F429830

General Info

Members Datasets Scaffolds Average Seq Length
384 228 384 112

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_101286691|Ga0070693_1012866911
Length 123
Sequence LRSFQHRLSEFEARGVRVVGISVDPPEINRRQSLKQGYTFPLLSDPKMHVIRRYDVLHPGAGPKGADIARPAEFLLDSNGIVRWVNLTDNIAARARPEQVLQAFEQLEHAANAGTTRPLTTDN

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
156 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 6.77
Rhizosphere 92.71
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1035204 3300002070 Unclassified 746
2 JGI24035J26624_1002017 3300002126 Unclassified 1892
3 JGI25404J52841_10002044 3300003659 Bacteria 3734
4 JGI25405J52794_10001945 3300003911 Bacteria 3497
5 JGI25405J52794_10003290 3300003911 Unclassified 2825
6 JGI25405J52794_10005775 3300003911 Bacteria 2245
7 Ga0065704_10016968 3300005289 Unclassified 1746
8 Ga0065704_10021650 3300005289 Unclassified 1748
9 Ga0065712_10012527 3300005290 Bacteria 2617
10 Ga0065712_10106115 3300005290 Bacteria 1924
11 Ga0065712_10130478 3300005290 Unclassified 1555
12 Ga0065712_10362308 3300005290 Bacteria 768
13 Ga0065715_10013663 3300005293 Bacteria 2191
14 Ga0065715_10034859 3300005293 Unclassified 1097
15 Ga0065715_10092216 3300005293 Bacteria 5241
16 Ga0065715_10210809 3300005293 Bacteria 1304
17 Ga0065707_10289683 3300005295 Unclassified 988
18 Ga0070676_10016388 3300005328 Bacteria 4096
19 Ga0070690_100024947 3300005330 Bacteria 3680
20 Ga0070690_100741073 3300005330 Unclassified 758
21 Ga0068869_100090669 3300005334 Bacteria 2298
22 Ga0068868_100026635 3300005338 Bacteria 4409
23 Ga0070660_100096264 3300005339 Bacteria 2341
24 Ga0070660_100143352 3300005339 Bacteria 1918
25 Ga0070660_100314325 3300005339 Unclassified 1286
26 Ga0070689_100063647 3300005340 Bacteria 2870
27 Ga0070687_100009204 3300005343 Bacteria 4223
28 Ga0070687_100289786 3300005343 Bacteria 1034
29 Ga0070668_100053439 3300005347 Bacteria 3115
30 Ga0070668_100164961 3300005347 Bacteria 1800
31 Ga0070669_100014070 3300005353 Bacteria 5690
32 Ga0070669_100822944 3300005353 Unclassified 790
33 Ga0070669_101376371 3300005353 Unclassified 612
34 Ga0070675_100014117 3300005354 Bacteria 6294
35 Ga0070675_100052030 3300005354 Bacteria 3366
36 Ga0070671_100315484 3300005355 Unclassified 1332
37 Ga0070674_100465198 3300005356 Unclassified 1046
38 Ga0070673_100013906 3300005364 Bacteria 5587
39 Ga0070688_100002909 3300005365 Bacteria 8734
40 Ga0070688_100117531 3300005365 Bacteria 1777
41 Ga0070659_100063482 3300005366 Bacteria 2922
42 Ga0070659_100599434 3300005366 Bacteria 947
43 Ga0070667_100022923 3300005367 Bacteria 5176
44 Ga0070709_10357024 3300005434 Unclassified 1081
45 Ga0070714_100028174 3300005435 Bacteria 4657
46 Ga0070714_100986418 3300005435 Unclassified 819
47 Ga0070713_100186959 3300005436 Unclassified 1865
48 Ga0070713_100303021 3300005436 Bacteria 1471
49 Ga0070711_100034274 3300005439 Bacteria 3385
50 Ga0070711_100435901 3300005439 Bacteria 1070
51 Ga0070694_101111696 3300005444 Bacteria 659
52 Ga0070708_100039602 3300005445 Bacteria 4124
53 Ga0070708_100060962 3300005445 Bacteria 3369
54 Ga0070708_100075874 3300005445 Bacteria 3035
55 Ga0070708_100729315 3300005445 Unclassified 932
56 Ga0070662_100003843 3300005457 Bacteria 9407
57 Ga0070681_10064747 3300005458 Bacteria 3625
58 Ga0070685_10017145 3300005466 Bacteria 3873
59 Ga0070706_100071363 3300005467 Bacteria 3212
60 Ga0070706_101628936 3300005467 Unclassified 589
61 Ga0070707_100444518 3300005468 Unclassified 1257
62 Ga0070707_100449996 3300005468 Bacteria 1248
63 Ga0070699_100087948 3300005518 Unclassified 2713
64 Ga0070679_100494308 3300005530 Unclassified 1167
65 Ga0070684_100008739 3300005535 Bacteria 7940
66 Ga0070697_100009878 3300005536 Bacteria 7443
67 Ga0070697_100045133 3300005536 Unclassified 3571
68 Ga0070697_100617087 3300005536 Bacteria 954
69 Ga0070672_100383548 3300005543 Unclassified 1202
70 Ga0070693_101286691 3300005547 Unclassified 565
71 Ga0070665_100163593 3300005548 Unclassified 2227
72 Ga0070665_100295840 3300005548 Unclassified 1621
73 Ga0068855_101743426 3300005563 Unclassified 634
74 Ga0070664_100131337 3300005564 Unclassified 2200
75 Ga0070664_100339708 3300005564 Unclassified 1364
76 Ga0068864_101993780 3300005618 Unclassified 587
77 Ga0068866_10975019 3300005718 Unclassified 601
78 Ga0068861_100154629 3300005719 Unclassified 1885
79 Ga0068861_102116336 3300005719 Unclassified 563
80 Ga0068863_101486392 3300005841 Unclassified 686
81 Ga0068858_100008431 3300005842 Bacteria 9908
82 Ga0068858_102265996 3300005842 Unclassified 537
83 Ga0068860_100028648 3300005843 Bacteria 5361
84 Ga0068860_101405999 3300005843 Unclassified 719
85 Ga0081455_10001323 3300005937 Bacteria 30691
86 Ga0081455_10001390 3300005937 Bacteria 29896
87 Ga0081455_10016344 3300005937 Bacteria 7169
88 Ga0081455_10041310 3300005937 Unclassified 4057
89 Ga0081455_10325070 3300005937 Unclassified 1094
90 Ga0081540_1000196 3300005983 Bacteria 62801
91 Ga0081540_1007057 3300005983 Bacteria 8073
92 Ga0081539_10033155 3300005985 Unclassified 3151
93 Ga0081539_10053030 3300005985 Bacteria 2273
94 Ga0081539_10253996 3300005985 Unclassified 779
95 Ga0070717_11262279 3300006028 Unclassified 672
96 Ga0070715_10047937 3300006163 Unclassified 1824
97 Ga0070715_10450307 3300006163 Bacteria 727
98 Ga0070716_100636466 3300006173 Unclassified 807
99 Ga0070716_101198638 3300006173 Unclassified 610
100 Ga0070716_101721340 3300006173 Unclassified 518
101 Ga0070712_100179072 3300006175 Bacteria 1651
102 Ga0070712_100413534 3300006175 Bacteria 1116
103 Ga0097621_100043840 3300006237 Bacteria 3607
104 Ga0068871_100675170 3300006358 Unclassified 945
105 Ga0075428_100342571 3300006844 Bacteria 1605
106 Ga0075428_100802726 3300006844 Bacteria 1000
107 Ga0075433_10673268 3300006852 Bacteria 907
108 Ga0075434_100072758 3300006871 Bacteria 3429
109 Ga0075434_100219362 3300006871 Bacteria 1921
110 Ga0075435_101671309 3300007076 Unclassified 559
111 Ga0099794_10121247 3300007265 Unclassified 1316
112 Ga0111539_10205777 3300009094 Bacteria 2294
113 Ga0111539_10834189 3300009094 Unclassified 1073
114 Ga0111539_12615479 3300009094 Unclassified 585
115 Ga0105245_10100001 3300009098 Bacteria 2682
116 Ga0114129_10186439 3300009147 Bacteria 2819
117 Ga0114129_10883147 3300009147 Unclassified 1134
118 Ga0114129_13349256 3300009147 Unclassified 517
119 Ga0105243_10230980 3300009148 Bacteria 1641
120 Ga0105242_10383547 3300009176 Bacteria 1307
121 Ga0105242_10464475 3300009176 Bacteria 1196
122 Ga0105242_10504468 3300009176 Unclassified 1151
123 Ga0105242_10645087 3300009176 Bacteria 1029
124 Ga0105248_10883110 3300009177 Unclassified 1009
125 Ga0105249_10037271 3300009553 Bacteria 4413
126 Ga0105249_11993506 3300009553 Unclassified 653
127 Ga0105249_12222038 3300009553 Bacteria 621
128 Ga0099796_10483026 3300010159 Bacteria 554
129 Ga0105239_10013545 3300010375 Bacteria 9053
130 Ga0105239_10283108 3300010375 Bacteria 1867
131 Ga0105239_11870196 3300010375 Unclassified 696
132 Ga0105246_11403606 3300011119 Unclassified 652
133 Ga0105246_12407945 3300011119 Unclassified 516
134 Ga0157314_1012691 3300012500 Bacteria 761
135 Ga0157370_10292817 3300013104 Bacteria 1503
136 Ga0157369_10147017 3300013105 Bacteria 2492
137 Ga0157374_10093423 3300013296 Bacteria 2872
138 Ga0157374_10159284 3300013296 Unclassified 2198
139 Ga0157374_10231540 3300013296 Unclassified 1815
140 Ga0157374_10408428 3300013296 Unclassified 1355
141 Ga0157374_11260202 3300013296 Unclassified 761
142 Ga0157374_11518174 3300013296 Bacteria 693
143 Ga0157378_10022768 3300013297 Bacteria 5514
144 Ga0157378_10982232 3300013297 Unclassified 878
145 Ga0157378_12605647 3300013297 Unclassified 558
146 Ga0163162_10000001 3300013306 Bacteria 751833
147 Ga0163162_10050775 3300013306 Bacteria 4159
148 Ga0163162_10710846 3300013306 Bacteria 1126
149 Ga0163162_10934439 3300013306 Unclassified 979
150 Ga0163162_11728954 3300013306 Unclassified 714
151 Ga0157372_10825154 3300013307 Unclassified 1077
152 Ga0157375_10110313 3300013308 Bacteria 2848
153 Ga0157375_10703738 3300013308 Unclassified 1164
154 Ga0163163_10434975 3300014325 Unclassified 1371
155 Ga0163163_10555644 3300014325 Unclassified 1210
156 Ga0157380_10026011 3300014326 Unclassified 4442
157 Ga0157376_10927737 3300014969 Unclassified 890
158 Ga0163161_10124681 3300017792 Bacteria 1938
159 Ga0207673_1001943 3300025290 Bacteria 2311
160 Ga0207697_10001371 3300025315 Bacteria 13337
161 Ga0207697_10004423 3300025315 Bacteria 6720
162 Ga0207697_10366383 3300025315 Bacteria 640
163 Ga0207692_10233555 3300025898 Bacteria 1095
164 Ga0207692_10406279 3300025898 Unclassified 850
165 Ga0207688_10121572 3300025901 Bacteria 1524
166 Ga0207688_10195563 3300025901 Unclassified 1211
167 Ga0207680_10051547 3300025903 Unclassified 2461
168 Ga0207685_10076977 3300025905 Bacteria 1369
169 Ga0207645_10002029 3300025907 Bacteria 16261
170 Ga0207645_10156009 3300025907 Bacteria 1491
171 Ga0207684_10263550 3300025910 Bacteria 1487
172 Ga0207684_11272693 3300025910 Bacteria 606
173 Ga0207693_10005201 3300025915 Bacteria 10893
174 Ga0207693_10062084 3300025915 Bacteria 2927
175 Ga0207693_10073229 3300025915 Bacteria 2682
176 Ga0207693_10084656 3300025915 Bacteria 2484
177 Ga0207663_10102246 3300025916 Unclassified 1927
178 Ga0207663_10294709 3300025916 Bacteria 1210
179 Ga0207662_10005797 3300025918 Bacteria 6613
180 Ga0207657_10181090 3300025919 Unclassified 1703
181 Ga0207657_10290226 3300025919 Bacteria 1297
182 Ga0207652_10016457 3300025921 Bacteria 6039
183 Ga0207646_10048096 3300025922 Bacteria 3824
184 Ga0207646_10162521 3300025922 Bacteria 2015
185 Ga0207646_11077932 3300025922 Unclassified 708
186 Ga0207681_10217706 3300025923 Unclassified 1475
187 Ga0207659_10026187 3300025926 Bacteria 3932
188 Ga0207659_10032120 3300025926 Bacteria 3600
189 Ga0207700_10197358 3300025928 Unclassified 1694
190 Ga0207700_11263017 3300025928 Unclassified 658
191 Ga0207664_10314162 3300025929 Bacteria 1381
192 Ga0207664_11139938 3300025929 Unclassified 696
193 Ga0207664_11363062 3300025929 Bacteria 630
194 Ga0207690_10119401 3300025932 Bacteria 1912
195 Ga0207690_10442139 3300025932 Bacteria 1044
196 Ga0207706_10004327 3300025933 Bacteria 13329
197 Ga0207706_10285643 3300025933 Bacteria 1439
198 Ga0207686_10390462 3300025934 Bacteria 1057
199 Ga0207686_11286388 3300025934 Unclassified 600
200 Ga0207709_10284828 3300025935 Unclassified 1222
201 Ga0207670_10063830 3300025936 Bacteria 2522
202 Ga0207670_10380885 3300025936 Unclassified 1124
203 Ga0207670_11673338 3300025936 Unclassified 541
204 Ga0207669_10785637 3300025937 Bacteria 789
205 Ga0207704_10054712 3300025938 Bacteria 2435
206 Ga0207704_10317314 3300025938 Unclassified 1201
207 Ga0207665_10351009 3300025939 Bacteria 1113
208 Ga0207665_10941144 3300025939 Unclassified 686
209 Ga0207665_11244358 3300025939 Unclassified 594
210 Ga0207691_10373041 3300025940 Unclassified 1219
211 Ga0207711_10716249 3300025941 Unclassified 933
212 Ga0207689_10226615 3300025942 Bacteria 1545
213 Ga0207689_11020942 3300025942 Unclassified 698
214 Ga0207661_10334500 3300025944 Unclassified 1364
215 Ga0207679_10222013 3300025945 Unclassified 1590
216 Ga0207679_10277829 3300025945 Unclassified 1435
217 Ga0207667_11411777 3300025949 Unclassified 669
218 Ga0207667_11539946 3300025949 Unclassified 635
219 Ga0207651_10106659 3300025960 Unclassified 2092
220 Ga0207712_10000022 3300025961 Bacteria 284365
221 Ga0207712_10018923 3300025961 Bacteria 4493
222 Ga0207712_11564799 3300025961 Unclassified 591
223 Ga0207668_10041625 3300025972 Bacteria 3107
224 Ga0207668_10907468 3300025972 Unclassified 784
225 Ga0207658_10031332 3300025986 Bacteria 3774
226 Ga0207658_11339085 3300025986 Unclassified 655
227 Ga0207677_10117612 3300026023 Bacteria 1993
228 Ga0207677_10462390 3300026023 Unclassified 1089
229 Ga0207703_10760338 3300026035 Unclassified 924
230 Ga0207703_12037159 3300026035 Unclassified 550
231 Ga0207678_10606219 3300026067 Unclassified 960
232 Ga0207678_10720227 3300026067 Bacteria 879
233 Ga0207708_11441331 3300026075 Unclassified 605
234 Ga0207702_10046096 3300026078 Bacteria 3669
235 Ga0207641_12110420 3300026088 Unclassified 564
236 Ga0207683_10025154 3300026121 Bacteria 5134
237 Ga0209974_10082301 3300027876 Unclassified 1109
238 Ga0268265_10014620 3300028380 Bacteria 5351
239 Ga0268264_10063969 3300028381 Bacteria 3095
240 Ga0268264_11862044 3300028381 Unclassified 612
241 Ga0265316_10629108 3300031344 Bacteria 760
242 Ga0373926_0263077 3300035083 Unclassified 670
243 Ga0373934_0042587 3300035086 Unclassified 1794
244 Ga0373923_0110191 3300035111 Unclassified 1222
245 Ga0373953_0044191 3300035117 Bacteria 1781
246 Ga0373953_0514339 3300035117 Unclassified 531
247 Ga0373956_0149811 3300035119 Unclassified 1098
248 Ga0373943_0027058 3300035170 Bacteria 2692
249 Ga0373943_0110350 3300035170 Bacteria 1450
250 Ga0373946_0245557 3300035171 Unclassified 872
251 Ga0373946_0593759 3300035171 Unclassified 574
252 Ga0373955_0264000 3300035172 Unclassified 1034
253 Ga0373924_0336885 3300035410 Unclassified 672
254 Ga0373935_0103562 3300035692 Bacteria 1880
255 Ga0373935_0831308 3300035692 Unclassified 682
256 Ga0373935_1123075 3300035692 Unclassified 585
257 Ga0373927_0331820 3300035695 Bacteria 1002
258 Ga0373927_0430498 3300035695 Bacteria 871
259 Ga0373933_0244499 3300035724 Unclassified 1155
260 Ga0373947_0015772 3300035725 Bacteria 4340
261 Ga0373947_0131143 3300035725 Bacteria 1600
262 Ga0373947_0255211 3300035725 Unclassified 1160
263 Ga0373947_0692445 3300035725 Bacteria 695
264 Ga0373937_0457969 3300036401 Unclassified 1211
265 Ga0373937_1266380 3300036401 Unclassified 686
266 Ga0373925_0098072 3300037068 Bacteria 2249
267 Ga0373925_0171724 3300037068 Bacteria 1712
268 Ga0373925_0298330 3300037068 Unclassified 1301
269 Ga0373925_1130057 3300037068 Unclassified 644
270 Ga0395900_0001895 3300037418 Bacteria 23792
271 Ga0395900_0637667 3300037418 Bacteria 1003
272 Ga0395900_0965830 3300037418 Unclassified 773
273 Ga0395898_0003099 3300037466 Bacteria 18810
274 Ga0395898_0476832 3300037466 Unclassified 1187
275 Ga0395898_0506296 3300037466 Bacteria 1148
276 Ga0395905_0133237 3300037471 Bacteria 2337
277 Ga0395905_0174307 3300037471 Unclassified 2020
278 Ga0395901_0000371 3300038443 Bacteria 53982
279 Ga0451853_0028516 3300041512 Bacteria 1636
280 Ga0439448_0059839 3300042005 Unclassified 1258
281 Ga0439450_126550 3300042008 Unclassified 660
282 Ga0439455_0004722 3300042012 Bacteria 2718
283 Ga0439455_0020004 3300042012 Bacteria 1583
284 Ga0439458_0018641 3300042157 Bacteria 1592
285 Ga0439444_0044806 3300042437 Unclassified 881
286 Ga0439464_0061716 3300042439 Bacteria 1098
287 Ga0453683_0007570 3300044673 Bacteria 7356
288 Ga0453683_0016215 3300044673 Bacteria 4813
289 Ga0453683_0037174 3300044673 Unclassified 3063
290 Ga0453684_0025477 3300044712 Bacteria 8586
291 Ga0453684_0253018 3300044712 Bacteria 2022
292 Ga0466968_0334561 3300044735 Unclassified 733
293 Ga0451576_0055294 3300045051 Bacteria 4153
294 Ga0466967_1387864 3300045976 Unclassified 700
295 Ga0495592_0022814 3300046454 Bacteria 4760
296 Ga0495592_0410089 3300046454 Unclassified 856
297 Ga0495603_0098743 3300046455 Bacteria 1705
298 Ga0495629_0130007 3300046459 Unclassified 1754
299 Ga0495629_0535136 3300046459 Unclassified 787
300 Ga0495641_0574611 3300046461 Unclassified 515
301 Ga0495651_0087861 3300046462 Bacteria 2337
302 Ga0495651_0419293 3300046462 Unclassified 870
303 Ga0495580_0259399 3300046472 Bacteria 1189
304 Ga0495582_0292857 3300046473 Bacteria 935
305 Ga0495639_0223233 3300046475 Unclassified 927
306 Ga0495664_0099095 3300046477 Bacteria 1755
307 Ga0495608_0268889 3300046511 Bacteria 1060
308 Ga0495618_0558823 3300046514 Unclassified 684
309 Ga0495628_0012240 3300046516 Bacteria 7232
310 Ga0495630_0080701 3300046517 Bacteria 2454
311 Ga0495630_0497717 3300046517 Bacteria 934
312 Ga0495666_0564996 3300046526 Unclassified 507
313 Ga0495652_0065704 3300046529 Bacteria 3046
314 Ga0495586_0057853 3300046535 Bacteria 2104
315 Ga0495587_0030224 3300046536 Bacteria 3286
316 Ga0495645_0045527 3300046543 Bacteria 3201
317 Ga0495667_0174456 3300046559 Bacteria 1381
318 Ga0495667_0210427 3300046559 Bacteria 1243
319 Ga0495634_0032382 3300046642 Bacteria 3596
320 Ga0495635_0072370 3300046663 Bacteria 2362
321 Ga0495588_0345902 3300046674 Bacteria 782
322 Ga0495657_0087276 3300046675 Bacteria 2008
323 Ga0495657_0436609 3300046675 Unclassified 768
324 Ga0495599_0028798 3300046678 Bacteria 3480
325 Ga0495623_0039288 3300046679 Bacteria 3025
326 Ga0495646_0039584 3300046680 Bacteria 2905
327 Ga0495647_0409563 3300046681 Unclassified 624
328 Ga0495658_0066942 3300046683 Bacteria 2076
329 Ga0495669_0481960 3300046684 Unclassified 603
330 Ga0495613_0082171 3300046689 Bacteria 2340
331 Ga0495613_0367039 3300046689 Unclassified 986
332 Ga0495624_0384958 3300046690 Bacteria 842
333 Ga0495600_0284668 3300046809 Bacteria 1046
334 Ga0495581_0170976 3300047315 Bacteria 1271
335 Ga0495604_0018871 3300047317 Bacteria 5522
336 Ga0495604_0449305 3300047317 Bacteria 842
337 Ga0495674_0056331 3300047319 Unclassified 3443
338 Ga0495674_0186989 3300047319 Bacteria 1723
339 Ga0495676_0098381 3300047321 Bacteria 2171
340 Ga0495680_0085405 3300047322 Unclassified 2376
341 Ga0495680_0261557 3300047322 Unclassified 1224
342 Ga0495675_0282466 3300047444 Unclassified 989
343 Ga0495684_0005807 3300047471 Bacteria 9596
344 Ga0495602_0075530 3300048088 Bacteria 2860
345 Ga0495614_0085783 3300048089 Bacteria 1367
346 Ga0496100_0659467 3300048903 Unclassified 815
347 Ga0496100_0673113 3300048903 Unclassified 807
348 Ga0496102_0289446 3300048905 Unclassified 1544
349 Ga0496102_0643447 3300048905 Unclassified 983
350 Ga0496102_1567941 3300048905 Unclassified 577
351 Ga0496103_0118887 3300048906 Bacteria 1683
352 Ga0496104_0065517 3300048907 Bacteria 3448
353 Ga0496104_0222499 3300048907 Unclassified 1800
354 Ga0496104_0619457 3300048907 Unclassified 992
355 Ga0496105_0772776 3300048908 Unclassified 732
356 Ga0496106_1195155 3300048909 Unclassified 593
357 Ga0496108_0073609 3300048911 Bacteria 2884
358 Ga0496109_0098314 3300048912 Bacteria 2713
359 Ga0496109_0109234 3300048912 Unclassified 2571
360 Ga0496109_0722596 3300048912 Unclassified 934
361 Ga0496111_0488363 3300048914 Unclassified 907
362 Ga0496112_0071613 3300048915 Bacteria 3426
363 Ga0496112_0503685 3300048915 Bacteria 1146
364 Ga0496112_0511276 3300048915 Unclassified 1136
365 Ga0496112_0560500 3300048915 Unclassified 1076
366 Ga0496112_0913951 3300048915 Unclassified 799
367 Ga0496113_0090192 3300048916 Bacteria 2361
368 Ga0496113_1364613 3300048916 Unclassified 550
369 Ga0496114_0031379 3300048917 Bacteria 4373
370 Ga0496115_0174648 3300048918 Unclassified 1776
371 Ga0496115_0227203 3300048918 Unclassified 1539
372 Ga0501079_0576364 3300049741 Bacteria 885
373 nmdc:mga05p37_319151_c1 3300050507 Bacteria 1839
374 nmdc:mga05p37_469574_c1 3300050507 Bacteria 1452
375 nmdc:mga06r32_1499332_c1 3300050510 Unclassified 614
376 nmdc:mga08y16_323866_c1 3300050511 Bacteria 1586
377 nmdc:mga0n895_627853_c1 3300050512 Unclassified 1075
378 Ga0495601_0019355 3300053077 Bacteria 4152
379 Ga0495612_0106062 3300053078 Bacteria 1200
380 Ga0495595_0234119 3300053084 Unclassified 918
381 Ga0495619_0501990 3300053085 Unclassified 834
382 Ga0495619_0539414 3300053085 Unclassified 801
383 Ga0495619_0597320 3300053085 Bacteria 755
384 Ga0500566_0321694 3300053094 Unclassified 720

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003659 JGI25404J52841_10002044 JGI25404J52841_100020442 96
2 3300005983 Ga0081540_1000196 Ga0081540_100019633 96
3 3300006173 Ga0070716_100636466 Ga0070716_1006364662 100
4 3300005719 Ga0068861_100154629 Ga0068861_1001546291 101
5 3300014326 Ga0157380_10026011 Ga0157380_100260115 101
6 3300025961 Ga0207712_10000022 Ga0207712_1000002234 101
7 3300049741 Ga0501079_0576364 Ga0501079_0576364_46_354 101
8 3300005289 Ga0065704_10016968 Ga0065704_100169683 103
9 3300017792 Ga0163161_10124681 Ga0163161_101246813 104
10 3300009147 Ga0114129_13349256 Ga0114129_133492562 107
11 3300025910 Ga0207684_10263550 Ga0207684_102635502 107
12 3300025922 Ga0207646_10162521 Ga0207646_101625212 107
13 3300005290 Ga0065712_10106115 Ga0065712_101061152 108
14 3300005445 Ga0070708_100060962 Ga0070708_1000609623 108
15 3300005467 Ga0070706_100071363 Ga0070706_1000713633 108
16 3300013306 Ga0163162_10000001 Ga0163162_10000001136 108
17 3300031344 Ga0265316_10629108 Ga0265316_106291082 109
18 3300005444 Ga0070694_101111696 Ga0070694_1011116962 110
19 3300005445 Ga0070708_100729315 Ga0070708_1007293151 111
20 3300005518 Ga0070699_100087948 Ga0070699_1000879484 111
21 3300005536 Ga0070697_100045133 Ga0070697_1000451334 111
22 3300007265 Ga0099794_10121247 Ga0099794_101212473 111
23 3300041512 Ga0451853_0028516 Ga0451853_0028516_379_714 111
24 3300044735 Ga0466968_0334561 Ga0466968_0334561_166_501 111
25 3300045976 Ga0466967_1387864 Ga0466967_1387864_128_463 111
26 3300005289 Ga0065704_10021650 Ga0065704_100216503 112
27 3300005290 Ga0065712_10012527 Ga0065712_100125272 112
28 3300005290 Ga0065712_10130478 Ga0065712_101304782 112
29 3300005290 Ga0065712_10362308 Ga0065712_103623082 112
30 3300005293 Ga0065715_10013663 Ga0065715_100136632 112
31 3300005293 Ga0065715_10034859 Ga0065715_100348592 112
32 3300005293 Ga0065715_10092216 Ga0065715_100922165 112
33 3300005295 Ga0065707_10289683 Ga0065707_102896832 112
34 3300005330 Ga0070690_100024947 Ga0070690_1000249474 112
35 3300005330 Ga0070690_100741073 Ga0070690_1007410731 112
36 3300005339 Ga0070660_100096264 Ga0070660_1000962643 112
37 3300005339 Ga0070660_100314325 Ga0070660_1003143252 112
38 3300005343 Ga0070687_100289786 Ga0070687_1002897861 112
39 3300005347 Ga0070668_100164961 Ga0070668_1001649613 112
40 3300005353 Ga0070669_100822944 Ga0070669_1008229442 112
41 3300005353 Ga0070669_101376371 Ga0070669_1013763712 112
42 3300005354 Ga0070675_100052030 Ga0070675_1000520304 112
43 3300005355 Ga0070671_100315484 Ga0070671_1003154842 112
44 3300005356 Ga0070674_100465198 Ga0070674_1004651981 112
45 3300005364 Ga0070673_100013906 Ga0070673_1000139063 112
46 3300005365 Ga0070688_100117531 Ga0070688_1001175313 112
47 3300005366 Ga0070659_100599434 Ga0070659_1005994342 112
48 3300005434 Ga0070709_10357024 Ga0070709_103570243 112
49 3300005435 Ga0070714_100028174 Ga0070714_1000281744 112
50 3300005435 Ga0070714_100986418 Ga0070714_1009864182 112
51 3300005436 Ga0070713_100186959 Ga0070713_1001869593 112
52 3300005436 Ga0070713_100303021 Ga0070713_1003030212 112
53 3300005439 Ga0070711_100034274 Ga0070711_1000342743 112
54 3300005439 Ga0070711_100435901 Ga0070711_1004359012 112
55 3300005445 Ga0070708_100039602 Ga0070708_1000396025 112
56 3300005458 Ga0070681_10064747 Ga0070681_100647474 112
57 3300005466 Ga0070685_10017145 Ga0070685_100171452 112
58 3300005467 Ga0070706_101628936 Ga0070706_1016289361 112
59 3300005468 Ga0070707_100444518 Ga0070707_1004445182 112
60 3300005530 Ga0070679_100494308 Ga0070679_1004943082 112
61 3300005535 Ga0070684_100008739 Ga0070684_1000087394 112
62 3300005536 Ga0070697_100009878 Ga0070697_1000098783 112
63 3300005536 Ga0070697_100617087 Ga0070697_1006170872 112
64 3300005548 Ga0070665_100163593 Ga0070665_1001635933 112
65 3300005548 Ga0070665_100295840 Ga0070665_1002958402 112
66 3300005564 Ga0070664_100131337 Ga0070664_1001313373 112
67 3300005564 Ga0070664_100339708 Ga0070664_1003397082 112
68 3300005618 Ga0068864_101993780 Ga0068864_1019937801 112
69 3300005718 Ga0068866_10975019 Ga0068866_109750192 112
70 3300005719 Ga0068861_102116336 Ga0068861_1021163361 112
71 3300005841 Ga0068863_101486392 Ga0068863_1014863922 112
72 3300005842 Ga0068858_100008431 Ga0068858_1000084311 112
73 3300005843 Ga0068860_101405999 Ga0068860_1014059992 112
74 3300005937 Ga0081455_10016344 Ga0081455_100163446 112
75 3300005937 Ga0081455_10041310 Ga0081455_100413103 112
76 3300005937 Ga0081455_10325070 Ga0081455_103250703 112
77 3300005985 Ga0081539_10053030 Ga0081539_100530303 112
78 3300005985 Ga0081539_10253996 Ga0081539_102539962 112
79 3300006028 Ga0070717_11262279 Ga0070717_112622791 112
80 3300006163 Ga0070715_10047937 Ga0070715_100479373 112
81 3300006163 Ga0070715_10450307 Ga0070715_104503071 112
82 3300006173 Ga0070716_101721340 Ga0070716_1017213401 112
83 3300006175 Ga0070712_100413534 Ga0070712_1004135342 112
84 3300006237 Ga0097621_100043840 Ga0097621_1000438403 112
85 3300006358 Ga0068871_100675170 Ga0068871_1006751701 112
86 3300006844 Ga0075428_100342571 Ga0075428_1003425712 112
87 3300006852 Ga0075433_10673268 Ga0075433_106732682 112
88 3300006871 Ga0075434_100072758 Ga0075434_1000727584 112
89 3300006871 Ga0075434_100219362 Ga0075434_1002193621 112
90 3300007076 Ga0075435_101671309 Ga0075435_1016713091 112
91 3300009094 Ga0111539_10205777 Ga0111539_102057772 112
92 3300009094 Ga0111539_10834189 Ga0111539_108341892 112
93 3300009147 Ga0114129_10186439 Ga0114129_101864393 112
94 3300009147 Ga0114129_10883147 Ga0114129_108831472 112
95 3300009176 Ga0105242_10383547 Ga0105242_103835472 112
96 3300009176 Ga0105242_10504468 Ga0105242_105044682 112
97 3300009176 Ga0105242_10645087 Ga0105242_106450872 112
98 3300009177 Ga0105248_10883110 Ga0105248_108831102 112
99 3300009553 Ga0105249_11993506 Ga0105249_119935062 112
100 3300009553 Ga0105249_12222038 Ga0105249_122220382 112
101 3300010159 Ga0099796_10483026 Ga0099796_104830261 112
102 3300010375 Ga0105239_10283108 Ga0105239_102831083 112
103 3300010375 Ga0105239_11870196 Ga0105239_118701961 112
104 3300011119 Ga0105246_11403606 Ga0105246_114036062 112
105 3300011119 Ga0105246_12407945 Ga0105246_124079451 112
106 3300012500 Ga0157314_1012691 Ga0157314_10126912 112
107 3300013104 Ga0157370_10292817 Ga0157370_102928172 112
108 3300013105 Ga0157369_10147017 Ga0157369_101470173 112
109 3300013296 Ga0157374_10159284 Ga0157374_101592842 112
110 3300013296 Ga0157374_10231540 Ga0157374_102315403 112
111 3300013296 Ga0157374_10408428 Ga0157374_104084282 112
112 3300013296 Ga0157374_11260202 Ga0157374_112602022 112
113 3300013296 Ga0157374_11518174 Ga0157374_115181741 112
114 3300013297 Ga0157378_10982232 Ga0157378_109822322 112
115 3300013297 Ga0157378_12605647 Ga0157378_126056472 112
116 3300013306 Ga0163162_10710846 Ga0163162_107108462 112
117 3300013306 Ga0163162_10934439 Ga0163162_109344392 112
118 3300013306 Ga0163162_11728954 Ga0163162_117289542 112
119 3300013308 Ga0157375_10703738 Ga0157375_107037383 112
120 3300014325 Ga0163163_10434975 Ga0163163_104349752 112
121 3300014325 Ga0163163_10555644 Ga0163163_105556443 112
122 3300014969 Ga0157376_10927737 Ga0157376_109277372 112
123 3300025315 Ga0207697_10004423 Ga0207697_100044234 112
124 3300025315 Ga0207697_10366383 Ga0207697_103663832 112
125 3300025898 Ga0207692_10233555 Ga0207692_102335552 112
126 3300025901 Ga0207688_10121572 Ga0207688_101215723 112
127 3300025903 Ga0207680_10051547 Ga0207680_100515471 112
128 3300025905 Ga0207685_10076977 Ga0207685_100769771 112
129 3300025907 Ga0207645_10156009 Ga0207645_101560092 112
130 3300025910 Ga0207684_11272693 Ga0207684_112726932 112
131 3300025915 Ga0207693_10062084 Ga0207693_100620843 112
132 3300025915 Ga0207693_10073229 Ga0207693_100732293 112
133 3300025915 Ga0207693_10084656 Ga0207693_100846562 112
134 3300025916 Ga0207663_10102246 Ga0207663_101022462 112
135 3300025916 Ga0207663_10294709 Ga0207663_102947092 112
136 3300025919 Ga0207657_10290226 Ga0207657_102902262 112
137 3300025921 Ga0207652_10016457 Ga0207652_100164573 112
138 3300025922 Ga0207646_11077932 Ga0207646_110779322 112
139 3300025926 Ga0207659_10032120 Ga0207659_100321205 112
140 3300025928 Ga0207700_10197358 Ga0207700_101973583 112
141 3300025928 Ga0207700_11263017 Ga0207700_112630171 112
142 3300025929 Ga0207664_10314162 Ga0207664_103141622 112
143 3300025929 Ga0207664_11139938 Ga0207664_111399381 112
144 3300025929 Ga0207664_11363062 Ga0207664_113630622 112
145 3300025932 Ga0207690_10442139 Ga0207690_104421392 112
146 3300025933 Ga0207706_10285643 Ga0207706_102856432 112
147 3300025934 Ga0207686_10390462 Ga0207686_103904622 112
148 3300025934 Ga0207686_11286388 Ga0207686_112863882 112
149 3300025936 Ga0207670_10380885 Ga0207670_103808853 112
150 3300025936 Ga0207670_11673338 Ga0207670_116733381 112
151 3300025937 Ga0207669_10785637 Ga0207669_107856372 112
152 3300025938 Ga0207704_10054712 Ga0207704_100547122 112
153 3300025939 Ga0207665_10351009 Ga0207665_103510091 112
154 3300025939 Ga0207665_10941144 Ga0207665_109411442 112
155 3300025941 Ga0207711_10716249 Ga0207711_107162492 112
156 3300025942 Ga0207689_11020942 Ga0207689_110209422 112
157 3300025944 Ga0207661_10334500 Ga0207661_103345002 112
158 3300025945 Ga0207679_10222013 Ga0207679_102220132 112
159 3300025945 Ga0207679_10277829 Ga0207679_102778292 112
160 3300025949 Ga0207667_11411777 Ga0207667_114117771 112
161 3300025960 Ga0207651_10106659 Ga0207651_101066591 112
162 3300025961 Ga0207712_11564799 Ga0207712_115647992 112
163 3300025972 Ga0207668_10907468 Ga0207668_109074682 112
164 3300025986 Ga0207658_11339085 Ga0207658_113390852 112
165 3300026023 Ga0207677_10117612 Ga0207677_101176122 112
166 3300026035 Ga0207703_10760338 Ga0207703_107603382 112
167 3300026067 Ga0207678_10606219 Ga0207678_106062193 112
168 3300026067 Ga0207678_10720227 Ga0207678_107202272 112
169 3300026078 Ga0207702_10046096 Ga0207702_100460963 112
170 3300026088 Ga0207641_12110420 Ga0207641_121104202 112
171 3300026121 Ga0207683_10025154 Ga0207683_100251544 112
172 3300028381 Ga0268264_11862044 Ga0268264_118620442 112
173 3300035083 Ga0373926_0263077 Ga0373926_0263077_193_531 112
174 3300035086 Ga0373934_0042587 Ga0373934_0042587_151_489 112
175 3300035111 Ga0373923_0110191 Ga0373923_0110191_680_1018 112
176 3300035117 Ga0373953_0044191 Ga0373953_0044191_663_1001 112
177 3300035117 Ga0373953_0514339 Ga0373953_0514339_81_419 112
178 3300035119 Ga0373956_0149811 Ga0373956_0149811_147_485 112
179 3300035170 Ga0373943_0027058 Ga0373943_0027058_752_1090 112
180 3300035170 Ga0373943_0110350 Ga0373943_0110350_920_1258 112
181 3300035171 Ga0373946_0245557 Ga0373946_0245557_413_751 112
182 3300035171 Ga0373946_0593759 Ga0373946_0593759_144_482 112
183 3300035172 Ga0373955_0264000 Ga0373955_0264000_215_553 112
184 3300035410 Ga0373924_0336885 Ga0373924_0336885_212_550 112
185 3300035692 Ga0373935_0103562 Ga0373935_0103562_1252_1590 112
186 3300035692 Ga0373935_0831308 Ga0373935_0831308_203_541 112
187 3300035692 Ga0373935_1123075 Ga0373935_1123075_33_371 112
188 3300035695 Ga0373927_0331820 Ga0373927_0331820_58_396 112
189 3300035695 Ga0373927_0430498 Ga0373927_0430498_445_783 112
190 3300035724 Ga0373933_0244499 Ga0373933_0244499_13_351 112
191 3300035725 Ga0373947_0015772 Ga0373947_0015772_3098_3436 112
192 3300035725 Ga0373947_0131143 Ga0373947_0131143_446_784 112
193 3300035725 Ga0373947_0255211 Ga0373947_0255211_795_1133 112
194 3300035725 Ga0373947_0692445 Ga0373947_0692445_301_639 112
195 3300036401 Ga0373937_0457969 Ga0373937_0457969_150_488 112
196 3300036401 Ga0373937_1266380 Ga0373937_1266380_228_566 112
197 3300037068 Ga0373925_0098072 Ga0373925_0098072_813_1151 112
198 3300037068 Ga0373925_0171724 Ga0373925_0171724_1238_1576 112
199 3300037068 Ga0373925_0298330 Ga0373925_0298330_237_575 112
200 3300037068 Ga0373925_1130057 Ga0373925_1130057_215_553 112
201 3300042005 Ga0439448_0059839 Ga0439448_0059839_825_1163 112
202 3300042008 Ga0439450_126550 Ga0439450_126550_243_581 112
203 3300042012 Ga0439455_0004722 Ga0439455_0004722_181_519 112
204 3300042012 Ga0439455_0020004 Ga0439455_0020004_814_1152 112
205 3300042157 Ga0439458_0018641 Ga0439458_0018641_1178_1516 112
206 3300042437 Ga0439444_0044806 Ga0439444_0044806_513_851 112
207 3300042439 Ga0439464_0061716 Ga0439464_0061716_629_967 112
208 3300044673 Ga0453683_0016215 Ga0453683_0016215_1171_1509 112
209 3300044712 Ga0453684_0253018 Ga0453684_0253018_377_715 112
210 3300046454 Ga0495592_0022814 Ga0495592_0022814_455_793 112
211 3300046454 Ga0495592_0410089 Ga0495592_0410089_469_807 112
212 3300046455 Ga0495603_0098743 Ga0495603_0098743_853_1191 112
213 3300046459 Ga0495629_0130007 Ga0495629_0130007_673_1011 112
214 3300046459 Ga0495629_0535136 Ga0495629_0535136_158_496 112
215 3300046461 Ga0495641_0574611 Ga0495641_0574611_140_478 112
216 3300046462 Ga0495651_0087861 Ga0495651_0087861_1876_2214 112
217 3300046462 Ga0495651_0419293 Ga0495651_0419293_62_400 112
218 3300046472 Ga0495580_0259399 Ga0495580_0259399_28_366 112
219 3300046473 Ga0495582_0292857 Ga0495582_0292857_398_736 112
220 3300046475 Ga0495639_0223233 Ga0495639_0223233_52_390 112
221 3300046477 Ga0495664_0099095 Ga0495664_0099095_1336_1674 112
222 3300046511 Ga0495608_0268889 Ga0495608_0268889_329_667 112
223 3300046514 Ga0495618_0558823 Ga0495618_0558823_176_514 112
224 3300046516 Ga0495628_0012240 Ga0495628_0012240_4474_4812 112
225 3300046517 Ga0495630_0080701 Ga0495630_0080701_1292_1630 112
226 3300046517 Ga0495630_0497717 Ga0495630_0497717_271_609 112
227 3300046526 Ga0495666_0564996 Ga0495666_0564996_53_391 112
228 3300046529 Ga0495652_0065704 Ga0495652_0065704_1466_1804 112
229 3300046535 Ga0495586_0057853 Ga0495586_0057853_1290_1628 112
230 3300046536 Ga0495587_0030224 Ga0495587_0030224_2146_2484 112
231 3300046543 Ga0495645_0045527 Ga0495645_0045527_287_625 112
232 3300046559 Ga0495667_0174456 Ga0495667_0174456_329_667 112
233 3300046559 Ga0495667_0210427 Ga0495667_0210427_712_1050 112
234 3300046642 Ga0495634_0032382 Ga0495634_0032382_2283_2621 112
235 3300046663 Ga0495635_0072370 Ga0495635_0072370_992_1330 112
236 3300046674 Ga0495588_0345902 Ga0495588_0345902_374_712 112
237 3300046675 Ga0495657_0087276 Ga0495657_0087276_632_970 112
238 3300046675 Ga0495657_0436609 Ga0495657_0436609_329_667 112
239 3300046678 Ga0495599_0028798 Ga0495599_0028798_2857_3195 112
240 3300046679 Ga0495623_0039288 Ga0495623_0039288_89_427 112
241 3300046680 Ga0495646_0039584 Ga0495646_0039584_1168_1506 112
242 3300046681 Ga0495647_0409563 Ga0495647_0409563_61_399 112
243 3300046683 Ga0495658_0066942 Ga0495658_0066942_465_803 112
244 3300046684 Ga0495669_0481960 Ga0495669_0481960_70_408 112
245 3300046689 Ga0495613_0082171 Ga0495613_0082171_1829_2167 112
246 3300046689 Ga0495613_0367039 Ga0495613_0367039_200_538 112
247 3300046690 Ga0495624_0384958 Ga0495624_0384958_179_517 112
248 3300046809 Ga0495600_0284668 Ga0495600_0284668_339_677 112
249 3300047315 Ga0495581_0170976 Ga0495581_0170976_55_393 112
250 3300047317 Ga0495604_0018871 Ga0495604_0018871_3993_4331 112
251 3300047317 Ga0495604_0449305 Ga0495604_0449305_92_430 112
252 3300047319 Ga0495674_0056331 Ga0495674_0056331_2108_2446 112
253 3300047319 Ga0495674_0186989 Ga0495674_0186989_1131_1469 112
254 3300047321 Ga0495676_0098381 Ga0495676_0098381_1784_2122 112
255 3300047322 Ga0495680_0085405 Ga0495680_0085405_954_1292 112
256 3300047322 Ga0495680_0261557 Ga0495680_0261557_416_754 112
257 3300047444 Ga0495675_0282466 Ga0495675_0282466_613_951 112
258 3300047471 Ga0495684_0005807 Ga0495684_0005807_2143_2481 112
259 3300048088 Ga0495602_0075530 Ga0495602_0075530_1015_1353 112
260 3300048089 Ga0495614_0085783 Ga0495614_0085783_514_852 112
261 3300048903 Ga0496100_0659467 Ga0496100_0659467_281_619 112
262 3300048903 Ga0496100_0673113 Ga0496100_0673113_65_403 112
263 3300048905 Ga0496102_0289446 Ga0496102_0289446_289_627 112
264 3300048905 Ga0496102_0643447 Ga0496102_0643447_412_750 112
265 3300048905 Ga0496102_1567941 Ga0496102_1567941_38_376 112
266 3300048906 Ga0496103_0118887 Ga0496103_0118887_609_947 112
267 3300048907 Ga0496104_0065517 Ga0496104_0065517_2499_2837 112
268 3300048907 Ga0496104_0222499 Ga0496104_0222499_1189_1527 112
269 3300048907 Ga0496104_0619457 Ga0496104_0619457_518_856 112
270 3300048908 Ga0496105_0772776 Ga0496105_0772776_20_358 112
271 3300048909 Ga0496106_1195155 Ga0496106_1195155_167_505 112
272 3300048911 Ga0496108_0073609 Ga0496108_0073609_1618_1956 112
273 3300048912 Ga0496109_0098314 Ga0496109_0098314_1039_1377 112
274 3300048912 Ga0496109_0109234 Ga0496109_0109234_708_1046 112
275 3300048914 Ga0496111_0488363 Ga0496111_0488363_146_484 112
276 3300048915 Ga0496112_0071613 Ga0496112_0071613_2683_3021 112
277 3300048915 Ga0496112_0511276 Ga0496112_0511276_325_663 112
278 3300048915 Ga0496112_0560500 Ga0496112_0560500_133_471 112
279 3300048915 Ga0496112_0913951 Ga0496112_0913951_295_633 112
280 3300048916 Ga0496113_0090192 Ga0496113_0090192_898_1236 112
281 3300048917 Ga0496114_0031379 Ga0496114_0031379_2636_2974 112
282 3300048918 Ga0496115_0174648 Ga0496115_0174648_10_348 112
283 3300048918 Ga0496115_0227203 Ga0496115_0227203_266_604 112
284 3300050507 nmdc:mga05p37_319151_c1 nmdc:mga05p37_319151_c1_467_805 112
285 3300050507 nmdc:mga05p37_469574_c1 nmdc:mga05p37_469574_c1_1100_1438 112
286 3300050510 nmdc:mga06r32_1499332_c1 nmdc:mga06r32_1499332_c1_186_524 112
287 3300050511 nmdc:mga08y16_323866_c1 nmdc:mga08y16_323866_c1_20_358 112
288 3300050512 nmdc:mga0n895_627853_c1 nmdc:mga0n895_627853_c1_535_873 112
289 3300053077 Ga0495601_0019355 Ga0495601_0019355_2575_2913 112
290 3300053078 Ga0495612_0106062 Ga0495612_0106062_27_365 112
291 3300053084 Ga0495595_0234119 Ga0495595_0234119_120_458 112
292 3300053085 Ga0495619_0501990 Ga0495619_0501990_326_664 112
293 3300053085 Ga0495619_0539414 Ga0495619_0539414_147_485 112
294 3300053085 Ga0495619_0597320 Ga0495619_0597320_337_675 112
295 3300053094 Ga0500566_0321694 Ga0500566_0321694_227_565 112
296 3300002070 JGI24750J21931_1035204 JGI24750J21931_10352042 113
297 3300002126 JGI24035J26624_1002017 JGI24035J26624_10020172 113
298 3300003911 JGI25405J52794_10001945 JGI25405J52794_100019452 113
299 3300003911 JGI25405J52794_10003290 JGI25405J52794_100032903 113
300 3300003911 JGI25405J52794_10005775 JGI25405J52794_100057753 113
301 3300005293 Ga0065715_10210809 Ga0065715_102108092 113
302 3300005328 Ga0070676_10016388 Ga0070676_100163883 113
303 3300005334 Ga0068869_100090669 Ga0068869_1000906691 113
304 3300005338 Ga0068868_100026635 Ga0068868_1000266353 113
305 3300005339 Ga0070660_100143352 Ga0070660_1001433523 113
306 3300005340 Ga0070689_100063647 Ga0070689_1000636471 113
307 3300005343 Ga0070687_100009204 Ga0070687_1000092043 113
308 3300005347 Ga0070668_100053439 Ga0070668_1000534393 113
309 3300005353 Ga0070669_100014070 Ga0070669_1000140705 113
310 3300005354 Ga0070675_100014117 Ga0070675_1000141175 113
311 3300005365 Ga0070688_100002909 Ga0070688_10000290912 113
312 3300005366 Ga0070659_100063482 Ga0070659_1000634823 113
313 3300005367 Ga0070667_100022923 Ga0070667_1000229235 113
314 3300005445 Ga0070708_100075874 Ga0070708_1000758743 113
315 3300005457 Ga0070662_100003843 Ga0070662_1000038436 113
316 3300005468 Ga0070707_100449996 Ga0070707_1004499962 113
317 3300005543 Ga0070672_100383548 Ga0070672_1003835482 113
318 3300005547 Ga0070693_101286691 Ga0070693_1012866911 113
319 3300005563 Ga0068855_101743426 Ga0068855_1017434262 113
320 3300005842 Ga0068858_102265996 Ga0068858_1022659961 113
321 3300005843 Ga0068860_100028648 Ga0068860_1000286484 113
322 3300005937 Ga0081455_10001323 Ga0081455_1000132329 113
323 3300005937 Ga0081455_10001390 Ga0081455_100013903 113
324 3300005983 Ga0081540_1007057 Ga0081540_100705710 113
325 3300005985 Ga0081539_10033155 Ga0081539_100331553 113
326 3300006173 Ga0070716_101198638 Ga0070716_1011986382 113
327 3300006175 Ga0070712_100179072 Ga0070712_1001790722 113
328 3300006844 Ga0075428_100802726 Ga0075428_1008027262 113
329 3300009094 Ga0111539_12615479 Ga0111539_126154792 113
330 3300009098 Ga0105245_10100001 Ga0105245_101000013 113
331 3300009148 Ga0105243_10230980 Ga0105243_102309801 113
332 3300009176 Ga0105242_10464475 Ga0105242_104644753 113
333 3300009553 Ga0105249_10037271 Ga0105249_100372713 113
334 3300010375 Ga0105239_10013545 Ga0105239_100135454 113
335 3300013296 Ga0157374_10093423 Ga0157374_100934232 113
336 3300013297 Ga0157378_10022768 Ga0157378_100227684 113
337 3300013306 Ga0163162_10050775 Ga0163162_100507753 113
338 3300013307 Ga0157372_10825154 Ga0157372_108251542 113
339 3300013308 Ga0157375_10110313 Ga0157375_101103134 113
340 3300025290 Ga0207673_1001943 Ga0207673_10019432 113
341 3300025315 Ga0207697_10001371 Ga0207697_100013714 113
342 3300025898 Ga0207692_10406279 Ga0207692_104062792 113
343 3300025901 Ga0207688_10195563 Ga0207688_101955632 113
344 3300025907 Ga0207645_10002029 Ga0207645_100020295 113
345 3300025915 Ga0207693_10005201 Ga0207693_100052013 113
346 3300025918 Ga0207662_10005797 Ga0207662_100057974 113
347 3300025919 Ga0207657_10181090 Ga0207657_101810902 113
348 3300025922 Ga0207646_10048096 Ga0207646_100480962 113
349 3300025923 Ga0207681_10217706 Ga0207681_102177062 113
350 3300025926 Ga0207659_10026187 Ga0207659_100261874 113
351 3300025932 Ga0207690_10119401 Ga0207690_101194012 113
352 3300025933 Ga0207706_10004327 Ga0207706_100043279 113
353 3300025935 Ga0207709_10284828 Ga0207709_102848281 113
354 3300025936 Ga0207670_10063830 Ga0207670_100638301 113
355 3300025938 Ga0207704_10317314 Ga0207704_103173142 113
356 3300025939 Ga0207665_11244358 Ga0207665_112443581 113
357 3300025940 Ga0207691_10373041 Ga0207691_103730412 113
358 3300025942 Ga0207689_10226615 Ga0207689_102266152 113
359 3300025949 Ga0207667_11539946 Ga0207667_115399462 113
360 3300025961 Ga0207712_10018923 Ga0207712_100189233 113
361 3300025972 Ga0207668_10041625 Ga0207668_100416253 113
362 3300025986 Ga0207658_10031332 Ga0207658_100313323 113
363 3300026023 Ga0207677_10462390 Ga0207677_104623902 113
364 3300026035 Ga0207703_12037159 Ga0207703_120371591 113
365 3300026075 Ga0207708_11441331 Ga0207708_114413311 113
366 3300027876 Ga0209974_10082301 Ga0209974_100823012 113
367 3300028380 Ga0268265_10014620 Ga0268265_100146205 113
368 3300028381 Ga0268264_10063969 Ga0268264_100639695 113
369 3300037418 Ga0395900_0001895 Ga0395900_0001895_3867_4208 113
370 3300037418 Ga0395900_0637667 Ga0395900_0637667_649_990 113
371 3300037418 Ga0395900_0965830 Ga0395900_0965830_293_634 113
372 3300037466 Ga0395898_0003099 Ga0395898_0003099_7898_8239 113
373 3300037466 Ga0395898_0476832 Ga0395898_0476832_345_686 113
374 3300037466 Ga0395898_0506296 Ga0395898_0506296_152_493 113
375 3300037471 Ga0395905_0133237 Ga0395905_0133237_1729_2070 113
376 3300037471 Ga0395905_0174307 Ga0395905_0174307_1401_1742 113
377 3300038443 Ga0395901_0000371 Ga0395901_0000371_44355_44696 113
378 3300044673 Ga0453683_0007570 Ga0453683_0007570_5810_6166 113
379 3300044673 Ga0453683_0037174 Ga0453683_0037174_135_485 113
380 3300044712 Ga0453684_0025477 Ga0453684_0025477_2500_2850 113
381 3300045051 Ga0451576_0055294 Ga0451576_0055294_540_881 113
382 3300048912 Ga0496109_0722596 Ga0496109_0722596_267_632 113
383 3300048915 Ga0496112_0503685 Ga0496112_0503685_634_999 113
384 3300048916 Ga0496113_1364613 Ga0496113_1364613_142_507 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

1

85

0.97

PF08534

Redoxin

Redoxin

2

101

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9225 4 58
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9197 4 58
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9169 4 58
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.8513 2 68
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.7534 3 106
ID Description Score Start End Superfamily
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9188 4 58 3.40.30.10
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7647 9 64 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7518 2 110 3.40.30.10
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7402 3 106 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7196 3 106 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A838F5H2-F1-model_v4 Redoxin domain-containing protein 0.952 1 55 GO:0016209
GO:0016491
AF-A0A817N411-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.9444 3 58 GO:0016209
GO:0016491
AF-A0A562JS45-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.944 1 59 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A379GF01-F1-model_v4 Thioredoxin-dependent peroxiredoxin Bcp 0.9397 4 56 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A3M0YUJ4-F1-model_v4 Peroxiredoxin 0.9392 1 54 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
68.75 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map