | 3300025929 | Ga0207664_10314162 | Ga0207664_103141622 | 112 |
| 143 | 3300025929 | Ga0207664_11139938 | Ga0207664_111399381 | 112 |
| 144 | 3300025929 | Ga0207664_11363062 | Ga0207664_113630622 | 112 |
| 145 | 3300025932 | Ga0207690_10442139 | Ga0207690_104421392 | 112 |
| 146 | 3300025933 | Ga0207706_10285643 | Ga0207706_102856432 | 112 |
| 147 | 3300025934 | Ga0207686_10390462 | Ga0207686_103904622 | 112 |
| 148 | 3300025934 | Ga0207686_11286388 | Ga0207686_112863882 | 112 |
| 149 | 3300025936 | Ga0207670_10380885 | Ga0207670_103808853 | 112 |
| 150 | 3300025936 | Ga0207670_11673338 | Ga0207670_116733381 | 112 |
| 151 | 3300025937 | Ga0207669_10785637 | Ga0207669_107856372 | 112 |
| 152 | 3300025938 | Ga0207704_10054712 | Ga0207704_100547122 | 112 |
| 153 | 3300025939 | Ga0207665_10351009 | Ga0207665_103510091 | 112 |
| 154 | 3300025939 | Ga0207665_10941144 | Ga0207665_109411442 | 112 |
| 155 | 3300025941 | Ga0207711_10716249 | Ga0207711_107162492 | 112 |
| 156 | 3300025942 | Ga0207689_11020942 | Ga0207689_110209422 | 112 |
| 157 | 3300025944 | Ga0207661_10334500 | Ga0207661_103345002 | 112 |
| 158 | 3300025945 | Ga0207679_10222013 | Ga0207679_102220132 | 112 |
| 159 | 3300025945 | Ga0207679_10277829 | Ga0207679_102778292 | 112 |
| 160 | 3300025949 | Ga0207667_11411777 | Ga0207667_114117771 | 112 |
| 161 | 3300025960 | Ga0207651_10106659 | Ga0207651_101066591 | 112 |
| 162 | 3300025961 | Ga0207712_11564799 | Ga0207712_115647992 | 112 |
| 163 | 3300025972 | Ga0207668_10907468 | Ga0207668_109074682 | 112 |
| 164 | 3300025986 | Ga0207658_11339085 | Ga0207658_113390852 | 112 |
| 165 | 3300026023 | Ga0207677_10117612 | Ga0207677_101176122 | 112 |
| 166 | 3300026035 | Ga0207703_10760338 | Ga0207703_107603382 | 112 |
| 167 | 3300026067 | Ga0207678_10606219 | Ga0207678_106062193 | 112 |
| 168 | 3300026067 | Ga0207678_10720227 | Ga0207678_107202272 | 112 |
| 169 | 3300026078 | Ga0207702_10046096 | Ga0207702_100460963 | 112 |
| 170 | 3300026088 | Ga0207641_12110420 | Ga0207641_121104202 | 112 |
| 171 | 3300026121 | Ga0207683_10025154 | Ga0207683_100251544 | 112 |
| 172 | 3300028381 | Ga0268264_11862044 | Ga0268264_118620442 | 112 |
| 173 | 3300035083 | Ga0373926_0263077 | Ga0373926_0263077_193_531 | 112 |
| 174 | 3300035086 | Ga0373934_0042587 | Ga0373934_0042587_151_489 | 112 |
| 175 | 3300035111 | Ga0373923_0110191 | Ga0373923_0110191_680_1018 | 112 |
| 176 | 3300035117 | Ga0373953_0044191 | Ga0373953_0044191_663_1001 | 112 |
| 177 | 3300035117 | Ga0373953_0514339 | Ga0373953_0514339_81_419 | 112 |
| 178 | 3300035119 | Ga0373956_0149811 | Ga0373956_0149811_147_485 | 112 |
| 179 | 3300035170 | Ga0373943_0027058 | Ga0373943_0027058_752_1090 | 112 |
| 180 | 3300035170 | Ga0373943_0110350 | Ga0373943_0110350_920_1258 | 112 |
| 181 | 3300035171 | Ga0373946_0245557 | Ga0373946_0245557_413_751 | 112 |
| 182 | 3300035171 | Ga0373946_0593759 | Ga0373946_0593759_144_482 | 112 |
| 183 | 3300035172 | Ga0373955_0264000 | Ga0373955_0264000_215_553 | 112 |
| 184 | 3300035410 | Ga0373924_0336885 | Ga0373924_0336885_212_550 | 112 |
| 185 | 3300035692 | Ga0373935_0103562 | Ga0373935_0103562_1252_1590 | 112 |
| 186 | 3300035692 | Ga0373935_0831308 | Ga0373935_0831308_203_541 | 112 |
| 187 | 3300035692 | Ga0373935_1123075 | Ga0373935_1123075_33_371 | 112 |
| 188 | 3300035695 | Ga0373927_0331820 | Ga0373927_0331820_58_396 | 112 |
| 189 | 3300035695 | Ga0373927_0430498 | Ga0373927_0430498_445_783 | 112 |
| 190 | 3300035724 | Ga0373933_0244499 | Ga0373933_0244499_13_351 | 112 |
| 191 | 3300035725 | Ga0373947_0015772 | Ga0373947_0015772_3098_3436 | 112 |
| 192 | 3300035725 | Ga0373947_0131143 | Ga0373947_0131143_446_784 | 112 |
| 193 | 3300035725 | Ga0373947_0255211 | Ga0373947_0255211_795_1133 | 112 |
| 194 | 3300035725 | Ga0373947_0692445 | Ga0373947_0692445_301_639 | 112 |
| 195 | 3300036401 | Ga0373937_0457969 | Ga0373937_0457969_150_488 | 112 |
| 196 | 3300036401 | Ga0373937_1266380 | Ga0373937_1266380_228_566 | 112 |
| 197 | 3300037068 | Ga0373925_0098072 | Ga0373925_0098072_813_1151 | 112 |
| 198 | 3300037068 | Ga0373925_0171724 | Ga0373925_0171724_1238_1576 | 112 |
| 199 | 3300037068 | Ga0373925_0298330 | Ga0373925_0298330_237_575 | 112 |
| 200 | 3300037068 | Ga0373925_1130057 | Ga0373925_1130057_215_553 | 112 |
| 201 | 3300042005 | Ga0439448_0059839 | Ga0439448_0059839_825_1163 | 112 |
| 202 | 3300042008 | Ga0439450_126550 | Ga0439450_126550_243_581 | 112 |
| 203 | 3300042012 | Ga0439455_0004722 | Ga0439455_0004722_181_519 | 112 |
| 204 | 3300042012 | Ga0439455_0020004 | Ga0439455_0020004_814_1152 | 112 |
| 205 | 3300042157 | Ga0439458_0018641 | Ga0439458_0018641_1178_1516 | 112 |
| 206 | 3300042437 | Ga0439444_0044806 | Ga0439444_0044806_513_851 | 112 |
| 207 | 3300042439 | Ga0439464_0061716 | Ga0439464_0061716_629_967 | 112 |
| 208 | 3300044673 | Ga0453683_0016215 | Ga0453683_0016215_1171_1509 | 112 |
| 209 | 3300044712 | Ga0453684_0253018 | Ga0453684_0253018_377_715 | 112 |
| 210 | 3300046454 | Ga0495592_0022814 | Ga0495592_0022814_455_793 | 112 |
| 211 | 3300046454 | Ga0495592_0410089 | Ga0495592_0410089_469_807 | 112 |
| 212 | 3300046455 | Ga0495603_0098743 | Ga0495603_0098743_853_1191 | 112 |
| 213 | 3300046459 | Ga0495629_0130007 | Ga0495629_0130007_673_1011 | 112 |
| 214 | 3300046459 | Ga0495629_0535136 | Ga0495629_0535136_158_496 | 112 |
| 215 | 3300046461 | Ga0495641_0574611 | Ga0495641_0574611_140_478 | 112 |
| 216 | 3300046462 | Ga0495651_0087861 | Ga0495651_0087861_1876_2214 | 112 |
| 217 | 3300046462 | Ga0495651_0419293 | Ga0495651_0419293_62_400 | 112 |
| 218 | 3300046472 | Ga0495580_0259399 | Ga0495580_0259399_28_366 | 112 |
| 219 | 3300046473 | Ga0495582_0292857 | Ga0495582_0292857_398_736 | 112 |
| 220 | 3300046475 | Ga0495639_0223233 | Ga0495639_0223233_52_390 | 112 |
| 221 | 3300046477 | Ga0495664_0099095 | Ga0495664_0099095_1336_1674 | 112 |
| 222 | 3300046511 | Ga0495608_0268889 | Ga0495608_0268889_329_667 | 112 |
| 223 | 3300046514 | Ga0495618_0558823 | Ga0495618_0558823_176_514 | 112 |
| 224 | 3300046516 | Ga0495628_0012240 | Ga0495628_0012240_4474_4812 | 112 |
| 225 | 3300046517 | Ga0495630_0080701 | Ga0495630_0080701_1292_1630 | 112 |
| 226 | 3300046517 | Ga0495630_0497717 | Ga0495630_0497717_271_609 | 112 |
| 227 | 3300046526 | Ga0495666_0564996 | Ga0495666_0564996_53_391 | 112 |
| 228 | 3300046529 | Ga0495652_0065704 | Ga0495652_0065704_1466_1804 | 112 |
| 229 | 3300046535 | Ga0495586_0057853 | Ga0495586_0057853_1290_1628 | 112 |
| 230 | 3300046536 | Ga0495587_0030224 | Ga0495587_0030224_2146_2484 | 112 |
| 231 | 3300046543 | Ga0495645_0045527 | Ga0495645_0045527_287_625 | 112 |
| 232 | 3300046559 | Ga0495667_0174456 | Ga0495667_0174456_329_667 | 112 |
| 233 | 3300046559 | Ga0495667_0210427 | Ga0495667_0210427_712_1050 | 112 |
| 234 | 3300046642 | Ga0495634_0032382 | Ga0495634_0032382_2283_2621 | 112 |
| 235 | 3300046663 | Ga0495635_0072370 | Ga0495635_0072370_992_1330 | 112 |
| 236 | 3300046674 | Ga0495588_0345902 | Ga0495588_0345902_374_712 | 112 |
| 237 | 3300046675 | Ga0495657_0087276 | Ga0495657_0087276_632_970 | 112 |
| 238 | 3300046675 | Ga0495657_0436609 | Ga0495657_0436609_329_667 | 112 |
| 239 | 3300046678 | Ga0495599_0028798 | Ga0495599_0028798_2857_3195 | 112 |
| 240 | 3300046679 | Ga0495623_0039288 | Ga0495623_0039288_89_427 | 112 |
| 241 | 3300046680 | Ga0495646_0039584 | Ga0495646_0039584_1168_1506 | 112 |
| 242 | 3300046681 | Ga0495647_0409563 | Ga0495647_0409563_61_399 | 112 |
| 243 | 3300046683 | Ga0495658_0066942 | Ga0495658_0066942_465_803 | 112 |
| 244 | 3300046684 | Ga0495669_0481960 | Ga0495669_0481960_70_408 | 112 |
| 245 | 3300046689 | Ga0495613_0082171 | Ga0495613_0082171_1829_2167 | 112 |
| 246 | 3300046689 | Ga0495613_0367039 | Ga0495613_0367039_200_538 | 112 |
| 247 | 3300046690 | Ga0495624_0384958 | Ga0495624_0384958_179_517 | 112 |
| 248 | 3300046809 | Ga0495600_0284668 | Ga0495600_0284668_339_677 | 112 |
| 249 | 3300047315 | Ga0495581_0170976 | Ga0495581_0170976_55_393 | 112 |
| 250 | 3300047317 | Ga0495604_0018871 | Ga0495604_0018871_3993_4331 | 112 |
| 251 | 3300047317 | Ga0495604_0449305 | Ga0495604_0449305_92_430 | 112 |
| 252 | 3300047319 | Ga0495674_0056331 | Ga0495674_0056331_2108_2446 | 112 |
| 253 | 3300047319 | Ga0495674_0186989 | Ga0495674_0186989_1131_1469 | 112 |
| 254 | 3300047321 | Ga0495676_0098381 | Ga0495676_0098381_1784_2122 | 112 |
| 255 | 3300047322 | Ga0495680_0085405 | Ga0495680_0085405_954_1292 | 112 |
| 256 | 3300047322 | Ga0495680_0261557 | Ga0495680_0261557_416_754 | 112 |
| 257 | 3300047444 | Ga0495675_0282466 | Ga0495675_0282466_613_951 | 112 |
| 258 | 3300047471 | Ga0495684_0005807 | Ga0495684_0005807_2143_2481 | 112 |
| 259 | 3300048088 | Ga0495602_0075530 | Ga0495602_0075530_1015_1353 | 112 |
| 260 | 3300048089 | Ga0495614_0085783 | Ga0495614_0085783_514_852 | 112 |
| 261 | 3300048903 | Ga0496100_0659467 | Ga0496100_0659467_281_619 | 112 |
| 262 | 3300048903 | Ga0496100_0673113 | Ga0496100_0673113_65_403 | 112 |
| 263 | 3300048905 | Ga0496102_0289446 | Ga0496102_0289446_289_627 | 112 |
| 264 | 3300048905 | Ga0496102_0643447 | Ga0496102_0643447_412_750 | 112 |
| 265 | 3300048905 | Ga0496102_1567941 | Ga0496102_1567941_38_376 | 112 |
| 266 | 3300048906 | Ga0496103_0118887 | Ga0496103_0118887_609_947 | 112 |
| 267 | 3300048907 | Ga0496104_0065517 | Ga0496104_0065517_2499_2837 | 112 |
| 268 | 3300048907 | Ga0496104_0222499 | Ga0496104_0222499_1189_1527 | 112 |
| 269 | 3300048907 | Ga0496104_0619457 | Ga0496104_0619457_518_856 | 112 |
| 270 | 3300048908 | Ga0496105_0772776 | Ga0496105_0772776_20_358 | 112 |
| 271 | 3300048909 | Ga0496106_1195155 | Ga0496106_1195155_167_505 | 112 |
| 272 | 3300048911 | Ga0496108_0073609 | Ga0496108_0073609_1618_1956 | 112 |
| 273 | 3300048912 | Ga0496109_0098314 | Ga0496109_0098314_1039_1377 | 112 |
| 274 | 3300048912 | Ga0496109_0109234 | Ga0496109_0109234_708_1046 | 112 |
| 275 | 3300048914 | Ga0496111_0488363 | Ga0496111_0488363_146_484 | 112 |
| 276 | 3300048915 | Ga0496112_0071613 | Ga0496112_0071613_2683_3021 | 112 |
| 277 | 3300048915 | Ga0496112_0511276 | Ga0496112_0511276_325_663 | 112 |
| 278 | 3300048915 | Ga0496112_0560500 | Ga0496112_0560500_133_471 | 112 |
| 279 | 3300048915 | Ga0496112_0913951 | Ga0496112_0913951_295_633 | 112 |
| 280 | 3300048916 | Ga0496113_0090192 | Ga0496113_0090192_898_1236 | 112 |
| 281 | 3300048917 | Ga0496114_0031379 | Ga0496114_0031379_2636_2974 | 112 |
| 282 | 3300048918 | Ga0496115_0174648 | Ga0496115_0174648_10_348 | 112 |
| 283 | 3300048918 | Ga0496115_0227203 | Ga0496115_0227203_266_604 | 112 |
| 284 | 3300050507 | nmdc:mga05p37_319151_c1 | nmdc:mga05p37_319151_c1_467_805 | 112 |
| 285 | 3300050507 | nmdc:mga05p37_469574_c1 | nmdc:mga05p37_469574_c1_1100_1438 | 112 |
| 286 | 3300050510 | nmdc:mga06r32_1499332_c1 | nmdc:mga06r32_1499332_c1_186_524 | 112 |
| 287 | 3300050511 | nmdc:mga08y16_323866_c1 | nmdc:mga08y16_323866_c1_20_358 | 112 |
| 288 | 3300050512 | nmdc:mga0n895_627853_c1 | nmdc:mga0n895_627853_c1_535_873 | 112 |
| 289 | 3300053077 | Ga0495601_0019355 | Ga0495601_0019355_2575_2913 | 112 |
| 290 | 3300053078 | Ga0495612_0106062 | Ga0495612_0106062_27_365 | 112 |
| 291 | 3300053084 | Ga0495595_0234119 | Ga0495595_0234119_120_458 | 112 |
| 292 | 3300053085 | Ga0495619_0501990 | Ga0495619_0501990_326_664 | 112 |
| 293 | 3300053085 | Ga0495619_0539414 | Ga0495619_0539414_147_485 | 112 |
| 294 | 3300053085 | Ga0495619_0597320 | Ga0495619_0597320_337_675 | 112 |
| 295 | 3300053094 | Ga0500566_0321694 | Ga0500566_0321694_227_565 | 112 |
| 296 | 3300002070 | JGI24750J21931_1035204 | JGI24750J21931_10352042 | 113 |
| 297 | 3300002126 | JGI24035J26624_1002017 | JGI24035J26624_10020172 | 113 |
| 298 | 3300003911 | JGI25405J52794_10001945 | JGI25405J52794_100019452 | 113 |
| 299 | 3300003911 | JGI25405J52794_10003290 | JGI25405J52794_100032903 | 113 |
| 300 | 3300003911 | JGI25405J52794_10005775 | JGI25405J52794_100057753 | 113 |
| 301 | 3300005293 | Ga0065715_10210809 | Ga0065715_102108092 | 113 |
| 302 | 3300005328 | Ga0070676_10016388 | Ga0070676_100163883 | 113 |
| 303 | 3300005334 | Ga0068869_100090669 | Ga0068869_1000906691 | 113 |
| 304 | 3300005338 | Ga0068868_100026635 | Ga0068868_1000266353 | 113 |
| 305 | 3300005339 | Ga0070660_100143352 | Ga0070660_1001433523 | 113 |
| 306 | 3300005340 | Ga0070689_100063647 | Ga0070689_1000636471 | 113 |
| 307 | 3300005343 | Ga0070687_100009204 | Ga0070687_1000092043 | 113 |
| 308 | 3300005347 | Ga0070668_100053439 | Ga0070668_1000534393 | 113 |
| 309 | 3300005353 | Ga0070669_100014070 | Ga0070669_1000140705 | 113 |
| 310 | 3300005354 | Ga0070675_100014117 | Ga0070675_1000141175 | 113 |
| 311 | 3300005365 | Ga0070688_100002909 | Ga0070688_10000290912 | 113 |
| 312 | 3300005366 | Ga0070659_100063482 | Ga0070659_1000634823 | 113 |
| 313 | 3300005367 | Ga0070667_100022923 | Ga0070667_1000229235 | 113 |
| 314 | 3300005445 | Ga0070708_100075874 | Ga0070708_1000758743 | 113 |
| 315 | 3300005457 | Ga0070662_100003843 | Ga0070662_1000038436 | 113 |
| 316 | 3300005468 | Ga0070707_100449996 | Ga0070707_1004499962 | 113 |
| 317 | 3300005543 | Ga0070672_100383548 | Ga0070672_1003835482 | 113 |
| 318 | 3300005547 | Ga0070693_101286691 | Ga0070693_1012866911 | 113 |
| 319 | 3300005563 | Ga0068855_101743426 | Ga0068855_1017434262 | 113 |
| 320 | 3300005842 | Ga0068858_102265996 | Ga0068858_1022659961 | 113 |
| 321 | 3300005843 | Ga0068860_100028648 | Ga0068860_1000286484 | 113 |
| 322 | 3300005937 | Ga0081455_10001323 | Ga0081455_1000132329 | 113 |
| 323 | 3300005937 | Ga0081455_10001390 | Ga0081455_100013903 | 113 |
| 324 | 3300005983 | Ga0081540_1007057 | Ga0081540_100705710 | 113 |
| 325 | 3300005985 | Ga0081539_10033155 | Ga0081539_100331553 | 113 |
| 326 | 3300006173 | Ga0070716_101198638 | Ga0070716_1011986382 | 113 |
| 327 | 3300006175 | Ga0070712_100179072 | Ga0070712_1001790722 | 113 |
| 328 | 3300006844 | Ga0075428_100802726 | Ga0075428_1008027262 | 113 |
| 329 | 3300009094 | Ga0111539_12615479 | Ga0111539_126154792 | 113 |
| 330 | 3300009098 | Ga0105245_10100001 | Ga0105245_101000013 | 113 |
| 331 | 3300009148 | Ga0105243_10230980 | Ga0105243_102309801 | 113 |
| 332 | 3300009176 | Ga0105242_10464475 | Ga0105242_104644753 | 113 |
| 333 | 3300009553 | Ga0105249_10037271 | Ga0105249_100372713 | 113 |
| 334 | 3300010375 | Ga0105239_10013545 | Ga0105239_100135454 | 113 |
| 335 | 3300013296 | Ga0157374_10093423 | Ga0157374_100934232 | 113 |
| 336 | 3300013297 | Ga0157378_10022768 | Ga0157378_100227684 | 113 |
| 337 | 3300013306 | Ga0163162_10050775 | Ga0163162_100507753 | 113 |
| 338 | 3300013307 | Ga0157372_10825154 | Ga0157372_108251542 | 113 |
| 339 | 3300013308 | Ga0157375_10110313 | Ga0157375_101103134 | 113 |
| 340 | 3300025290 | Ga0207673_1001943 | Ga0207673_10019432 | 113 |
| 341 | 3300025315 | Ga0207697_10001371 | Ga0207697_100013714 | 113 |
| 342 | 3300025898 | Ga0207692_10406279 | Ga0207692_104062792 | 113 |
| 343 | 3300025901 | Ga0207688_10195563 | Ga0207688_101955632 | 113 |
| 344 | 3300025907 | Ga0207645_10002029 | Ga0207645_100020295 | 113 |
| 345 | 3300025915 | Ga0207693_10005201 | Ga0207693_100052013 | 113 |
| 346 | 3300025918 | Ga0207662_10005797 | Ga0207662_100057974 | 113 |
| 347 | 3300025919 | Ga0207657_10181090 | Ga0207657_101810902 | 113 |
| 348 | 3300025922 | Ga0207646_10048096 | Ga0207646_100480962 | 113 |
| 349 | 3300025923 | Ga0207681_10217706 | Ga0207681_102177062 | 113 |
| 350 | 3300025926 | Ga0207659_10026187 | Ga0207659_100261874 | 113 |
| 351 | 3300025932 | Ga0207690_10119401 | Ga0207690_101194012 | 113 |
| 352 | 3300025933 | Ga0207706_10004327 | Ga0207706_100043279 | 113 |
| 353 | 3300025935 | Ga0207709_10284828 | Ga0207709_102848281 | 113 |
| 354 | 3300025936 | Ga0207670_10063830 | Ga0207670_100638301 | 113 |
| 355 | 3300025938 | Ga0207704_10317314 | Ga0207704_103173142 | 113 |
| 356 | 3300025939 | Ga0207665_11244358 | Ga0207665_112443581 | 113 |
| 357 | 3300025940 | Ga0207691_10373041 | Ga0207691_103730412 | 113 |
| 358 | 3300025942 | Ga0207689_10226615 | Ga0207689_102266152 | 113 |
| 359 | 3300025949 | Ga0207667_11539946 | Ga0207667_115399462 | 113 |
| 360 | 3300025961 | Ga0207712_10018923 | Ga0207712_100189233 | 113 |
| 361 | 3300025972 | Ga0207668_10041625 | Ga0207668_100416253 | 113 |
| 362 | 3300025986 | Ga0207658_10031332 | Ga0207658_100313323 | 113 |
| 363 | 3300026023 | Ga0207677_10462390 | Ga0207677_104623902 | 113 |
| 364 | 3300026035 | Ga0207703_12037159 | Ga0207703_120371591 | 113 |
| 365 | 3300026075 | Ga0207708_11441331 | Ga0207708_114413311 | 113 |
| 366 | 3300027876 | Ga0209974_10082301 | Ga0209974_100823012 | 113 |
| 367 | 3300028380 | Ga0268265_10014620 | Ga0268265_100146205 | 113 |
| 368 | 3300028381 | Ga0268264_10063969 | Ga0268264_100639695 | 113 |
| 369 | 3300037418 | Ga0395900_0001895 | Ga0395900_0001895_3867_4208 | 113 |
| 370 | 3300037418 | Ga0395900_0637667 | Ga0395900_0637667_649_990 | 113 |
| 371 | 3300037418 | Ga0395900_0965830 | Ga0395900_0965830_293_634 | 113 |
| 372 | 3300037466 | Ga0395898_0003099 | Ga0395898_0003099_7898_8239 | 113 |
| 373 | 3300037466 | Ga0395898_0476832 | Ga0395898_0476832_345_686 | 113 |
| 374 | 3300037466 | Ga0395898_0506296 | Ga0395898_0506296_152_493 | 113 |
| 375 | 3300037471 | Ga0395905_0133237 | Ga0395905_0133237_1729_2070 | 113 |
| 376 | 3300037471 | Ga0395905_0174307 | Ga0395905_0174307_1401_1742 | 113 |
| 377 | 3300038443 | Ga0395901_0000371 | Ga0395901_0000371_44355_44696 | 113 |
| 378 | 3300044673 | Ga0453683_0007570 | Ga0453683_0007570_5810_6166 | 113 |
| 379 | 3300044673 | Ga0453683_0037174 | Ga0453683_0037174_135_485 | 113 |
| 380 | 3300044712 | Ga0453684_0025477 | Ga0453684_0025477_2500_2850 | 113 |
| 381 | 3300045051 | Ga0451576_0055294 | Ga0451576_0055294_540_881 | 113 |
| 382 | 3300048912 | Ga0496109_0722596 | Ga0496109_0722596_267_632 | 113 |
| 383 | 3300048915 | Ga0496112_0503685 | Ga0496112_0503685_634_999 | 113 |
| 384 | 3300048916 | Ga0496113_1364613 | Ga0496113_1364613_142_507 | 113 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5imf-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - structure f5 | 0.9225 | 4 | 58 |
| 5iph-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c84s mutant | 0.9197 | 4 | 58 |
| 5io2-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c48s mutant | 0.9169 | 4 | 58 |
| 3gkn-assembly1.cif.gz_A | insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures | 0.8513 | 2 | 68 |
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.7534 | 3 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5iphA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9188 | 4 | 58 | 3.40.30.10 |
| af_Q9D1A0_27_140_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7647 | 9 | 64 | 3.40.30.10 |
| af_Q559T9_1_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7518 | 2 | 110 | 3.40.30.10 |
| 2cx4E00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7402 | 3 | 106 | 3.40.30.10 |
| af_I1MS47_66_213_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7196 | 3 | 106 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838F5H2-F1-model_v4 | Redoxin domain-containing protein | 0.952 | 1 | 55 |
GO:0016209
GO:0016491 |
| AF-A0A817N411-F1-model_v4 | Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein | 0.9444 | 3 | 58 |
GO:0016209
GO:0016491 |
| AF-A0A562JS45-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.944 | 1 | 59 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A379GF01-F1-model_v4 | Thioredoxin-dependent peroxiredoxin Bcp | 0.9397 | 4 | 56 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A3M0YUJ4-F1-model_v4 | Peroxiredoxin | 0.9392 | 1 | 54 |
GO:0016209
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar